F480423

General Info

Members Datasets Scaffolds Average Seq Length
778 443 1556 300

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0009337|Ga0466961_0009337_279_1271
Length 320
Sequence VELGMVGLGRMGANMAERLRRGGHTVVGFDRSEQSPRDVASLEELVGRLAAPRAVWVMVPAGPPTYETVDALAGLLEPGDVVVDGGNSRYTDDIRHADDLAERGIGFVDCGVSGGVWGLTEGYALMVGGDPEHVERLTPVFQTLKPEGEFGFVHAGKVGAGHFAKMVHNGIEYGLMQAYAEGWELLETTELVTDVREVMRSWQRGTVIRSWLLDLAVRALDTDEHLDELRGFAQDSGEGRWTVQAAIDHAVPLPVITAALFARFASRQEDSPAMKMIAALRNQFGGHPVTAAAGSTERGADAPGADAQPXXRSARAADPH

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
119 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
260 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
263 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
264 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
267 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
268 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
269 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
270 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
370 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
397 2501939600 Micromonospora sp. L5 Isolate Unclassified
398 2643221559 Lysobacter sp. Root559 Isolate Unclassified
399 2643221573 Lysobacter sp. Root604 Isolate Unclassified
400 2643221586 Lysobacter sp. Root667 Isolate Unclassified
401 2643221612 Lysobacter sp. Root76 Isolate Unclassified
402 2643221720 Lysobacter sp. Root916 Isolate Unclassified
403 2643221727 Lysobacter sp. Root96 Isolate Unclassified
404 2643221728 Lysobacter sp. Root983 Isolate Unclassified
405 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
406 2818991457 Xanthomonas translucens 569 Isolate Unclassified
407 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
408 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
409 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
410 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
411 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
412 2855683550 Micromonospora sp. RP3T Isolate Unclassified
413 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
414 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
415 2858882152 Micromonospora noduli MED15 Isolate Nodule
416 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
417 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
418 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
419 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
420 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
421 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
422 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
423 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
424 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
425 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
426 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
427 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
428 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
429 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
430 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
431 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
432 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
433 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
434 649633069 Micromonospora sp. L5 Isolate Unclassified
435 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
436 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
437 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
438 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
439 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
440 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
441 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
442 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
443 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0.9
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0.64
Rhizoplane 3.6
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0009337 3300044693 Bacteria 6248
2 SwRhRL2b_contig_1635563 2162886007 Bacteria 2400
3 SwRhRL2b_contig_3910350 2162886007 Bacteria 2434
4 JGI24740J21852_10000250 3300001979 Bacteria 22866
5 JGI24740J21852_10010858 3300001979 Bacteria 3486
6 JGI24739J22299_10000012 3300001989 Bacteria 53158
7 JGI24739J22299_10002821 3300001989 Bacteria 6671
8 JGI24737J22298_10001747 3300001990 Bacteria 7759
9 JGI24737J22298_10008646 3300001990 Bacteria 3405
10 JGI24735J21928_10017831 3300002067 Bacteria 2193
11 Ga0006562J51391_1109942 3300003578 Bacteria 4463
12 Ga0007429J51699_1109887 3300003579 Bacteria 1148
13 Ga0055537_1001342 3300003773 Bacteria 9995
14 Ga0055524_1011706 3300003775 Bacteria 3412
15 Ga0055536_1002027 3300003781 Bacteria 11611
16 Ga0055536_1002102 3300003781 Bacteria 11340
17 Ga0055536_1014122 3300003781 Bacteria 2828
18 Ga0055534_1000145 3300003784 Bacteria 52879
19 Ga0055528_1002402 3300003790 Bacteria 10077
20 Ga0055530_10001996 3300003791 Bacteria 13846
21 Ga0055531_10002315 3300003794 Bacteria 12863
22 Ga0055531_10002729 3300003794 Bacteria 11611
23 Ga0055531_10002839 3300003794 Bacteria 11340
24 Ga0055531_10006904 3300003794 Bacteria 6322
25 Ga0058863_11891516 3300004799 Bacteria 1492
26 Ga0065704_10070903 3300005289 Bacteria 14826
27 Ga0065704_10071727 3300005289 Bacteria 10107
28 Ga0065704_10081660 3300005289 Bacteria 3722
29 Ga0070658_10021153 3300005327 Bacteria 5211
30 Ga0070658_10216472 3300005327 Bacteria 1619
31 Ga0070676_10018097 3300005328 Bacteria 3901
32 Ga0070683_100041323 3300005329 Bacteria 4242
33 Ga0070683_100135494 3300005329 Bacteria 2332
34 Ga0070683_100200791 3300005329 Bacteria 1893
35 Ga0070690_100030291 3300005330 Bacteria 3361
36 Ga0070690_100054963 3300005330 Bacteria 2549
37 Ga0070670_100020864 3300005331 Bacteria 5634
38 Ga0070670_100099618 3300005331 Bacteria 2501
39 Ga0068869_100011504 3300005334 Bacteria 5805
40 Ga0068869_100078456 3300005334 Bacteria 2459
41 Ga0070666_10000336 3300005335 Bacteria 29577
42 Ga0070666_10038826 3300005335 Bacteria 3170
43 Ga0070666_10039545 3300005335 Bacteria 3144
44 Ga0070680_100000521 3300005336 Bacteria 26265
45 Ga0070680_100214504 3300005336 Bacteria 1624
46 Ga0070682_100034816 3300005337 Bacteria 3070
47 Ga0068868_100037042 3300005338 Bacteria 3779
48 Ga0070660_100241763 3300005339 Bacteria 1470
49 Ga0070689_100071385 3300005340 Bacteria 2712
50 Ga0070689_100205918 3300005340 Bacteria 1608
51 Ga0070687_100017441 3300005343 Bacteria 3301
52 Ga0070661_100007788 3300005344 Bacteria 7393
53 Ga0070661_100072732 3300005344 Bacteria 2530
54 Ga0070661_100175851 3300005344 Bacteria 1627
55 Ga0070692_10046297 3300005345 Bacteria 2247
56 Ga0070668_100021819 3300005347 Bacteria 4838
57 Ga0070668_100151413 3300005347 Bacteria 1876
58 Ga0070668_100191903 3300005347 Bacteria 1673
59 Ga0070668_100250911 3300005347 Bacteria 1469
60 Ga0070669_100004478 3300005353 Bacteria 10069
61 Ga0070669_100020335 3300005353 Bacteria 4741
62 Ga0070675_100361772 3300005354 Bacteria 1288
63 Ga0070675_100477655 3300005354 Bacteria 1121
64 Ga0070671_100029011 3300005355 Bacteria 4561
65 Ga0070671_100065696 3300005355 Bacteria 3022
66 Ga0070671_100379732 3300005355 Bacteria 1208
67 Ga0070674_100114597 3300005356 Bacteria 1985
68 Ga0070673_100202626 3300005364 Bacteria 1709
69 Ga0070673_100318912 3300005364 Bacteria 1372
70 Ga0070688_100124551 3300005365 Bacteria 1731
71 Ga0070659_100000095 3300005366 Bacteria 66495
72 Ga0070659_100105722 3300005366 Bacteria 2268
73 Ga0070659_100233657 3300005366 Bacteria 1520
74 Ga0070667_100000136 3300005367 Bacteria 93545
75 Ga0070667_100045174 3300005367 Bacteria 3703
76 Ga0070709_10000583 3300005434 Bacteria 21361
77 Ga0070709_10203735 3300005434 Bacteria 1402
78 Ga0070714_100000055 3300005435 Bacteria 103321
79 Ga0070714_100041169 3300005435 Bacteria 3897
80 Ga0070714_100048821 3300005435 Bacteria 3601
81 Ga0070713_100000192 3300005436 Bacteria 40641
82 Ga0070713_100011442 3300005436 Bacteria 6463
83 Ga0070713_100057458 3300005436 Bacteria 3240
84 Ga0070710_10000874 3300005437 Bacteria 14417
85 Ga0070701_10005657 3300005438 Bacteria 5187
86 Ga0070711_100006472 3300005439 Bacteria 7063
87 Ga0070711_100208892 3300005439 Bacteria 1511
88 Ga0070705_100108537 3300005440 Bacteria 1768
89 Ga0070700_100012262 3300005441 Bacteria 4777
90 Ga0070694_100032295 3300005444 Bacteria 3438
91 Ga0070708_100046121 3300005445 Bacteria 3845
92 Ga0070663_100044966 3300005455 Bacteria 3117
93 Ga0070663_100330185 3300005455 Bacteria 1229
94 Ga0070678_100227815 3300005456 Bacteria 1552
95 Ga0070662_100028877 3300005457 Bacteria 3865
96 Ga0070662_100064481 3300005457 Bacteria 2683
97 Ga0070681_10000094 3300005458 Bacteria 65410
98 Ga0068867_100073625 3300005459 Bacteria 2558
99 Ga0068867_100179642 3300005459 Bacteria 1682
100 Ga0068867_100211896 3300005459 Bacteria 1556
101 Ga0070685_10004987 3300005466 Bacteria 6721
102 Ga0070685_10014623 3300005466 Bacteria 4159
103 Ga0070706_100005686 3300005467 Bacteria 11854
104 Ga0070706_100077409 3300005467 Bacteria 3078
105 Ga0070707_100004091 3300005468 Bacteria 13690
106 Ga0070707_100016100 3300005468 Bacteria 7015
107 Ga0070707_100020363 3300005468 Bacteria 6256
108 Ga0070707_100030221 3300005468 Bacteria 5156
109 Ga0070698_100004075 3300005471 Bacteria 16059
110 Ga0070698_100076866 3300005471 Bacteria 3339
111 Ga0070698_100119149 3300005471 Bacteria 2600
112 Ga0070699_100106053 3300005518 Bacteria 2465
113 Ga0070699_100261212 3300005518 Bacteria 1548
114 Ga0070679_100000137 3300005530 Bacteria 59366
115 Ga0070679_100012389 3300005530 Bacteria 8148
116 Ga0070679_100150868 3300005530 Bacteria 2301
117 Ga0070684_100105923 3300005535 Bacteria 2517
118 Ga0070697_100021408 3300005536 Bacteria 5122
119 Ga0068853_100012399 3300005539 Bacteria 6935
120 Ga0068853_100024322 3300005539 Bacteria 5077
121 Ga0068853_100048715 3300005539 Bacteria 3640
122 Ga0070672_100035303 3300005543 Bacteria 3800
123 Ga0070672_100051332 3300005543 Bacteria 3216
124 Ga0070696_100011608 3300005546 Bacteria 5902
125 Ga0070665_100036904 3300005548 Bacteria 4914
126 Ga0070665_100050311 3300005548 Bacteria 4181
127 Ga0070665_100068287 3300005548 Bacteria 3564
128 Ga0070665_100069489 3300005548 Bacteria 3530
129 Ga0068855_100002493 3300005563 Bacteria 22680
130 Ga0070664_100006215 3300005564 Bacteria 9650
131 Ga0070664_100110304 3300005564 Bacteria 2401
132 Ga0070664_100175797 3300005564 Bacteria 1901
133 Ga0070664_100374402 3300005564 Bacteria 1299
134 Ga0068857_100012030 3300005577 Bacteria 7526
135 Ga0068857_100032517 3300005577 Bacteria 4613
136 Ga0068857_100090442 3300005577 Bacteria 2739
137 Ga0068857_100099890 3300005577 Bacteria 2603
138 Ga0068854_100003465 3300005578 Bacteria 9850
139 Ga0068854_100132061 3300005578 Bacteria 1907
140 Ga0068854_100269397 3300005578 Bacteria 1367
141 Ga0068856_100047281 3300005614 Bacteria 4239
142 Ga0068856_100198126 3300005614 Bacteria 2023
143 Ga0068852_100012623 3300005616 Bacteria 6423
144 Ga0068859_100104964 3300005617 Bacteria 2885
145 Ga0068859_100130326 3300005617 Bacteria 2586
146 Ga0068859_100147891 3300005617 Bacteria 2424
147 Ga0068864_100005730 3300005618 Bacteria 10187
148 Ga0068866_10018133 3300005718 Bacteria 3178
149 Ga0068866_10147481 3300005718 Bacteria 1358
150 Ga0068861_100021164 3300005719 Bacteria 4673
151 Ga0068861_100030924 3300005719 Bacteria 3928
152 Ga0068851_10002784 3300005834 Bacteria 7706
153 Ga0068851_10003762 3300005834 Bacteria 6784
154 Ga0068870_10008660 3300005840 Bacteria 4587
155 Ga0068870_10016335 3300005840 Bacteria 3544
156 Ga0068870_10031355 3300005840 Bacteria 2693
157 Ga0068863_100020956 3300005841 Bacteria 6243
158 Ga0068863_100022890 3300005841 Bacteria 5971
159 Ga0068858_100146677 3300005842 Bacteria 2216
160 Ga0068860_100001168 3300005843 Bacteria 28767
161 Ga0068860_100007627 3300005843 Bacteria 10827
162 Ga0068860_100062025 3300005843 Bacteria 3552
163 Ga0068860_100127223 3300005843 Bacteria 2442
164 Ga0068860_100177584 3300005843 Bacteria 2058
165 Ga0068862_100009976 3300005844 Bacteria 7848
166 Ga0068862_100041565 3300005844 Bacteria 3912
167 Ga0081539_10000070 3300005985 Bacteria 235651
168 Ga0075364_10119615 3300006051 Bacteria 1763
169 Ga0070716_100007909 3300006173 Bacteria 5262
170 Ga0070712_100007728 3300006175 Bacteria 6727
171 Ga0075367_10110869 3300006178 Bacteria 1684
172 Ga0097621_100026821 3300006237 Bacteria 4524
173 Ga0097621_100047064 3300006237 Bacteria 3493
174 Ga0097621_100181557 3300006237 Bacteria 1818
175 Ga0068871_100006433 3300006358 Bacteria 8310
176 Ga0075428_100000293 3300006844 Bacteria 48891
177 Ga0075428_100394845 3300006844 Bacteria 1483
178 Ga0075430_100011687 3300006846 Bacteria 7471
179 Ga0075431_100000530 3300006847 Bacteria 31979
180 Ga0075431_100039148 3300006847 Bacteria 4884
181 Ga0075431_100250531 3300006847 Bacteria 1799
182 Ga0075431_100368611 3300006847 Bacteria 1442
183 Ga0075434_100059401 3300006871 Bacteria 3801
184 Ga0075434_100222164 3300006871 Bacteria 1909
185 Ga0075429_100002723 3300006880 Bacteria 14917
186 Ga0068865_100035561 3300006881 Bacteria 3351
187 Ga0075436_100000001 3300006914 Bacteria 622380
188 Ga0075436_100055413 3300006914 Bacteria 2737
189 Ga0097620_100104954 3300006931 Bacteria 2885
190 Ga0097620_100130329 3300006931 Bacteria 2586
191 Ga0097620_100147887 3300006931 Bacteria 2424
192 Ga0075435_100100248 3300007076 Bacteria 2399
193 Ga0099794_10071042 3300007265 Bacteria 1705
194 Ga0099795_10001637 3300007788 Bacteria 4952
195 Ga0105251_10000205 3300009011 Bacteria 59437
196 Ga0105251_10002055 3300009011 Bacteria 16280
197 Ga0105240_10006607 3300009093 Bacteria 17021
198 Ga0105240_10010277 3300009093 Bacteria 13176
199 Ga0105240_10034952 3300009093 Bacteria 6480
200 Ga0105240_10060371 3300009093 Bacteria 4727
201 Ga0105240_10117790 3300009093 Bacteria 3202
202 Ga0105240_10153999 3300009093 Bacteria 2736
203 Ga0111539_10004596 3300009094 Bacteria 18040
204 Ga0111539_10049302 3300009094 Bacteria 5023
205 Ga0111539_10089144 3300009094 Bacteria 3624
206 Ga0111539_10154269 3300009094 Bacteria 2688
207 Ga0105245_10145922 3300009098 Bacteria 2233
208 Ga0105245_10157108 3300009098 Bacteria 2155
209 Ga0105245_10313166 3300009098 Bacteria 1544
210 Ga0105247_10122076 3300009101 Bacteria 1689
211 Ga0105247_10166966 3300009101 Bacteria 1461
212 Ga0114129_10000754 3300009147 Bacteria 41193
213 Ga0114129_10014233 3300009147 Bacteria 11336
214 Ga0114129_10822800 3300009147 Bacteria 1183
215 Ga0105243_10020186 3300009148 Bacteria 5052
216 Ga0105243_10026521 3300009148 Bacteria 4436
217 Ga0105243_10406096 3300009148 Bacteria 1267
218 Ga0105241_10029052 3300009174 Bacteria 4121
219 Ga0105241_10058036 3300009174 Bacteria 2971
220 Ga0105242_10034292 3300009176 Bacteria 4069
221 Ga0105242_10042909 3300009176 Bacteria 3656
222 Ga0105248_10001300 3300009177 Bacteria 27811
223 Ga0105248_10102081 3300009177 Bacteria 3233
224 Ga0105237_10000016 3300009545 Bacteria 256506
225 Ga0105237_10004233 3300009545 Bacteria 16711
226 Ga0105237_10468740 3300009545 Bacteria 1265
227 Ga0105238_10070629 3300009551 Bacteria 3491
228 Ga0105238_10145423 3300009551 Bacteria 2347
229 Ga0105238_10167936 3300009551 Bacteria 2170
230 Ga0105249_10002681 3300009553 Bacteria 15387
231 Ga0105249_10125843 3300009553 Bacteria 2440
232 Ga0105249_10557624 3300009553 Bacteria 1197
233 Ga0105239_10052219 3300010375 Bacteria 4482
234 Ga0105239_10077002 3300010375 Bacteria 3669
235 Ga0105239_10515703 3300010375 Bacteria 1360
236 Ga0105239_10593775 3300010375 Bacteria 1263
237 Ga0105246_10033581 3300011119 Bacteria 3411
238 Ga0157314_1000223 3300012500 Bacteria 6155
239 Ga0157324_1002943 3300012506 Bacteria 1079
240 Ga0157371_10198152 3300013102 Bacteria 1439
241 Ga0157371_10206843 3300013102 Bacteria 1408
242 Ga0157370_10000476 3300013104 Bacteria 50116
243 Ga0157369_10000100 3300013105 Bacteria 118782
244 Ga0157369_10025033 3300013105 Bacteria 6629
245 Ga0157369_10029133 3300013105 Bacteria 6103
246 Ga0157374_10003679 3300013296 Bacteria 12887
247 Ga0157374_10067660 3300013296 Bacteria 3359
248 Ga0157374_10544075 3300013296 Bacteria 1168
249 Ga0157378_10009378 3300013297 Bacteria 8527
250 Ga0157378_10050486 3300013297 Bacteria 3702
251 Ga0157378_10058065 3300013297 Bacteria 3450
252 Ga0163162_10191483 3300013306 Bacteria 2173
253 Ga0163162_10483026 3300013306 Bacteria 1370
254 Ga0157372_10007589 3300013307 Bacteria 11530
255 Ga0157372_10026454 3300013307 Bacteria 6313
256 Ga0157372_10081896 3300013307 Bacteria 3653
257 Ga0157375_10000625 3300013308 Bacteria 31386
258 Ga0157375_10118790 3300013308 Bacteria 2751
259 Ga0163163_10023658 3300014325 Bacteria 5833
260 Ga0163163_10035797 3300014325 Bacteria 4819
261 Ga0163163_10227331 3300014325 Bacteria 1915
262 Ga0157380_10003174 3300014326 Bacteria 11216
263 Ga0157380_10025884 3300014326 Bacteria 4451
264 Ga0157380_10043366 3300014326 Bacteria 3522
265 Ga0182008_10010929 3300014497 Bacteria 4842
266 Ga0182008_10045824 3300014497 Bacteria 2174
267 Ga0157379_10001803 3300014968 Bacteria 17663
268 Ga0157379_10518191 3300014968 Bacteria 1106
269 Ga0157376_10037036 3300014969 Bacteria 3956
270 Ga0157376_10075201 3300014969 Bacteria 2882
271 Ga0157376_10192722 3300014969 Bacteria 1870
272 Ga0182006_1017559 3300015261 Bacteria 3037
273 Ga0183369_1003 3300015685 Bacteria 726443
274 Ga0163161_10075323 3300017792 Bacteria 2476
275 Ga0206353_11617679 3300020082 Bacteria 3679
276 Ga0213876_10026144 3300021384 Bacteria 3079
277 Ga0213876_10061694 3300021384 Bacteria 1979
278 Ga0209129_1000913 3300025258 Bacteria 18074
279 Ga0209565_1000060 3300025263 Bacteria 188543
280 Ga0207666_1001700 3300025271 Bacteria 2618
281 Ga0209673_1000047 3300025273 Bacteria 289276
282 Ga0209130_1003490 3300025284 Bacteria 6619
283 Ga0209675_1000007 3300025291 Bacteria 683430
284 Ga0209676_1000018 3300025292 Bacteria 631385
285 Ga0209676_1000027 3300025292 Bacteria 560222
286 Ga0209676_1002858 3300025292 Bacteria 11392
287 Ga0209025_1001291 3300025294 Bacteria 34256
288 Ga0209564_1000252 3300025295 Bacteria 114416
289 Ga0209758_1000446 3300025297 Bacteria 68984
290 Ga0209050_1000592 3300025298 Bacteria 57827
291 Ga0209256_1008729 3300025299 Bacteria 4623
292 Ga0209051_1001427 3300025303 Bacteria 20456
293 Ga0209257_1000035 3300025304 Bacteria 631463
294 Ga0209257_1000046 3300025304 Bacteria 477765
295 Ga0209257_1001448 3300025304 Bacteria 28059
296 Ga0209257_1056676 3300025304 Bacteria 1081
297 Ga0207697_10000097 3300025315 Bacteria 39643
298 Ga0207697_10008206 3300025315 Bacteria 4590
299 Ga0207656_10004305 3300025321 Bacteria 4960
300 Ga0207713_1000196 3300025735 Bacteria 84000
301 Ga0207713_1002516 3300025735 Bacteria 13272
302 Ga0207682_10000466 3300025893 Bacteria 18726
303 Ga0207682_10002890 3300025893 Bacteria 7573
304 Ga0207682_10013250 3300025893 Bacteria 3214
305 Ga0207692_10000881 3300025898 Bacteria 10850
306 Ga0207642_10004519 3300025899 Bacteria 4492
307 Ga0207688_10000116 3300025901 Bacteria 32495
308 Ga0207688_10028803 3300025901 Bacteria 3055
309 Ga0207680_10001365 3300025903 Bacteria 11567
310 Ga0207680_10179035 3300025903 Bacteria 1432
311 Ga0207647_10000992 3300025904 Bacteria 22010
312 Ga0207647_10004032 3300025904 Bacteria 10948
313 Ga0207647_10005864 3300025904 Bacteria 8954
314 Ga0207647_10022241 3300025904 Bacteria 4216
315 Ga0207699_10001293 3300025906 Bacteria 11897
316 Ga0207645_10003584 3300025907 Bacteria 11745
317 Ga0207645_10010509 3300025907 Bacteria 6356
318 Ga0207643_10027882 3300025908 Bacteria 3134
319 Ga0207705_10011410 3300025909 Bacteria 6433
320 Ga0207684_10013990 3300025910 Bacteria 6932
321 Ga0207684_10051867 3300025910 Bacteria 3481
322 Ga0207654_10000280 3300025911 Bacteria 31003
323 Ga0207654_10000283 3300025911 Bacteria 30936
324 Ga0207707_10000439 3300025912 Bacteria 43257
325 Ga0207695_10000405 3300025913 Bacteria 96061
326 Ga0207695_10000689 3300025913 Bacteria 66235
327 Ga0207695_10000715 3300025913 Bacteria 64608
328 Ga0207695_10018800 3300025913 Bacteria 7973
329 Ga0207695_10026005 3300025913 Bacteria 6539
330 Ga0207695_10042103 3300025913 Bacteria 4883
331 Ga0207695_10078811 3300025913 Bacteria 3342
332 Ga0207695_10105632 3300025913 Bacteria 2803
333 Ga0207671_10000137 3300025914 Bacteria 112029
334 Ga0207671_10001825 3300025914 Bacteria 23756
335 Ga0207671_10015842 3300025914 Bacteria 5882
336 Ga0207671_10094877 3300025914 Bacteria 2252
337 Ga0207693_10025030 3300025915 Bacteria 4735
338 Ga0207693_10059739 3300025915 Bacteria 2986
339 Ga0207663_10183166 3300025916 Bacteria 1497
340 Ga0207660_10002142 3300025917 Bacteria 13105
341 Ga0207662_10003021 3300025918 Bacteria 8581
342 Ga0207662_10028647 3300025918 Bacteria 3222
343 Ga0207657_10012463 3300025919 Bacteria 8391
344 Ga0207649_10011872 3300025920 Bacteria 4818
345 Ga0207652_10000079 3300025921 Bacteria 105322
346 Ga0207652_10025732 3300025921 Bacteria 4896
347 Ga0207652_10190018 3300025921 Bacteria 1847
348 Ga0207646_10000256 3300025922 Bacteria 72211
349 Ga0207646_10015564 3300025922 Bacteria 7179
350 Ga0207646_10043460 3300025922 Bacteria 4035
351 Ga0207646_10413908 3300025922 Bacteria 1217
352 Ga0207681_10008487 3300025923 Bacteria 6278
353 Ga0207681_10022204 3300025923 Bacteria 4045
354 Ga0207681_10058540 3300025923 Bacteria 2638
355 Ga0207694_10113496 3300025924 Bacteria 2157
356 Ga0207650_10001884 3300025925 Bacteria 14810
357 Ga0207650_10037752 3300025925 Bacteria 3522
358 Ga0207650_10046007 3300025925 Bacteria 3212
359 Ga0207659_10065667 3300025926 Bacteria 2630
360 Ga0207659_10094395 3300025926 Bacteria 2241
361 Ga0207687_10119815 3300025927 Bacteria 1966
362 Ga0207700_10001894 3300025928 Bacteria 11879
363 Ga0207700_10039448 3300025928 Bacteria 3438
364 Ga0207664_10000030 3300025929 Bacteria 179903
365 Ga0207664_10002437 3300025929 Bacteria 12308
366 Ga0207644_10077325 3300025931 Bacteria 2450
367 Ga0207644_10092570 3300025931 Bacteria 2256
368 Ga0207644_10119922 3300025931 Bacteria 2001
369 Ga0207644_10400703 3300025931 Bacteria 1121
370 Ga0207690_10010965 3300025932 Bacteria 5404
371 Ga0207690_10101982 3300025932 Bacteria 2051
372 Ga0207706_10001631 3300025933 Bacteria 22262
373 Ga0207706_10014736 3300025933 Bacteria 7081
374 Ga0207706_10060867 3300025933 Bacteria 3325
375 Ga0207686_10082335 3300025934 Bacteria 2103
376 Ga0207670_10111613 3300025936 Bacteria 1971
377 Ga0207669_10004174 3300025937 Bacteria 6332
378 Ga0207669_10140723 3300025937 Bacteria 1674
379 Ga0207704_10047001 3300025938 Bacteria 2577
380 Ga0207704_10051187 3300025938 Bacteria 2496
381 Ga0207665_10000991 3300025939 Bacteria 19211
382 Ga0207691_10050701 3300025940 Bacteria 3798
383 Ga0207691_10052700 3300025940 Bacteria 3716
384 Ga0207691_10214831 3300025940 Bacteria 1669
385 Ga0207711_10000945 3300025941 Bacteria 27919
386 Ga0207711_10095261 3300025941 Bacteria 2625
387 Ga0207689_10000289 3300025942 Bacteria 45719
388 Ga0207689_10012535 3300025942 Bacteria 7242
389 Ga0207689_10143107 3300025942 Bacteria 1970
390 Ga0207689_10352371 3300025942 Bacteria 1224
391 Ga0207661_10023623 3300025944 Bacteria 4648
392 Ga0207661_10063594 3300025944 Bacteria 2989
393 Ga0207679_10192038 3300025945 Bacteria 1699
394 Ga0207679_10358800 3300025945 Bacteria 1272
395 Ga0207679_10416411 3300025945 Bacteria 1185
396 Ga0207667_10000047 3300025949 Bacteria 240471
397 Ga0207667_10036432 3300025949 Bacteria 5273
398 Ga0207667_10039681 3300025949 Bacteria 5016
399 Ga0207667_10467839 3300025949 Bacteria 1280
400 Ga0207651_10123132 3300025960 Bacteria 1970
401 Ga0207712_10006596 3300025961 Bacteria 7323
402 Ga0207712_10362772 3300025961 Bacteria 1207
403 Ga0207640_10002363 3300025981 Bacteria 10112
404 Ga0207640_10043600 3300025981 Bacteria 2868
405 Ga0207640_10380022 3300025981 Bacteria 1144
406 Ga0207658_10000663 3300025986 Bacteria 30044
407 Ga0207658_10021808 3300025986 Bacteria 4451
408 Ga0207658_10243774 3300025986 Bacteria 1524
409 Ga0207703_10032726 3300026035 Bacteria 4116
410 Ga0207703_10160533 3300026035 Bacteria 1968
411 Ga0207639_10001346 3300026041 Bacteria 16595
412 Ga0207678_10000160 3300026067 Bacteria 55960
413 Ga0207678_10027279 3300026067 Bacteria 4980
414 Ga0207678_10124175 3300026067 Bacteria 2203
415 Ga0207678_10241128 3300026067 Bacteria 1548
416 Ga0207708_10000888 3300026075 Bacteria 22477
417 Ga0207708_10013319 3300026075 Bacteria 6143
418 Ga0207708_10407124 3300026075 Bacteria 1126
419 Ga0207702_10184048 3300026078 Bacteria 1926
420 Ga0207641_10015484 3300026088 Bacteria 6248
421 Ga0207641_10118381 3300026088 Bacteria 2359
422 Ga0207648_10004502 3300026089 Bacteria 14289
423 Ga0207648_10010208 3300026089 Bacteria 8931
424 Ga0207648_10062249 3300026089 Bacteria 3253
425 Ga0207648_10132887 3300026089 Bacteria 2191
426 Ga0207648_10467855 3300026089 Bacteria 1150
427 Ga0207676_10022363 3300026095 Bacteria 4650
428 Ga0207674_10000012 3300026116 Bacteria 193220
429 Ga0207674_10005235 3300026116 Bacteria 15442
430 Ga0207674_10032089 3300026116 Bacteria 5510
431 Ga0207674_10035898 3300026116 Bacteria 5170
432 Ga0207674_10050998 3300026116 Bacteria 4224
433 Ga0207674_10133157 3300026116 Bacteria 2449
434 Ga0207675_100007676 3300026118 Bacteria 10179
435 Ga0207675_100094817 3300026118 Bacteria 2807
436 Ga0207683_10000797 3300026121 Bacteria 28789
437 Ga0207683_10005272 3300026121 Bacteria 11094
438 Ga0207683_10015047 3300026121 Bacteria 6585
439 Ga0207683_10095783 3300026121 Bacteria 2646
440 Ga0207698_10006055 3300026142 Bacteria 7522
441 Ga0209984_1001657 3300027424 Bacteria 2426
442 Ga0209970_1001427 3300027614 Bacteria 4175
443 Ga0209983_1000693 3300027665 Bacteria 7273
444 Ga0209971_1002046 3300027682 Bacteria 4907
445 Ga0268266_10082590 3300028379 Bacteria 2803
446 Ga0268266_10107297 3300028379 Bacteria 2469
447 Ga0268266_10151515 3300028379 Bacteria 2090
448 Ga0268265_10012118 3300028380 Bacteria 5838
449 Ga0268265_10553405 3300028380 Bacteria 1092
450 Ga0268264_10007894 3300028381 Bacteria 8854
451 Ga0268264_10051279 3300028381 Bacteria 3438
452 Ga0265323_10017208 3300028653 Bacteria 2811
453 Ga0265338_10015780 3300028800 Bacteria 8273
454 Ga0265338_10091589 3300028800 Bacteria 2511
455 Ga0316183_1005705 3300030742 Bacteria 10165
456 Ga0316181_1169600 3300030744 Bacteria 2458
457 Ga0265762_1007251 3300030760 Bacteria 1976
458 Ga0265770_1000674 3300030878 Bacteria 4757
459 Ga0265760_10002180 3300031090 Bacteria 5732
460 Ga0265325_10002157 3300031241 Bacteria 13416
461 Ga0307513_10002018 3300031456 Bacteria 28576
462 Ga0307513_10089006 3300031456 Bacteria 3153
463 Ga0307408_100132825 3300031548 Bacteria 1944
464 Ga0307516_10004141 3300031730 Bacteria 18086
465 Ga0307413_10216378 3300031824 Bacteria 1396
466 Ga0307413_10419226 3300031824 Bacteria 1054
467 Ga0307518_10003354 3300031838 Bacteria 11558
468 Ga0307410_10079868 3300031852 Bacteria 2293
469 Ga0307410_10126225 3300031852 Bacteria 1873
470 Ga0307410_10249498 3300031852 Bacteria 1379
471 Ga0307412_10103778 3300031911 Bacteria 2016
472 Ga0307409_100006173 3300031995 Bacteria 7011
473 Ga0307409_100300013 3300031995 Bacteria 1494
474 Ga0307416_100180894 3300032002 Bacteria 1976
475 Ga0307414_10074074 3300032004 Bacteria 2465
476 Ga0307414_10136174 3300032004 Bacteria 1915
477 Ga0307414_10268059 3300032004 Bacteria 1428
478 Ga0307414_10435834 3300032004 Bacteria 1146
479 Ga0307411_10118434 3300032005 Bacteria 1910
480 Ga0307415_100074442 3300032126 Bacteria 2400
481 Ga0307415_100101943 3300032126 Bacteria 2107
482 Ga0307415_100182880 3300032126 Bacteria 1646
483 Ga0373934_0018939 3300035086 Bacteria 2638
484 Ga0373944_0012545 3300035089 Bacteria 2338
485 Ga0373936_0079879 3300035113 Bacteria 1360
486 Ga0373953_0075492 3300035117 Bacteria 1395
487 Ga0373954_0012360 3300035118 Bacteria 3794
488 Ga0373957_0039106 3300035120 Bacteria 1778
489 Ga0373943_0097633 3300035170 Bacteria 1531
490 Ga0316574_0057119 3300035398 Bacteria 2443
491 Ga0373931_0061927 3300035691 Bacteria 2019
492 Ga0373933_0000044 3300035724 Bacteria 77423
493 Ga0373933_0003201 3300035724 Bacteria 9139
494 Ga0373933_0114046 3300035724 Bacteria 1688
495 Ga0373933_0171765 3300035724 Bacteria 1379
496 Ga0373947_0048570 3300035725 Bacteria 2546
497 Ga0373947_0123460 3300035725 Bacteria 1647
498 Ga0373937_0000050 3300036401 Bacteria 105342
499 Ga0373937_0017793 3300036401 Bacteria 6341
500 Ga0316582_0004491 3300036647 Bacteria 7067
501 Ga0373925_0202297 3300037068 Bacteria 1580
502 Ga0395905_0003815 3300037471 Bacteria 15932
503 Ga0395905_0153241 3300037471 Bacteria 2168
504 Ga0395905_0269429 3300037471 Bacteria 1589
505 Ga0395901_0000215 3300038443 Bacteria 72912
506 Ga0436365_0818700 3300039437 Bacteria 2754
507 Ga0436365_0841650 3300039437 Bacteria 3707
508 Ga0439436_0005513 3300041404 Bacteria 3875
509 Ga0439436_0076162 3300041404 Bacteria 934
510 Ga0439439_0000316 3300041406 Bacteria 7777
511 Ga0439439_0015190 3300041406 Bacteria 1878
512 Ga0439461_0003918 3300041410 Bacteria 2467
513 Ga0439465_0006869 3300041413 Bacteria 3614
514 Ga0451789_1143133 3300041443 Bacteria 1398
515 Ga0451791_0749437 3300041451 Bacteria 3485
516 Ga0451793_0416064 3300041452 Bacteria 2493
517 Ga0451793_1561296 3300041452 Bacteria 2839
518 Ga0451800_0088931 3300041459 Bacteria 9497
519 Ga0451806_279372 3300041462 Bacteria 1944
520 Ga0451843_0620283 3300041509 Bacteria 1382
521 Ga0439442_008192 3300042002 Bacteria 2110
522 Ga0439445_0001491 3300042004 Bacteria 5092
523 Ga0439449_0000056 3300042007 Bacteria 34138
524 Ga0439449_0001472 3300042007 Bacteria 9225
525 Ga0439449_0001609 3300042007 Bacteria 8851
526 Ga0439449_0005191 3300042007 Bacteria 4998
527 Ga0439434_0022524 3300042435 Bacteria 1894
528 Ga0466972_0003287 3300044658 Bacteria 8011
529 Ga0466966_0048653 3300044684 Bacteria 2701
530 Ga0466966_0138855 3300044684 Bacteria 1486
531 Ga0466961_0027210 3300044693 Bacteria 3676
532 Ga0466961_0047434 3300044693 Bacteria 2747
533 Ga0466961_0146768 3300044693 Bacteria 1475
534 Ga0466963_0018000 3300044694 Bacteria 4409
535 Ga0466964_0081309 3300044706 Bacteria 1391
536 Ga0466971_0082278 3300044719 Bacteria 1469
537 Ga0466971_0118587 3300044719 Bacteria 1224
538 Ga0466970_0000034 3300044765 Bacteria 50551
539 Ga0466957_0001063 3300044842 Bacteria 14161
540 Ga0466959_0028392 3300045049 Bacteria 4149
541 Ga0466959_0086499 3300045049 Bacteria 2255
542 Ga0466959_0224178 3300045049 Bacteria 1303
543 Ga0451576_0006973 3300045051 Bacteria 13674
544 Ga0466958_0065450 3300045836 Bacteria 2218
545 Ga0466958_0112374 3300045836 Bacteria 1701
546 Ga0466967_0026332 3300045976 Bacteria 4815
547 Ga0466967_0146122 3300045976 Bacteria 2206
548 Ga0466967_0596340 3300045976 Bacteria 1090
549 Ga0495629_0037205 3300046459 Bacteria 3430
550 Ga0495638_0024634 3300046460 Bacteria 3920
551 Ga0495641_0006990 3300046461 Bacteria 7169
552 Ga0495651_0001235 3300046462 Bacteria 19776
553 Ga0495651_0007805 3300046462 Bacteria 8190
554 Ga0495651_0190308 3300046462 Bacteria 1445
555 Ga0495653_0007671 3300046463 Bacteria 8830
556 Ga0495582_0027317 3300046473 Bacteria 3127
557 Ga0495582_0031344 3300046473 Bacteria 2922
558 Ga0495605_0089304 3300046474 Bacteria 1430
559 Ga0495639_0127951 3300046475 Bacteria 1214
560 Ga0495662_0057553 3300046476 Bacteria 1877
561 Ga0495664_0004094 3300046477 Bacteria 7957
562 Ga0495664_0151351 3300046477 Bacteria 1407
563 Ga0495607_0141297 3300046501 Bacteria 1241
564 Ga0495606_0003021 3300046507 Bacteria 18410
565 Ga0495608_0292377 3300046511 Bacteria 1009
566 Ga0495610_0004372 3300046512 Bacteria 10473
567 Ga0495616_0037659 3300046513 Bacteria 2487
568 Ga0495616_0044718 3300046513 Bacteria 2245
569 Ga0495628_0173772 3300046516 Bacteria 1632
570 Ga0495631_0002447 3300046518 Bacteria 10465
571 Ga0495663_0000387 3300046525 Bacteria 16315
572 Ga0495666_0026232 3300046526 Bacteria 2875
573 Ga0495642_0013810 3300046528 Bacteria 3128
574 Ga0495640_0095420 3300046533 Bacteria 1957
575 Ga0495587_0000183 3300046536 Bacteria 46219
576 Ga0495621_0043335 3300046539 Bacteria 1587
577 Ga0495645_0079614 3300046543 Bacteria 2353
578 Ga0495645_0103418 3300046543 Bacteria 2023
579 Ga0495633_0000651 3300046558 Bacteria 32098
580 Ga0495667_0086586 3300046559 Bacteria 2032
581 Ga0495625_0107482 3300046660 Bacteria 1910
582 Ga0495599_0057796 3300046678 Bacteria 2427
583 Ga0495623_0088097 3300046679 Bacteria 1911
584 Ga0495646_0155829 3300046680 Bacteria 1267
585 Ga0495658_0010396 3300046683 Bacteria 4656
586 Ga0495658_0087538 3300046683 Bacteria 1839
587 Ga0495624_0006000 3300046690 Bacteria 8664
588 Ga0495660_0096688 3300046810 Bacteria 1526
589 Ga0495581_0024555 3300047315 Bacteria 3493
590 Ga0495604_0191762 3300047317 Bacteria 1423
591 Ga0495674_0009636 3300047319 Bacteria 9174
592 Ga0495681_0082551 3300047470 Bacteria 1432
593 Ga0495686_0005817 3300047472 Bacteria 9618
594 Ga0495593_0004328 3300047673 Bacteria 8449
595 Ga0495593_0279611 3300047673 Bacteria 835
596 Ga0495602_0000053 3300048088 Bacteria 113109
597 Ga0495602_0111159 3300048088 Bacteria 2225
598 Ga0495614_0020766 3300048089 Bacteria 2838
599 Ga0496100_0098471 3300048903 Bacteria 2010
600 Ga0496100_0152423 3300048903 Bacteria 1650
601 Ga0496100_0184880 3300048903 Bacteria 1509
602 Ga0496101_0033138 3300048904 Bacteria 3642
603 Ga0496104_0000017 3300048907 Bacteria 325877
604 Ga0496104_0011176 3300048907 Bacteria 8035
605 Ga0496104_0022256 3300048907 Bacteria 5821
606 Ga0496105_0000009 3300048908 Bacteria 325734
607 Ga0496105_0046384 3300048908 Bacteria 3587
608 Ga0496106_0264415 3300048909 Bacteria 1377
609 Ga0496108_0027171 3300048911 Bacteria 4722
610 Ga0496108_0053148 3300048911 Bacteria 3396
611 Ga0496108_0086086 3300048911 Bacteria 2668
612 Ga0496110_0008627 3300048913 Bacteria 8209
613 Ga0496110_0588143 3300048913 Bacteria 1010
614 Ga0496112_0115517 3300048915 Bacteria 2655
615 Ga0496112_0215929 3300048915 Bacteria 1874
616 Ga0496113_0111684 3300048916 Bacteria 2128
617 Ga0496114_0000155 3300048917 Bacteria 49214
618 Ga0496114_0004607 3300048917 Bacteria 10709
619 Ga0496115_0019526 3300048918 Bacteria 5216
620 Ga0496115_0158870 3300048918 Bacteria 1868
621 Ga0496117_0000826 3300048920 Bacteria 47957
622 Ga0496117_0006643 3300048920 Bacteria 11599
623 Ga0496117_0057775 3300048920 Bacteria 2691
624 Ga0496118_0025065 3300048921 Bacteria 5128
625 Ga0496118_0127746 3300048921 Bacteria 1639
626 Ga0496118_0173618 3300048921 Bacteria 1313
627 Ga0496119_0002773 3300048922 Bacteria 18816
628 Ga0496120_0000273 3300048923 Bacteria 86248
629 Ga0496121_0085053 3300048924 Bacteria 2491
630 Ga0496122_0000417 3300048925 Bacteria 90401
631 Ga0496122_0012311 3300048925 Bacteria 8538
632 Ga0496123_0000137 3300048926 Bacteria 152169
633 Ga0496123_0002212 3300048926 Bacteria 24710
634 Ga0496124_0000034 3300048927 Bacteria 325332
635 Ga0496124_0000872 3300048927 Bacteria 49232
636 Ga0496125_0000044 3300048928 Bacteria 296762
637 Ga0496126_0016963 3300048929 Bacteria 7266
638 Ga0496126_0017271 3300048929 Bacteria 7190
639 Ga0501031_0050062 3300049568 Bacteria 2723
640 Ga0501032_0023436 3300049569 Bacteria 4264
641 Ga0501032_0076833 3300049569 Bacteria 2223
642 Ga0501034_0000521 3300049571 Bacteria 61943
643 Ga0501034_0000923 3300049571 Bacteria 42924
644 Ga0501034_0159319 3300049571 Bacteria 2229
645 Ga0501034_0187070 3300049571 Bacteria 2034
646 Ga0501036_0054608 3300049572 Bacteria 3384
647 Ga0501036_0115561 3300049572 Bacteria 2267
648 Ga0501037_0077888 3300049573 Bacteria 2405
649 Ga0501037_0299078 3300049573 Bacteria 1118
650 Ga0501037_0326394 3300049573 Bacteria 1062
651 Ga0501038_0032429 3300049574 Bacteria 4609
652 Ga0501039_0078938 3300049575 Bacteria 2561
653 Ga0501040_0416396 3300049576 Bacteria 966
654 Ga0501041_0007760 3300049577 Bacteria 6300
655 Ga0501042_0042463 3300049578 Bacteria 3237
656 Ga0501043_0216995 3300049579 Bacteria 1481
657 Ga0501043_0273435 3300049579 Bacteria 1296
658 Ga0501046_0005045 3300049580 Bacteria 11840
659 Ga0501046_0119437 3300049580 Bacteria 2007
660 Ga0501046_0222432 3300049580 Bacteria 1397
661 Ga0501047_0046639 3300049581 Bacteria 4188
662 Ga0501047_0059050 3300049581 Bacteria 3704
663 Ga0501047_0150132 3300049581 Bacteria 2207
664 Ga0501047_0443099 3300049581 Bacteria 1128
665 Ga0501048_0053019 3300049582 Bacteria 2886
666 Ga0501069_0002341 3300049585 Bacteria 9591
667 Ga0501070_0007770 3300049586 Bacteria 9090
668 Ga0501070_0134398 3300049586 Bacteria 2042
669 Ga0501071_0035224 3300049587 Bacteria 3565
670 Ga0501072_0007719 3300049588 Bacteria 8165
671 Ga0501073_0026367 3300049589 Bacteria 4165
672 Ga0501073_0038939 3300049589 Bacteria 3371
673 Ga0501073_0074055 3300049589 Bacteria 2371
674 Ga0501074_0092078 3300049590 Bacteria 2171
675 Ga0501075_0066719 3300049591 Bacteria 2715
676 Ga0501076_0008850 3300049592 Bacteria 7402
677 Ga0501076_0204266 3300049592 Bacteria 1614
678 Ga0501077_0071229 3300049593 Bacteria 2203
679 Ga0501217_018657 3300049661 Bacteria 1613
680 Ga0501225_0001698 3300049705 Bacteria 6887
681 Ga0501079_0003471 3300049741 Bacteria 11589
682 Ga0501079_0078558 3300049741 Bacteria 2552
683 Ga0501079_0233022 3300049741 Bacteria 1438
684 Ga0501080_0003421 3300049742 Bacteria 13999
685 Ga0501080_0079020 3300049742 Bacteria 3059
686 Ga0501080_0171804 3300049742 Bacteria 1999
687 Ga0501080_0291974 3300049742 Bacteria 1480
688 Ga0501081_0040667 3300049743 Bacteria 3183
689 Ga0501081_0224909 3300049743 Bacteria 1365
690 Ga0501035_0145163 3300049822 Bacteria 2061
691 Ga0501035_0409300 3300049822 Bacteria 1127
692 Ga0501035_0472380 3300049822 Bacteria 1035
693 Ga0501044_0251104 3300049823 Bacteria 1710
694 Ga0501045_0003175 3300049824 Bacteria 11235
695 Ga0501045_0408725 3300049824 Bacteria 1010
696 nmdc:mga05p37_282623_c1 3300050507 Bacteria 1978
697 nmdc:mga05p37_55834_c1 3300050507 Bacteria 4862
698 nmdc:mga05p37_609254_c1 3300050507 Bacteria 1231
699 nmdc:mga09592_62508_c1 3300050508 Bacteria 3151
700 nmdc:mga0qj67_171670_c1 3300050509 Bacteria 1761
701 nmdc:mga0qj67_3715_c1 3300050509 Bacteria 11011
702 nmdc:mga06r32_32272_c1 3300050510 Bacteria 4926
703 nmdc:mga06r32_92745_c1 3300050510 Bacteria 2953
704 nmdc:mga08y16_426537_c1 3300050511 Bacteria 1355
705 nmdc:mga08y16_701898_c1 3300050511 Bacteria 1011
706 nmdc:mga0n895_7143_c1 3300050512 Bacteria 9551
707 nmdc:mga0rr50_243703_c1 3300050513 Bacteria 1490
708 nmdc:mga0rr50_5169_c1 3300050513 Bacteria 7749
709 nmdc:mga08x19_111409_c1 3300050514 Bacteria 1826
710 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
711 nmdc:mga0a205_299567_c1 3300050515 Bacteria 1481
712 Ga0495601_0034728 3300053077 Bacteria 3146
713 Ga0495601_0305762 3300053077 Bacteria 1036
714 Ga0495612_0003013 3300053078 Bacteria 6994
715 Ga0495595_0003624 3300053084 Bacteria 6137
716 Ga0495619_0025722 3300053085 Bacteria 3782
717 Ga0500643_002076 3300053087 Bacteria 10663
718 Ga0500651_0000690 3300053093 Bacteria 16757
719 Ga0500597_000320 3300053120 Bacteria 9910
720 Ga0501084_0032589 3300054114 Bacteria 4358
721 Ga0501084_0045617 3300054114 Bacteria 3670
722 Ga0501084_0060561 3300054114 Bacteria 3169
723 Ga0501082_0024016 3300060353 Bacteria 5258
724 Ga0501082_0063666 3300060353 Bacteria 3175
725 Ga0501082_0066131 3300060353 Bacteria 3113
726 Ga0466962_0024040 3300061719 Bacteria 2928
727 Ga0466962_0031903 3300061719 Bacteria 2523
728 Ga0530510_0027384 3300061734 Bacteria 4083
729 Ga0530510_0128361 3300061734 Bacteria 1865
730 Ga0530510_0149248 3300061734 Bacteria 1725
731 Ga0530510_0194453 3300061734 Bacteria 1506
732 2501944882 2501939600 Bacteria 6907073
733 2643818553 2643221559 Bacteria 4424915
734 2643880571 2643221573 Bacteria 4784121
735 2643938315 2643221586 Bacteria 4446529
736 2644078950 2643221612 Bacteria 4361984
737 2644661140 2643221720 Bacteria 4694283
738 2644693727 2643221727 Bacteria 4415595
739 2644699218 2643221728 Bacteria 4797149
740 2676493692 2675903060 Bacteria 10051191
741 2819661313 2818991457 Bacteria 5323295
742 2832005315 2832004796 Bacteria 6538017
743 2842758991 2842757796 Bacteria 3981385
744 2842784528 2842780639 Bacteria 4337790
745 2855674314 2855670206 Bacteria 7120389
746 2855679748 2855676851 Bacteria 7063653
747 2855688007 2855683550 Bacteria 7134265
748 2856859670 2856858025 Bacteria 7255264
749 2857290662 2857288857 Bacteria 7189066
750 2858884990 2858882152 Bacteria 7230291
751 2858891871 2858888857 Bacteria 7060307
752 2858899649 2858895516 Bacteria 7378898
753 2861526670 2861520306 Bacteria 8348283
754 2863412679 2863404153 Bacteria 9672205
755 2866071476 2866065130 Bacteria 6518152
756 2867304689 2867302475 Bacteria 7087181
757 2867318743 2867312974 Bacteria 7058875
758 2867323941 2867319477 Bacteria 7069771
759 2869052030 2869048445 Bacteria 6875584
760 2869063309 2869061728 Bacteria 7112407
761 2869072753 2869068681 Bacteria 7205615
762 2880494449 2880489317 Bacteria 7096270
763 2880497855 2880495981 Bacteria 7340502
764 2891404108 2891395885 Bacteria 9251614
765 2895437825 2895427314 Bacteria 13147766
766 2895448312 2895442618 Bacteria 11027144
767 2929219911 2929219909 Bacteria 6984360
768 2929226424 2929226422 Bacteria 7248583
769 649810163 649633069 Bacteria 6962533
770 8002869911 8002869464 Bacteria 3588529
771 8003836225 8003830390 Bacteria 6541657
772 8003874644 8003870546 Bacteria 7396674
773 8011355790 8011350971 Bacteria 6158957
774 8054710509 8054704163 Bacteria 7247792
775 8054729131 8054727385 Bacteria 7558670
776 8054740494 8054734606 Bacteria 6947278
777 8055178601 8055172936 Bacteria 9305943
778 8057574466 8057568493 Bacteria 7221719
779 Ga0466961_0009337
780 SwRhRL2b_contig_1635563
781 SwRhRL2b_contig_3910350
782 JGI24740J21852_10000250
783 JGI24740J21852_10010858
784 JGI24739J22299_10000012
785 JGI24739J22299_10002821
786 JGI24737J22298_10001747
787 JGI24737J22298_10008646
788 JGI24735J21928_10017831
789 Ga0006562J51391_1109942
790 Ga0007429J51699_1109887
791 Ga0055537_1001342
792 Ga0055524_1011706
793 Ga0055536_1002027
794 Ga0055536_1002102
795 Ga0055536_1014122
796 Ga0055534_1000145
797 Ga0055528_1002402
798 Ga0055530_10001996
799 Ga0055531_10002315
800 Ga0055531_10002729
801 Ga0055531_10002839
802 Ga0055531_10006904
803 Ga0058863_11891516
804 Ga0065704_10070903
805 Ga0065704_10071727
806 Ga0065704_10081660
807 Ga0070658_10021153
808 Ga0070658_10216472
809 Ga0070676_10018097
810 Ga0070683_100041323
811 Ga0070683_100135494
812 Ga0070683_100200791
813 Ga0070690_100030291
814 Ga0070690_100054963
815 Ga0070670_100020864
816 Ga0070670_100099618
817 Ga0068869_100011504
818 Ga0068869_100078456
819 Ga0070666_10000336
820 Ga0070666_10038826
821 Ga0070666_10039545
822 Ga0070680_100000521
823 Ga0070680_100214504
824 Ga0070682_100034816
825 Ga0068868_100037042
826 Ga0070660_100241763
827 Ga0070689_100071385
828 Ga0070689_100205918
829 Ga0070687_100017441
830 Ga0070661_100007788
831 Ga0070661_100072732
832 Ga0070661_100175851
833 Ga0070692_10046297
834 Ga0070668_100021819
835 Ga0070668_100151413
836 Ga0070668_100191903
837 Ga0070668_100250911
838 Ga0070669_100004478
839 Ga0070669_100020335
840 Ga0070675_100361772
841 Ga0070675_100477655
842 Ga0070671_100029011
843 Ga0070671_100065696
844 Ga0070671_100379732
845 Ga0070674_100114597
846 Ga0070673_100202626
847 Ga0070673_100318912
848 Ga0070688_100124551
849 Ga0070659_100000095
850 Ga0070659_100105722
851 Ga0070659_100233657
852 Ga0070667_100000136
853 Ga0070667_100045174
854 Ga0070709_10000583
855 Ga0070709_10203735
856 Ga0070714_100000055
857 Ga0070714_100041169
858 Ga0070714_100048821
859 Ga0070713_100000192
860 Ga0070713_100011442
861 Ga0070713_100057458
862 Ga0070710_10000874
863 Ga0070701_10005657
864 Ga0070711_100006472
865 Ga0070711_100208892
866 Ga0070705_100108537
867 Ga0070700_100012262
868 Ga0070694_100032295
869 Ga0070708_100046121
870 Ga0070663_100044966
871 Ga0070663_100330185
872 Ga0070678_100227815
873 Ga0070662_100028877
874 Ga0070662_100064481
875 Ga0070681_10000094
876 Ga0068867_100073625
877 Ga0068867_100179642
878 Ga0068867_100211896
879 Ga0070685_10004987
880 Ga0070685_10014623
881 Ga0070706_100005686
882 Ga0070706_100077409
883 Ga0070707_100004091
884 Ga0070707_100016100
885 Ga0070707_100020363
886 Ga0070707_100030221
887 Ga0070698_100004075
888 Ga0070698_100076866
889 Ga0070698_100119149
890 Ga0070699_100106053
891 Ga0070699_100261212
892 Ga0070679_100000137
893 Ga0070679_100012389
894 Ga0070679_100150868
895 Ga0070684_100105923
896 Ga0070697_100021408
897 Ga0068853_100012399
898 Ga0068853_100024322
899 Ga0068853_100048715
900 Ga0070672_100035303
901 Ga0070672_100051332
902 Ga0070696_100011608
903 Ga0070665_100036904
904 Ga0070665_100050311
905 Ga0070665_100068287
906 Ga0070665_100069489
907 Ga0068855_100002493
908 Ga0070664_100006215
909 Ga0070664_100110304
910 Ga0070664_100175797
911 Ga0070664_100374402
912 Ga0068857_100012030
913 Ga0068857_100032517
914 Ga0068857_100090442
915 Ga0068857_100099890
916 Ga0068854_100003465
917 Ga0068854_100132061
918 Ga0068854_100269397
919 Ga0068856_100047281
920 Ga0068856_100198126
921 Ga0068852_100012623
922 Ga0068859_100104964
923 Ga0068859_100130326
924 Ga0068859_100147891
925 Ga0068864_100005730
926 Ga0068866_10018133
927 Ga0068866_10147481
928 Ga0068861_100021164
929 Ga0068861_100030924
930 Ga0068851_10002784
931 Ga0068851_10003762
932 Ga0068870_10008660
933 Ga0068870_10016335
934 Ga0068870_10031355
935 Ga0068863_100020956
936 Ga0068863_100022890
937 Ga0068858_100146677
938 Ga0068860_100001168
939 Ga0068860_100007627
940 Ga0068860_100062025
941 Ga0068860_100127223
942 Ga0068860_100177584
943 Ga0068862_100009976
944 Ga0068862_100041565
945 Ga0081539_10000070
946 Ga0075364_10119615
947 Ga0070716_100007909
948 Ga0070712_100007728
949 Ga0075367_10110869
950 Ga0097621_100026821
951 Ga0097621_100047064
952 Ga0097621_100181557
953 Ga0068871_100006433
954 Ga0075428_100000293
955 Ga0075428_100394845
956 Ga0075430_100011687
957 Ga0075431_100000530
958 Ga0075431_100039148
959 Ga0075431_100250531
960 Ga0075431_100368611
961 Ga0075434_100059401
962 Ga0075434_100222164
963 Ga0075429_100002723
964 Ga0068865_100035561
965 Ga0075436_100000001
966 Ga0075436_100055413
967 Ga0097620_100104954
968 Ga0097620_100130329
969 Ga0097620_100147887
970 Ga0075435_100100248
971 Ga0099794_10071042
972 Ga0099795_10001637
973 Ga0105251_10000205
974 Ga0105251_10002055
975 Ga0105240_10006607
976 Ga0105240_10010277
977 Ga0105240_10034952
978 Ga0105240_10060371
979 Ga0105240_10117790
980 Ga0105240_10153999
981 Ga0111539_10004596
982 Ga0111539_10049302
983 Ga0111539_10089144
984 Ga0111539_10154269
985 Ga0105245_10145922
986 Ga0105245_10157108
987 Ga0105245_10313166
988 Ga0105247_10122076
989 Ga0105247_10166966
990 Ga0114129_10000754
991 Ga0114129_10014233
992 Ga0114129_10822800
993 Ga0105243_10020186
994 Ga0105243_10026521
995 Ga0105243_10406096
996 Ga0105241_10029052
997 Ga0105241_10058036
998 Ga0105242_10034292
999 Ga0105242_10042909
1000 Ga0105248_10001300
1001 Ga0105248_10102081
1002 Ga0105237_10000016
1003 Ga0105237_10004233
1004 Ga0105237_10468740
1005 Ga0105238_10070629
1006 Ga0105238_10145423
1007 Ga0105238_10167936
1008 Ga0105249_10002681
1009 Ga0105249_10125843
1010 Ga0105249_10557624
1011 Ga0105239_10052219
1012 Ga0105239_10077002
1013 Ga0105239_10515703
1014 Ga0105239_10593775
1015 Ga0105246_10033581
1016 Ga0157314_1000223
1017 Ga0157324_1002943
1018 Ga0157371_10198152
1019 Ga0157371_10206843
1020 Ga0157370_10000476
1021 Ga0157369_10000100
1022 Ga0157369_10025033
1023 Ga0157369_10029133
1024 Ga0157374_10003679
1025 Ga0157374_10067660
1026 Ga0157374_10544075
1027 Ga0157378_10009378
1028 Ga0157378_10050486
1029 Ga0157378_10058065
1030 Ga0163162_10191483
1031 Ga0163162_10483026
1032 Ga0157372_10007589
1033 Ga0157372_10026454
1034 Ga0157372_10081896
1035 Ga0157375_10000625
1036 Ga0157375_10118790
1037 Ga0163163_10023658
1038 Ga0163163_10035797
1039 Ga0163163_10227331
1040 Ga0157380_10003174
1041 Ga0157380_10025884
1042 Ga0157380_10043366
1043 Ga0182008_10010929
1044 Ga0182008_10045824
1045 Ga0157379_10001803
1046 Ga0157379_10518191
1047 Ga0157376_10037036
1048 Ga0157376_10075201
1049 Ga0157376_10192722
1050 Ga0182006_1017559
1051 Ga0183369_1003
1052 Ga0163161_10075323
1053 Ga0206353_11617679
1054 Ga0213876_10026144
1055 Ga0213876_10061694
1056 Ga0209129_1000913
1057 Ga0209565_1000060
1058 Ga0207666_1001700
1059 Ga0209673_1000047
1060 Ga0209130_1003490
1061 Ga0209675_1000007
1062 Ga0209676_1000018
1063 Ga0209676_1000027
1064 Ga0209676_1002858
1065 Ga0209025_1001291
1066 Ga0209564_1000252
1067 Ga0209758_1000446
1068 Ga0209050_1000592
1069 Ga0209256_1008729
1070 Ga0209051_1001427
1071 Ga0209257_1000035
1072 Ga0209257_1000046
1073 Ga0209257_1001448
1074 Ga0209257_1056676
1075 Ga0207697_10000097
1076 Ga0207697_10008206
1077 Ga0207656_10004305
1078 Ga0207713_1000196
1079 Ga0207713_1002516
1080 Ga0207682_10000466
1081 Ga0207682_10002890
1082 Ga0207682_10013250
1083 Ga0207692_10000881
1084 Ga0207642_10004519
1085 Ga0207688_10000116
1086 Ga0207688_10028803
1087 Ga0207680_10001365
1088 Ga0207680_10179035
1089 Ga0207647_10000992
1090 Ga0207647_10004032
1091 Ga0207647_10005864
1092 Ga0207647_10022241
1093 Ga0207699_10001293
1094 Ga0207645_10003584
1095 Ga0207645_10010509
1096 Ga0207643_10027882
1097 Ga0207705_10011410
1098 Ga0207684_10013990
1099 Ga0207684_10051867
1100 Ga0207654_10000280
1101 Ga0207654_10000283
1102 Ga0207707_10000439
1103 Ga0207695_10000405
1104 Ga0207695_10000689
1105 Ga0207695_10000715
1106 Ga0207695_10018800
1107 Ga0207695_10026005
1108 Ga0207695_10042103
1109 Ga0207695_10078811
1110 Ga0207695_10105632
1111 Ga0207671_10000137
1112 Ga0207671_10001825
1113 Ga0207671_10015842
1114 Ga0207671_10094877
1115 Ga0207693_10025030
1116 Ga0207693_10059739
1117 Ga0207663_10183166
1118 Ga0207660_10002142
1119 Ga0207662_10003021
1120 Ga0207662_10028647
1121 Ga0207657_10012463
1122 Ga0207649_10011872
1123 Ga0207652_10000079
1124 Ga0207652_10025732
1125 Ga0207652_10190018
1126 Ga0207646_10000256
1127 Ga0207646_10015564
1128 Ga0207646_10043460
1129 Ga0207646_10413908
1130 Ga0207681_10008487
1131 Ga0207681_10022204
1132 Ga0207681_10058540
1133 Ga0207694_10113496
1134 Ga0207650_10001884
1135 Ga0207650_10037752
1136 Ga0207650_10046007
1137 Ga0207659_10065667
1138 Ga0207659_10094395
1139 Ga0207687_10119815
1140 Ga0207700_10001894
1141 Ga0207700_10039448
1142 Ga0207664_10000030
1143 Ga0207664_10002437
1144 Ga0207644_10077325
1145 Ga0207644_10092570
1146 Ga0207644_10119922
1147 Ga0207644_10400703
1148 Ga0207690_10010965
1149 Ga0207690_10101982
1150 Ga0207706_10001631
1151 Ga0207706_10014736
1152 Ga0207706_10060867
1153 Ga0207686_10082335
1154 Ga0207670_10111613
1155 Ga0207669_10004174
1156 Ga0207669_10140723
1157 Ga0207704_10047001
1158 Ga0207704_10051187
1159 Ga0207665_10000991
1160 Ga0207691_10050701
1161 Ga0207691_10052700
1162 Ga0207691_10214831
1163 Ga0207711_10000945
1164 Ga0207711_10095261
1165 Ga0207689_10000289
1166 Ga0207689_10012535
1167 Ga0207689_10143107
1168 Ga0207689_10352371
1169 Ga0207661_10023623
1170 Ga0207661_10063594
1171 Ga0207679_10192038
1172 Ga0207679_10358800
1173 Ga0207679_10416411
1174 Ga0207667_10000047
1175 Ga0207667_10036432
1176 Ga0207667_10039681
1177 Ga0207667_10467839
1178 Ga0207651_10123132
1179 Ga0207712_10006596
1180 Ga0207712_10362772
1181 Ga0207640_10002363
1182 Ga0207640_10043600
1183 Ga0207640_10380022
1184 Ga0207658_10000663
1185 Ga0207658_10021808
1186 Ga0207658_10243774
1187 Ga0207703_10032726
1188 Ga0207703_10160533
1189 Ga0207639_10001346
1190 Ga0207678_10000160
1191 Ga0207678_10027279
1192 Ga0207678_10124175
1193 Ga0207678_10241128
1194 Ga0207708_10000888
1195 Ga0207708_10013319
1196 Ga0207708_10407124
1197 Ga0207702_10184048
1198 Ga0207641_10015484
1199 Ga0207641_10118381
1200 Ga0207648_10004502
1201 Ga0207648_10010208
1202 Ga0207648_10062249
1203 Ga0207648_10132887
1204 Ga0207648_10467855
1205 Ga0207676_10022363
1206 Ga0207674_10000012
1207 Ga0207674_10005235
1208 Ga0207674_10032089
1209 Ga0207674_10035898
1210 Ga0207674_10050998
1211 Ga0207674_10133157
1212 Ga0207675_100007676
1213 Ga0207675_100094817
1214 Ga0207683_10000797
1215 Ga0207683_10005272
1216 Ga0207683_10015047
1217 Ga0207683_10095783
1218 Ga0207698_10006055
1219 Ga0209984_1001657
1220 Ga0209970_1001427
1221 Ga0209983_1000693
1222 Ga0209971_1002046
1223 Ga0268266_10082590
1224 Ga0268266_10107297
1225 Ga0268266_10151515
1226 Ga0268265_10012118
1227 Ga0268265_10553405
1228 Ga0268264_10007894
1229 Ga0268264_10051279
1230 Ga0265323_10017208
1231 Ga0265338_10015780
1232 Ga0265338_10091589
1233 Ga0316183_1005705
1234 Ga0316181_1169600
1235 Ga0265762_1007251
1236 Ga0265770_1000674
1237 Ga0265760_10002180
1238 Ga0265325_10002157
1239 Ga0307513_10002018
1240 Ga0307513_10089006
1241 Ga0307408_100132825
1242 Ga0307516_10004141
1243 Ga0307413_10216378
1244 Ga0307413_10419226
1245 Ga0307518_10003354
1246 Ga0307410_10079868
1247 Ga0307410_10126225
1248 Ga0307410_10249498
1249 Ga0307412_10103778
1250 Ga0307409_100006173
1251 Ga0307409_100300013
1252 Ga0307416_100180894
1253 Ga0307414_10074074
1254 Ga0307414_10136174
1255 Ga0307414_10268059
1256 Ga0307414_10435834
1257 Ga0307411_10118434
1258 Ga0307415_100074442
1259 Ga0307415_100101943
1260 Ga0307415_100182880
1261 Ga0373934_0018939
1262 Ga0373944_0012545
1263 Ga0373936_0079879
1264 Ga0373953_0075492
1265 Ga0373954_0012360
1266 Ga0373957_0039106
1267 Ga0373943_0097633
1268 Ga0316574_0057119
1269 Ga0373931_0061927
1270 Ga0373933_0000044
1271 Ga0373933_0003201
1272 Ga0373933_0114046
1273 Ga0373933_0171765
1274 Ga0373947_0048570
1275 Ga0373947_0123460
1276 Ga0373937_0000050
1277 Ga0373937_0017793
1278 Ga0316582_0004491
1279 Ga0373925_0202297
1280 Ga0395905_0003815
1281 Ga0395905_0153241
1282 Ga0395905_0269429
1283 Ga0395901_0000215
1284 Ga0436365_0818700
1285 Ga0436365_0841650
1286 Ga0439436_0005513
1287 Ga0439436_0076162
1288 Ga0439439_0000316
1289 Ga0439439_0015190
1290 Ga0439461_0003918
1291 Ga0439465_0006869
1292 Ga0451789_1143133
1293 Ga0451791_0749437
1294 Ga0451793_0416064
1295 Ga0451793_1561296
1296 Ga0451800_0088931
1297 Ga0451806_279372
1298 Ga0451843_0620283
1299 Ga0439442_008192
1300 Ga0439445_0001491
1301 Ga0439449_0000056
1302 Ga0439449_0001472
1303 Ga0439449_0001609
1304 Ga0439449_0005191
1305 Ga0439434_0022524
1306 Ga0466972_0003287
1307 Ga0466966_0048653
1308 Ga0466966_0138855
1309 Ga0466961_0027210
1310 Ga0466961_0047434
1311 Ga0466961_0146768
1312 Ga0466963_0018000
1313 Ga0466964_0081309
1314 Ga0466971_0082278
1315 Ga0466971_0118587
1316 Ga0466970_0000034
1317 Ga0466957_0001063
1318 Ga0466959_0028392
1319 Ga0466959_0086499
1320 Ga0466959_0224178
1321 Ga0451576_0006973
1322 Ga0466958_0065450
1323 Ga0466958_0112374
1324 Ga0466967_0026332
1325 Ga0466967_0146122
1326 Ga0466967_0596340
1327 Ga0495629_0037205
1328 Ga0495638_0024634
1329 Ga0495641_0006990
1330 Ga0495651_0001235
1331 Ga0495651_0007805
1332 Ga0495651_0190308
1333 Ga0495653_0007671
1334 Ga0495582_0027317
1335 Ga0495582_0031344
1336 Ga0495605_0089304
1337 Ga0495639_0127951
1338 Ga0495662_0057553
1339 Ga0495664_0004094
1340 Ga0495664_0151351
1341 Ga0495607_0141297
1342 Ga0495606_0003021
1343 Ga0495608_0292377
1344 Ga0495610_0004372
1345 Ga0495616_0037659
1346 Ga0495616_0044718
1347 Ga0495628_0173772
1348 Ga0495631_0002447
1349 Ga0495663_0000387
1350 Ga0495666_0026232
1351 Ga0495642_0013810
1352 Ga0495640_0095420
1353 Ga0495587_0000183
1354 Ga0495621_0043335
1355 Ga0495645_0079614
1356 Ga0495645_0103418
1357 Ga0495633_0000651
1358 Ga0495667_0086586
1359 Ga0495625_0107482
1360 Ga0495599_0057796
1361 Ga0495623_0088097
1362 Ga0495646_0155829
1363 Ga0495658_0010396
1364 Ga0495658_0087538
1365 Ga0495624_0006000
1366 Ga0495660_0096688
1367 Ga0495581_0024555
1368 Ga0495604_0191762
1369 Ga0495674_0009636
1370 Ga0495681_0082551
1371 Ga0495686_0005817
1372 Ga0495593_0004328
1373 Ga0495593_0279611
1374 Ga0495602_0000053
1375 Ga0495602_0111159
1376 Ga0495614_0020766
1377 Ga0496100_0098471
1378 Ga0496100_0152423
1379 Ga0496100_0184880
1380 Ga0496101_0033138
1381 Ga0496104_0000017
1382 Ga0496104_0011176
1383 Ga0496104_0022256
1384 Ga0496105_0000009
1385 Ga0496105_0046384
1386 Ga0496106_0264415
1387 Ga0496108_0027171
1388 Ga0496108_0053148
1389 Ga0496108_0086086
1390 Ga0496110_0008627
1391 Ga0496110_0588143
1392 Ga0496112_0115517
1393 Ga0496112_0215929
1394 Ga0496113_0111684
1395 Ga0496114_0000155
1396 Ga0496114_0004607
1397 Ga0496115_0019526
1398 Ga0496115_0158870
1399 Ga0496117_0000826
1400 Ga0496117_0006643
1401 Ga0496117_0057775
1402 Ga0496118_0025065
1403 Ga0496118_0127746
1404 Ga0496118_0173618
1405 Ga0496119_0002773
1406 Ga0496120_0000273
1407 Ga0496121_0085053
1408 Ga0496122_0000417
1409 Ga0496122_0012311
1410 Ga0496123_0000137
1411 Ga0496123_0002212
1412 Ga0496124_0000034
1413 Ga0496124_0000872
1414 Ga0496125_0000044
1415 Ga0496126_0016963
1416 Ga0496126_0017271
1417 Ga0501031_0050062
1418 Ga0501032_0023436
1419 Ga0501032_0076833
1420 Ga0501034_0000521
1421 Ga0501034_0000923
1422 Ga0501034_0159319
1423 Ga0501034_0187070
1424 Ga0501036_0054608
1425 Ga0501036_0115561
1426 Ga0501037_0077888
1427 Ga0501037_0299078
1428 Ga0501037_0326394
1429 Ga0501038_0032429
1430 Ga0501039_0078938
1431 Ga0501040_0416396
1432 Ga0501041_0007760
1433 Ga0501042_0042463
1434 Ga0501043_0216995
1435 Ga0501043_0273435
1436 Ga0501046_0005045
1437 Ga0501046_0119437
1438 Ga0501046_0222432
1439 Ga0501047_0046639
1440 Ga0501047_0059050
1441 Ga0501047_0150132
1442 Ga0501047_0443099
1443 Ga0501048_0053019
1444 Ga0501069_0002341
1445 Ga0501070_0007770
1446 Ga0501070_0134398
1447 Ga0501071_0035224
1448 Ga0501072_0007719
1449 Ga0501073_0026367
1450 Ga0501073_0038939
1451 Ga0501073_0074055
1452 Ga0501074_0092078
1453 Ga0501075_0066719
1454 Ga0501076_0008850
1455 Ga0501076_0204266
1456 Ga0501077_0071229
1457 Ga0501217_018657
1458 Ga0501225_0001698
1459 Ga0501079_0003471
1460 Ga0501079_0078558
1461 Ga0501079_0233022
1462 Ga0501080_0003421
1463 Ga0501080_0079020
1464 Ga0501080_0171804
1465 Ga0501080_0291974
1466 Ga0501081_0040667
1467 Ga0501081_0224909
1468 Ga0501035_0145163
1469 Ga0501035_0409300
1470 Ga0501035_0472380
1471 Ga0501044_0251104
1472 Ga0501045_0003175
1473 Ga0501045_0408725
1474 nmdc:mga05p37_282623_c1
1475 nmdc:mga05p37_55834_c1
1476 nmdc:mga05p37_609254_c1
1477 nmdc:mga09592_62508_c1
1478 nmdc:mga0qj67_171670_c1
1479 nmdc:mga0qj67_3715_c1
1480 nmdc:mga06r32_32272_c1
1481 nmdc:mga06r32_92745_c1
1482 nmdc:mga08y16_426537_c1
1483 nmdc:mga08y16_701898_c1
1484 nmdc:mga0n895_7143_c1
1485 nmdc:mga0rr50_243703_c1
1486 nmdc:mga0rr50_5169_c1
1487 nmdc:mga08x19_111409_c1
1488 nmdc:mga08x19_1_c1
1489 nmdc:mga0a205_299567_c1
1490 Ga0495601_0034728
1491 Ga0495601_0305762
1492 Ga0495612_0003013
1493 Ga0495595_0003624
1494 Ga0495619_0025722
1495 Ga0500643_002076
1496 Ga0500651_0000690
1497 Ga0500597_000320
1498 Ga0501084_0032589
1499 Ga0501084_0045617
1500 Ga0501084_0060561
1501 Ga0501082_0024016
1502 Ga0501082_0063666
1503 Ga0501082_0066131
1504 Ga0466962_0024040
1505 Ga0466962_0031903
1506 Ga0530510_0027384
1507 Ga0530510_0128361
1508 Ga0530510_0149248
1509 Ga0530510_0194453
1510 2501944882
1511 2643818553
1512 2643880571
1513 2643938315
1514 2644078950
1515 2644661140
1516 2644693727
1517 2644699218
1518 2676493692
1519 2819661313
1520 2832005315
1521 2842758991
1522 2842784528
1523 2855674314
1524 2855679748
1525 2855688007
1526 2856859670
1527 2857290662
1528 2858884990
1529 2858891871
1530 2858899649
1531 2861526670
1532 2863412679
1533 2866071476
1534 2867304689
1535 2867318743
1536 2867323941
1537 2869052030
1538 2869063309
1539 2869072753
1540 2880494449
1541 2880497855
1542 2891404108
1543 2895437825
1544 2895448312
1545 2929219911
1546 2929226424
1547 649810163
1548 8002869911
1549 8003836225
1550 8003874644
1551 8011355790
1552 8054710509
1553 8054729131
1554 8054740494
1555 8055178601
1556 8057574466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

156

0.94

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

161

292

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fox-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with kynurenine 0.9492 1 30
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9481 1 30
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9476 2 30
7ctq-assembly2.cif.gz_B peptidyl tryptophan dihydroxylase qhpg essential for tryptophylquinone cofactor biogenesis 0.9472 3 29
6fph-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1h 0.9463 1 30
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9454 2 170 3.40.50.720
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 2 169 3.40.50.720
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.94 2 164 3.40.50.720
af_O65404_36_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9361 2 32 3.50.50.60
af_Q54RE8_8_392_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9348 3 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9859 47 154 GO:0004616
GO:0050661
AF-T1B9E1-F1-model_v4 6-phosphogluconate dehydrogenase, NAD-binding domain protein (EC 1.1.-.-) 0.9827 1 67 GO:0016491
GO:0050661
AF-A0A521XLA1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9805 1 143 GO:0004616
GO:0050661
AF-A0A537CJ56-F1-model_v4 6-phosphogluconate dehydrogenase 0.9793 1 136 GO:0004616
GO:0050661
AF-A0A7W1CXV2-F1-model_v4 NAD(P)-binding domain-containing protein 0.9754 1 144 GO:0004616
GO:0050661

Map