F480234
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 774 | 454 | 736 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0007616|Ga0466969_0007616_1068_2177 |
| Length | 330 |
| Sequence | MNDLGGRRANGARSRHTQAPLIGTTRQDSATNAMRDIYAIGDLQGCQTSFEQLLARLPQDSDLWLAGDLVNRGPRSLDTLRQVIALGDRVTAVLGNHDLHLLAVAAGVRQAHGSDTIDDILNAPDRDALIDWVRHQPLAHFARGHLMVHAGVLPQWDAAQVISLAQDVQTQLRGPDWKTFLSRMFGNQPDQWQEGLGDEDRQRLTINALTRMRFCTADGRIDFKIKEGADAATEALKPWFDAPGRRTSDVTMVFGHWSALGLVMRDRLLGLDTGCVWGGKLTAVKLAETPAGRDLIQIDCPQIRDPFASADGKKRNKHKLDAPLRKGDGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 7 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 8 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 9 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 10 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 11 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 12 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 13 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 14 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 15 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 16 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 17 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 18 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 21 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 22 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 23 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 24 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 25 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 26 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 27 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 28 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 29 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 30 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 31 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 32 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 33 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 34 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 35 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 36 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 37 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 38 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 39 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 42 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 43 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 44 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 47 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 48 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 49 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 50 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 51 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 52 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 113 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 114 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 206 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 207 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 255 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 256 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 257 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 258 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 261 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 262 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 263 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 268 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 269 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 270 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 271 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 272 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 273 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 274 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 275 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 276 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 277 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 278 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 279 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 280 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 281 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 282 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 283 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 286 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 287 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 288 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 289 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 290 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 291 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 292 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 383 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 392 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 407 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 408 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 410 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 411 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 412 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 413 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 414 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 416 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 417 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 418 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 419 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 422 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 426 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 427 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 439 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 441 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 442 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 443 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 444 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 445 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 446 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 447 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 449 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 451 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 452 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 454 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.09 |
| Metatranscriptomes | 0 |
| Isolates | 4.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.16 |
| Nodule | 1.03 |
| Rhizoplane | 2.33 |
| Rhizosphere | 67.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002764 | 3300001979 | Bacteria | 7850 |
| 2 | JGI25155J39150_1000005 | 3300002704 | Bacteria | 261712 |
| 3 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 4 | JGI25154J39366_1000015 | 3300002738 | Bacteria | 261778 |
| 5 | JGI25158J39367_1004793 | 3300002739 | Bacteria | 2014 |
| 6 | JGI25158J39367_1007049 | 3300002739 | Bacteria | 1596 |
| 7 | JGI25157J39369_1000016 | 3300002741 | Bacteria | 192349 |
| 8 | JGI25150J39212_1003538 | 3300002774 | Bacteria | 3647 |
| 9 | JGI25159J45721_1000065 | 3300002987 | Bacteria | 51403 |
| 10 | JGI25159J45721_1011231 | 3300002987 | Bacteria | 2215 |
| 11 | JGI25151J46595_10000614 | 3300003187 | Bacteria | 31207 |
| 12 | JGI25151J46595_10000935 | 3300003187 | Bacteria | 22615 |
| 13 | JGI25151J46595_10005710 | 3300003187 | Bacteria | 6384 |
| 14 | JGI25151J46595_10031914 | 3300003187 | Bacteria | 2049 |
| 15 | JGI25151J46595_10055061 | 3300003187 | Bacteria | 1314 |
| 16 | JGI25151J46595_10057071 | 3300003187 | Bacteria | 1275 |
| 17 | rootH1_10002293 | 3300003316 | Bacteria | 5018 |
| 18 | rootH1_10005867 | 3300003316 | Bacteria | 7077 |
| 19 | rootH2_10140946 | 3300003320 | Bacteria | 2542 |
| 20 | rootL2_10005248 | 3300003322 | Bacteria | 26533 |
| 21 | rootL2_10010992 | 3300003322 | Bacteria | 49384 |
| 22 | rootL2_10027335 | 3300003322 | Bacteria | 1194 |
| 23 | rootH1_10016719 | 3300003323 | Bacteria | 30697 |
| 24 | rootH1_10037528 | 3300003323 | Bacteria | 5424 |
| 25 | rootH1_10094518 | 3300003323 | Bacteria | 3692 |
| 26 | rootH1_10106554 | 3300003323 | Bacteria | 2349 |
| 27 | rootH1_10203174 | 3300003323 | Bacteria | 1676 |
| 28 | JGI25160J50197_1000098 | 3300003354 | Bacteria | 87307 |
| 29 | JGI25161J50226_1000037 | 3300003374 | Bacteria | 133331 |
| 30 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 31 | Ga0055529_1000127 | 3300003763 | Bacteria | 109148 |
| 32 | Ga0055526_1000985 | 3300003771 | Bacteria | 20948 |
| 33 | Ga0055526_1002586 | 3300003771 | Bacteria | 12095 |
| 34 | Ga0055526_1005064 | 3300003771 | Bacteria | 7695 |
| 35 | Ga0055526_1005110 | 3300003771 | Bacteria | 7652 |
| 36 | Ga0055537_1000463 | 3300003773 | Bacteria | 25524 |
| 37 | Ga0055537_1000876 | 3300003773 | Bacteria | 14379 |
| 38 | Ga0055537_1001110 | 3300003773 | Bacteria | 11640 |
| 39 | Ga0055524_1000196 | 3300003775 | Bacteria | 66415 |
| 40 | Ga0055524_1000261 | 3300003775 | Bacteria | 53201 |
| 41 | Ga0055524_1000761 | 3300003775 | Bacteria | 21714 |
| 42 | Ga0055524_1004096 | 3300003775 | Bacteria | 6840 |
| 43 | Ga0055524_1012988 | 3300003775 | Bacteria | 3167 |
| 44 | Ga0055536_1000022 | 3300003781 | Bacteria | 198244 |
| 45 | Ga0055534_1000270 | 3300003784 | Bacteria | 35440 |
| 46 | Ga0055534_1000368 | 3300003784 | Bacteria | 28258 |
| 47 | Ga0055534_1002591 | 3300003784 | Bacteria | 6176 |
| 48 | Ga0055534_1022796 | 3300003784 | Bacteria | 1032 |
| 49 | Ga0055528_1003437 | 3300003790 | Bacteria | 7948 |
| 50 | Ga0055530_10000190 | 3300003791 | Bacteria | 55126 |
| 51 | Ga0055530_10012241 | 3300003791 | Bacteria | 3007 |
| 52 | Ga0055540_1000187 | 3300003792 | Bacteria | 59910 |
| 53 | Ga0055540_1010573 | 3300003792 | Bacteria | 3060 |
| 54 | Ga0055531_10000765 | 3300003794 | Bacteria | 26813 |
| 55 | Ga0055531_10001838 | 3300003794 | Bacteria | 14978 |
| 56 | Ga0055531_10009989 | 3300003794 | Bacteria | 4784 |
| 57 | Ga0055531_10012043 | 3300003794 | Bacteria | 4105 |
| 58 | Ga0055531_10041802 | 3300003794 | Bacteria | 1321 |
| 59 | Ga0055543_1001040 | 3300004625 | Bacteria | 12317 |
| 60 | Ga0055543_1009791 | 3300004625 | Bacteria | 2039 |
| 61 | Ga0065165_1000153 | 3300005262 | Bacteria | 120209 |
| 62 | Ga0065165_1000447 | 3300005262 | Bacteria | 64800 |
| 63 | Ga0065165_1000816 | 3300005262 | Bacteria | 41256 |
| 64 | Ga0065165_1008081 | 3300005262 | Bacteria | 5019 |
| 65 | Ga0065165_1019554 | 3300005262 | Bacteria | 2411 |
| 66 | Ga0065165_1048047 | 3300005262 | Bacteria | 1228 |
| 67 | Ga0065714_10069965 | 3300005288 | Bacteria | 4019 |
| 68 | Ga0065704_10153150 | 3300005289 | Bacteria | 1413 |
| 69 | Ga0070676_10275423 | 3300005328 | Bacteria | 1132 |
| 70 | Ga0070670_100039689 | 3300005331 | Bacteria | 4048 |
| 71 | Ga0068869_100122717 | 3300005334 | Bacteria | 1989 |
| 72 | Ga0068868_100012661 | 3300005338 | Bacteria | 6170 |
| 73 | Ga0068868_100049498 | 3300005338 | Bacteria | 3298 |
| 74 | Ga0070689_100061503 | 3300005340 | Bacteria | 2921 |
| 75 | Ga0070691_10199715 | 3300005341 | Bacteria | 1050 |
| 76 | Ga0070687_100213944 | 3300005343 | Bacteria | 1176 |
| 77 | Ga0070687_100316115 | 3300005343 | Bacteria | 996 |
| 78 | Ga0070661_100359613 | 3300005344 | Bacteria | 1144 |
| 79 | Ga0070669_100033317 | 3300005353 | Bacteria | 3726 |
| 80 | Ga0070675_100087152 | 3300005354 | Bacteria | 2611 |
| 81 | Ga0070674_100107379 | 3300005356 | Bacteria | 2044 |
| 82 | Ga0070659_100003416 | 3300005366 | Bacteria | 11314 |
| 83 | Ga0070694_100079143 | 3300005444 | Bacteria | 2281 |
| 84 | Ga0070678_100071614 | 3300005456 | Bacteria | 2595 |
| 85 | Ga0070678_100234981 | 3300005456 | Bacteria | 1530 |
| 86 | Ga0070678_100242500 | 3300005456 | Bacteria | 1508 |
| 87 | Ga0070662_100002892 | 3300005457 | Bacteria | 10661 |
| 88 | Ga0070681_10550144 | 3300005458 | Bacteria | 1068 |
| 89 | Ga0068867_100000083 | 3300005459 | Bacteria | 58784 |
| 90 | Ga0070706_100240587 | 3300005467 | Bacteria | 1690 |
| 91 | Ga0070679_100017823 | 3300005530 | Bacteria | 6876 |
| 92 | Ga0070679_100027204 | 3300005530 | Bacteria | 5626 |
| 93 | Ga0070697_100184512 | 3300005536 | Bacteria | 1769 |
| 94 | Ga0070672_100160174 | 3300005543 | Bacteria | 1866 |
| 95 | Ga0070696_100016131 | 3300005546 | Bacteria | 5025 |
| 96 | Ga0070693_100011800 | 3300005547 | Bacteria | 4407 |
| 97 | Ga0068855_100205702 | 3300005563 | Bacteria | 2214 |
| 98 | Ga0070664_100385085 | 3300005564 | Bacteria | 1280 |
| 99 | Ga0070702_100129681 | 3300005615 | Bacteria | 1591 |
| 100 | Ga0068852_100062137 | 3300005616 | Bacteria | 3248 |
| 101 | Ga0068864_100075933 | 3300005618 | Bacteria | 2935 |
| 102 | Ga0068861_100390626 | 3300005719 | Bacteria | 1232 |
| 103 | Ga0068863_100160280 | 3300005841 | Bacteria | 2155 |
| 104 | Ga0068863_100210350 | 3300005841 | Bacteria | 1873 |
| 105 | Ga0068863_100553101 | 3300005841 | Bacteria | 1136 |
| 106 | Ga0068858_100145889 | 3300005842 | Bacteria | 2223 |
| 107 | Ga0068860_100190066 | 3300005843 | Bacteria | 1987 |
| 108 | Ga0068860_100205441 | 3300005843 | Bacteria | 1910 |
| 109 | Ga0068862_100218395 | 3300005844 | Bacteria | 1725 |
| 110 | Ga0075365_10078840 | 3300006038 | Bacteria | 2228 |
| 111 | Ga0075363_100022955 | 3300006048 | Bacteria | 3158 |
| 112 | Ga0075363_100088043 | 3300006048 | Bacteria | 1706 |
| 113 | Ga0075364_10019243 | 3300006051 | Bacteria | 4284 |
| 114 | Ga0075364_10031006 | 3300006051 | Bacteria | 3434 |
| 115 | Ga0075362_10011298 | 3300006177 | Bacteria | 3514 |
| 116 | Ga0075362_10039976 | 3300006177 | Bacteria | 2063 |
| 117 | Ga0075362_10070479 | 3300006177 | Bacteria | 1595 |
| 118 | Ga0075362_10146250 | 3300006177 | Bacteria | 1132 |
| 119 | Ga0075367_10085772 | 3300006178 | Bacteria | 1910 |
| 120 | Ga0075366_10002784 | 3300006195 | Bacteria | 9050 |
| 121 | Ga0075366_10010643 | 3300006195 | Bacteria | 5168 |
| 122 | Ga0075366_10246065 | 3300006195 | Bacteria | 1090 |
| 123 | Ga0075370_10001192 | 3300006353 | Bacteria | 10958 |
| 124 | Ga0075370_10001802 | 3300006353 | Bacteria | 9581 |
| 125 | Ga0075370_10197766 | 3300006353 | Bacteria | 1185 |
| 126 | Ga0075431_100078600 | 3300006847 | Bacteria | 3405 |
| 127 | Ga0075433_10001375 | 3300006852 | Bacteria | 17875 |
| 128 | Ga0075434_100000064 | 3300006871 | Bacteria | 54394 |
| 129 | Ga0075429_100073753 | 3300006880 | Bacteria | 2972 |
| 130 | Ga0075436_100001875 | 3300006914 | Bacteria | 14444 |
| 131 | Ga0099823_1011917 | 3300006944 | Bacteria | 8811 |
| 132 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 133 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 134 | Ga0075435_100001865 | 3300007076 | Bacteria | 13702 |
| 135 | Ga0105250_10006305 | 3300009092 | Bacteria | 5197 |
| 136 | Ga0105240_10058493 | 3300009093 | Bacteria | 4812 |
| 137 | Ga0111539_10007990 | 3300009094 | Bacteria | 13496 |
| 138 | Ga0111539_10108906 | 3300009094 | Bacteria | 3251 |
| 139 | Ga0105245_10281638 | 3300009098 | Bacteria | 1625 |
| 140 | Ga0114129_10047107 | 3300009147 | Bacteria | 6059 |
| 141 | Ga0105243_10000895 | 3300009148 | Bacteria | 28043 |
| 142 | Ga0105243_10026872 | 3300009148 | Bacteria | 4408 |
| 143 | Ga0105241_10049659 | 3300009174 | Bacteria | 3196 |
| 144 | Ga0105242_10003270 | 3300009176 | Bacteria | 12633 |
| 145 | Ga0105248_10003706 | 3300009177 | Bacteria | 16936 |
| 146 | Ga0105237_10000441 | 3300009545 | Bacteria | 59156 |
| 147 | Ga0105238_10024678 | 3300009551 | Bacteria | 6129 |
| 148 | Ga0105238_10191736 | 3300009551 | Bacteria | 2020 |
| 149 | Ga0105238_10938854 | 3300009551 | Unclassified | 884 |
| 150 | Ga0105249_10142651 | 3300009553 | Bacteria | 2298 |
| 151 | Ga0105239_10000417 | 3300010375 | Bacteria | 62040 |
| 152 | Ga0157319_1000016 | 3300012497 | Bacteria | 127256 |
| 153 | Ga0157370_10001585 | 3300013104 | Bacteria | 28149 |
| 154 | Ga0157378_10284520 | 3300013297 | Bacteria | 1595 |
| 155 | Ga0163162_10602926 | 3300013306 | Bacteria | 1224 |
| 156 | Ga0182008_10005352 | 3300014497 | Bacteria | 7328 |
| 157 | Ga0157377_10000104 | 3300014745 | Bacteria | 58794 |
| 158 | Ga0157379_10030130 | 3300014968 | Bacteria | 4827 |
| 159 | Ga0157379_10235902 | 3300014968 | Bacteria | 1659 |
| 160 | Ga0157376_10070386 | 3300014969 | Bacteria | 2969 |
| 161 | Ga0182007_10000761 | 3300015262 | Bacteria | 18052 |
| 162 | Ga0182007_10055158 | 3300015262 | Bacteria | 1307 |
| 163 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 164 | Ga0163161_10000127 | 3300017792 | Bacteria | 71051 |
| 165 | Ga0163161_10018567 | 3300017792 | Bacteria | 4873 |
| 166 | Ga0163161_10034424 | 3300017792 | Bacteria | 3624 |
| 167 | Ga0213872_10000004 | 3300021361 | Bacteria | 306230 |
| 168 | Ga0213872_10000012 | 3300021361 | Bacteria | 191291 |
| 169 | Ga0213872_10000077 | 3300021361 | Bacteria | 90250 |
| 170 | Ga0213872_10000324 | 3300021361 | Bacteria | 40551 |
| 171 | Ga0213872_10001319 | 3300021361 | Bacteria | 16438 |
| 172 | Ga0213872_10002068 | 3300021361 | Bacteria | 12145 |
| 173 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 174 | Ga0209436_103957 | 3300025208 | Bacteria | 3764 |
| 175 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 176 | Ga0207425_1006514 | 3300025245 | Bacteria | 3185 |
| 177 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 178 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 179 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 180 | Ga0209129_1011907 | 3300025258 | Bacteria | 2042 |
| 181 | Ga0209565_1000102 | 3300025263 | Bacteria | 127545 |
| 182 | Ga0209565_1000411 | 3300025263 | Bacteria | 35316 |
| 183 | Ga0209565_1000966 | 3300025263 | Bacteria | 14968 |
| 184 | Ga0209565_1002030 | 3300025263 | Bacteria | 7799 |
| 185 | Ga0209673_1000189 | 3300025273 | Bacteria | 123470 |
| 186 | Ga0209673_1008368 | 3300025273 | Bacteria | 4611 |
| 187 | Ga0209673_1010389 | 3300025273 | Bacteria | 3927 |
| 188 | Ga0209130_1000141 | 3300025284 | Bacteria | 115378 |
| 189 | Ga0209130_1000423 | 3300025284 | Bacteria | 45537 |
| 190 | Ga0209130_1000951 | 3300025284 | Bacteria | 22947 |
| 191 | Ga0209675_1000070 | 3300025291 | Bacteria | 169161 |
| 192 | Ga0209675_1000288 | 3300025291 | Bacteria | 47740 |
| 193 | Ga0209675_1000383 | 3300025291 | Bacteria | 36811 |
| 194 | Ga0209675_1000389 | 3300025291 | Bacteria | 36614 |
| 195 | Ga0209675_1002912 | 3300025291 | Bacteria | 8476 |
| 196 | Ga0209675_1009066 | 3300025291 | Bacteria | 3559 |
| 197 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 198 | Ga0209676_1000069 | 3300025292 | Bacteria | 312462 |
| 199 | Ga0209676_1029305 | 3300025292 | Bacteria | 1701 |
| 200 | Ga0209025_1000124 | 3300025294 | Bacteria | 201973 |
| 201 | Ga0209025_1001088 | 3300025294 | Bacteria | 39306 |
| 202 | Ga0209025_1001306 | 3300025294 | Bacteria | 34010 |
| 203 | Ga0209025_1002311 | 3300025294 | Bacteria | 20651 |
| 204 | Ga0209025_1003168 | 3300025294 | Bacteria | 16001 |
| 205 | Ga0209025_1005103 | 3300025294 | Bacteria | 10918 |
| 206 | Ga0209025_1033082 | 3300025294 | Bacteria | 2399 |
| 207 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 208 | Ga0209564_1000350 | 3300025295 | Bacteria | 86762 |
| 209 | Ga0209564_1000380 | 3300025295 | Bacteria | 81287 |
| 210 | Ga0209564_1000415 | 3300025295 | Bacteria | 75119 |
| 211 | Ga0209564_1000497 | 3300025295 | Bacteria | 64942 |
| 212 | Ga0209564_1001117 | 3300025295 | Bacteria | 31602 |
| 213 | Ga0209564_1008921 | 3300025295 | Bacteria | 4864 |
| 214 | Ga0209564_1011606 | 3300025295 | Bacteria | 3929 |
| 215 | Ga0209758_1003237 | 3300025297 | Bacteria | 15125 |
| 216 | Ga0209758_1040734 | 3300025297 | Bacteria | 1748 |
| 217 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 218 | Ga0209050_1002239 | 3300025298 | Bacteria | 17258 |
| 219 | Ga0209050_1002352 | 3300025298 | Bacteria | 16517 |
| 220 | Ga0209050_1004909 | 3300025298 | Bacteria | 8742 |
| 221 | Ga0209050_1010655 | 3300025298 | Bacteria | 4492 |
| 222 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 223 | Ga0209256_1000059 | 3300025299 | Bacteria | 272170 |
| 224 | Ga0209256_1000496 | 3300025299 | Bacteria | 57666 |
| 225 | Ga0209256_1000842 | 3300025299 | Bacteria | 38479 |
| 226 | Ga0209256_1002703 | 3300025299 | Bacteria | 13836 |
| 227 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 228 | Ga0207426_1004246 | 3300025302 | Bacteria | 7111 |
| 229 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 230 | Ga0209051_1000639 | 3300025303 | Bacteria | 40255 |
| 231 | Ga0209051_1000928 | 3300025303 | Bacteria | 29063 |
| 232 | Ga0209051_1003952 | 3300025303 | Bacteria | 9439 |
| 233 | Ga0209051_1013653 | 3300025303 | Bacteria | 3848 |
| 234 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 235 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 236 | Ga0209257_1003877 | 3300025304 | Bacteria | 12209 |
| 237 | Ga0209257_1004170 | 3300025304 | Bacteria | 11478 |
| 238 | Ga0207696_1005757 | 3300025711 | Bacteria | 5092 |
| 239 | Ga0207645_10271834 | 3300025907 | Bacteria | 1124 |
| 240 | Ga0207684_10199097 | 3300025910 | Bacteria | 1728 |
| 241 | Ga0207654_10043309 | 3300025911 | Bacteria | 2551 |
| 242 | Ga0207695_10004036 | 3300025913 | Bacteria | 20195 |
| 243 | Ga0207671_10007150 | 3300025914 | Bacteria | 9741 |
| 244 | Ga0207649_10002113 | 3300025920 | Bacteria | 11254 |
| 245 | Ga0207652_10085609 | 3300025921 | Bacteria | 2762 |
| 246 | Ga0207681_10030861 | 3300025923 | Bacteria | 3497 |
| 247 | Ga0207694_10017517 | 3300025924 | Bacteria | 5415 |
| 248 | Ga0207687_10182831 | 3300025927 | Bacteria | 1625 |
| 249 | Ga0207690_10001070 | 3300025932 | Bacteria | 17526 |
| 250 | Ga0207706_10000544 | 3300025933 | Bacteria | 39990 |
| 251 | Ga0207686_10003771 | 3300025934 | Bacteria | 8132 |
| 252 | Ga0207709_10000032 | 3300025935 | Bacteria | 324478 |
| 253 | Ga0207709_10015374 | 3300025935 | Bacteria | 4242 |
| 254 | Ga0207670_10109996 | 3300025936 | Bacteria | 1984 |
| 255 | Ga0207670_10143830 | 3300025936 | Bacteria | 1761 |
| 256 | Ga0207691_10075959 | 3300025940 | Bacteria | 3028 |
| 257 | Ga0207711_10016794 | 3300025941 | Bacteria | 6079 |
| 258 | Ga0207679_10000119 | 3300025945 | Bacteria | 63967 |
| 259 | Ga0207679_10417696 | 3300025945 | Bacteria | 1183 |
| 260 | Ga0207667_10413258 | 3300025949 | Bacteria | 1373 |
| 261 | Ga0207651_10038244 | 3300025960 | Bacteria | 3152 |
| 262 | Ga0207668_10294510 | 3300025972 | Bacteria | 1337 |
| 263 | Ga0207677_10006076 | 3300026023 | Bacteria | 6589 |
| 264 | Ga0207677_10023415 | 3300026023 | Bacteria | 3815 |
| 265 | Ga0207677_10322122 | 3300026023 | Bacteria | 1285 |
| 266 | Ga0207639_10144109 | 3300026041 | Bacteria | 1988 |
| 267 | Ga0207639_10366866 | 3300026041 | Bacteria | 1290 |
| 268 | Ga0207702_10168555 | 3300026078 | Bacteria | 2006 |
| 269 | Ga0207641_10151766 | 3300026088 | Bacteria | 2099 |
| 270 | Ga0207641_10282398 | 3300026088 | Bacteria | 1562 |
| 271 | Ga0207641_10514052 | 3300026088 | Bacteria | 1164 |
| 272 | Ga0207648_10000243 | 3300026089 | Bacteria | 58746 |
| 273 | Ga0207648_10784171 | 3300026089 | Bacteria | 886 |
| 274 | Ga0207676_10026632 | 3300026095 | Bacteria | 4300 |
| 275 | Ga0207676_10050322 | 3300026095 | Bacteria | 3248 |
| 276 | Ga0207675_100059637 | 3300026118 | Bacteria | 3561 |
| 277 | Ga0207675_100529971 | 3300026118 | Bacteria | 1175 |
| 278 | Ga0207683_10044447 | 3300026121 | Bacteria | 3883 |
| 279 | Ga0207683_10070600 | 3300026121 | Bacteria | 3086 |
| 280 | Ga0207698_10032373 | 3300026142 | Bacteria | 3787 |
| 281 | Ga0207698_10696665 | 3300026142 | Bacteria | 1010 |
| 282 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 283 | Ga0209371_1029846 | 3300027312 | Bacteria | 1200 |
| 284 | Ga0209970_1000301 | 3300027614 | Bacteria | 8157 |
| 285 | Ga0209282_1000064 | 3300027666 | Bacteria | 91973 |
| 286 | Ga0209971_1002004 | 3300027682 | Bacteria | 4953 |
| 287 | Ga0209813_10024948 | 3300027866 | Bacteria | 1715 |
| 288 | Ga0209974_10002829 | 3300027876 | Bacteria | 6302 |
| 289 | Ga0207428_10014008 | 3300027907 | Bacteria | 6984 |
| 290 | Ga0268265_10659008 | 3300028380 | Bacteria | 1007 |
| 291 | Ga0268264_10169873 | 3300028381 | Bacteria | 1971 |
| 292 | Ga0307515_10002745 | 3300028794 | Bacteria | 37653 |
| 293 | Ga0307515_10006997 | 3300028794 | Bacteria | 22401 |
| 294 | Ga0307515_10014617 | 3300028794 | Bacteria | 14532 |
| 295 | Ga0307515_10017471 | 3300028794 | Bacteria | 13059 |
| 296 | Ga0307515_10067591 | 3300028794 | Bacteria | 4926 |
| 297 | Ga0307515_10357348 | 3300028794 | Bacteria | 1104 |
| 298 | Ga0307515_10428656 | 3300028794 | Bacteria | 941 |
| 299 | Ga0268256_1030016 | 3300030500 | Bacteria | 1323 |
| 300 | Ga0307512_10042866 | 3300030522 | Bacteria | 3741 |
| 301 | Ga0316181_1225858 | 3300030744 | Bacteria | 1474 |
| 302 | Ga0316182_1383265 | 3300030745 | Bacteria | 2027 |
| 303 | Ga0265332_10010386 | 3300031238 | Bacteria | 4144 |
| 304 | Ga0265328_10017791 | 3300031239 | Bacteria | 2750 |
| 305 | Ga0265329_10009325 | 3300031242 | Bacteria | 3667 |
| 306 | Ga0265327_10000235 | 3300031251 | Bacteria | 111362 |
| 307 | Ga0265327_10063536 | 3300031251 | Bacteria | 1874 |
| 308 | Ga0265316_10153241 | 3300031344 | Bacteria | 1726 |
| 309 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 310 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 311 | Ga0307513_10007087 | 3300031456 | Bacteria | 14577 |
| 312 | Ga0307513_10099934 | 3300031456 | Bacteria | 2928 |
| 313 | Ga0307509_10125778 | 3300031507 | Bacteria | 2530 |
| 314 | Ga0307509_10140135 | 3300031507 | Bacteria | 2355 |
| 315 | Ga0307408_100000165 | 3300031548 | Bacteria | 73853 |
| 316 | Ga0307408_100000438 | 3300031548 | Bacteria | 36836 |
| 317 | Ga0307408_100001378 | 3300031548 | Bacteria | 18115 |
| 318 | Ga0307408_100001760 | 3300031548 | Bacteria | 15807 |
| 319 | Ga0307408_100013147 | 3300031548 | Bacteria | 5493 |
| 320 | Ga0307408_100013539 | 3300031548 | Bacteria | 5414 |
| 321 | Ga0307408_100014599 | 3300031548 | Bacteria | 5219 |
| 322 | Ga0307408_100026194 | 3300031548 | Bacteria | 4002 |
| 323 | Ga0307408_100508273 | 3300031548 | Bacteria | 1056 |
| 324 | Ga0307514_10001054 | 3300031649 | Bacteria | 39555 |
| 325 | Ga0265314_10000727 | 3300031711 | Bacteria | 39795 |
| 326 | Ga0265314_10057988 | 3300031711 | Bacteria | 2655 |
| 327 | Ga0307516_10008369 | 3300031730 | Bacteria | 11721 |
| 328 | Ga0307516_10384694 | 3300031730 | Bacteria | 1064 |
| 329 | Ga0307405_10018659 | 3300031731 | Bacteria | 3832 |
| 330 | Ga0307405_10179141 | 3300031731 | Bacteria | 1520 |
| 331 | Ga0307406_10003154 | 3300031901 | Bacteria | 8971 |
| 332 | Ga0307406_10014450 | 3300031901 | Bacteria | 4544 |
| 333 | Ga0307416_100007980 | 3300032002 | Bacteria | 6780 |
| 334 | Ga0307414_10074486 | 3300032004 | Bacteria | 2460 |
| 335 | Ga0307411_10001640 | 3300032005 | Bacteria | 9332 |
| 336 | Ga0307411_10103341 | 3300032005 | Bacteria | 2021 |
| 337 | Ga0307415_100101370 | 3300032126 | Bacteria | 2113 |
| 338 | Ga0373950_0009468 | 3300034818 | Bacteria | 1557 |
| 339 | Ga0373934_0000209 | 3300035086 | Bacteria | 21432 |
| 340 | Ga0373934_0009596 | 3300035086 | Bacteria | 3628 |
| 341 | Ga0373940_0011326 | 3300035088 | Bacteria | 2116 |
| 342 | Ga0373944_0063361 | 3300035089 | Bacteria | 1190 |
| 343 | Ga0373951_0009094 | 3300035091 | Bacteria | 2240 |
| 344 | Ga0373923_0052788 | 3300035111 | Bacteria | 1708 |
| 345 | Ga0373923_0056415 | 3300035111 | Bacteria | 1658 |
| 346 | Ga0373923_0215049 | 3300035111 | Bacteria | 892 |
| 347 | Ga0373936_0068977 | 3300035113 | Bacteria | 1454 |
| 348 | Ga0373939_0000372 | 3300035114 | Bacteria | 11306 |
| 349 | Ga0373953_0021321 | 3300035117 | Bacteria | 2429 |
| 350 | Ga0373953_0077125 | 3300035117 | Bacteria | 1381 |
| 351 | Ga0373954_0033657 | 3300035118 | Bacteria | 2371 |
| 352 | Ga0373956_0000006 | 3300035119 | Bacteria | 65782 |
| 353 | Ga0373956_0007077 | 3300035119 | Bacteria | 4513 |
| 354 | Ga0373957_0002256 | 3300035120 | Bacteria | 5462 |
| 355 | Ga0373943_0006998 | 3300035170 | Bacteria | 5059 |
| 356 | Ga0373946_0032277 | 3300035171 | Bacteria | 2102 |
| 357 | Ga0373955_0011044 | 3300035172 | Bacteria | 4289 |
| 358 | Ga0373962_0008728 | 3300035242 | Bacteria | 2500 |
| 359 | Ga0373931_0002459 | 3300035691 | Bacteria | 8205 |
| 360 | Ga0373931_0008442 | 3300035691 | Bacteria | 4886 |
| 361 | Ga0373931_0391223 | 3300035691 | Bacteria | 878 |
| 362 | Ga0373935_0045106 | 3300035692 | Bacteria | 2780 |
| 363 | Ga0373927_0064882 | 3300035695 | Bacteria | 2362 |
| 364 | Ga0373933_0000217 | 3300035724 | Bacteria | 37933 |
| 365 | Ga0373933_0281000 | 3300035724 | Bacteria | 1075 |
| 366 | Ga0373947_0014945 | 3300035725 | Bacteria | 4455 |
| 367 | Ga0373937_0000205 | 3300036401 | Bacteria | 57080 |
| 368 | Ga0373937_0011507 | 3300036401 | Bacteria | 7767 |
| 369 | Ga0373937_0040011 | 3300036401 | Bacteria | 4273 |
| 370 | Ga0373937_0102769 | 3300036401 | Bacteria | 2653 |
| 371 | Ga0373937_0215819 | 3300036401 | Bacteria | 1805 |
| 372 | Ga0373925_0022510 | 3300037068 | Bacteria | 4597 |
| 373 | Ga0373925_0053081 | 3300037068 | Bacteria | 3029 |
| 374 | Ga0395899_0001005 | 3300037312 | Bacteria | 25863 |
| 375 | Ga0395899_0022001 | 3300037312 | Bacteria | 4835 |
| 376 | Ga0395899_0043120 | 3300037312 | Bacteria | 3366 |
| 377 | Ga0395899_0304823 | 3300037312 | Bacteria | 1077 |
| 378 | Ga0395900_0006176 | 3300037418 | Bacteria | 12511 |
| 379 | Ga0395900_0010004 | 3300037418 | Bacteria | 9704 |
| 380 | Ga0395900_0122716 | 3300037418 | Bacteria | 2665 |
| 381 | Ga0395900_0233878 | 3300037418 | Bacteria | 1847 |
| 382 | Ga0395900_0312814 | 3300037418 | Bacteria | 1553 |
| 383 | Ga0395898_0007548 | 3300037466 | Bacteria | 11551 |
| 384 | Ga0395898_0039793 | 3300037466 | Bacteria | 4651 |
| 385 | Ga0395898_0043895 | 3300037466 | Bacteria | 4404 |
| 386 | Ga0395905_0000033 | 3300037471 | Bacteria | 279363 |
| 387 | Ga0395905_0003696 | 3300037471 | Bacteria | 16194 |
| 388 | Ga0395905_0004869 | 3300037471 | Bacteria | 13838 |
| 389 | Ga0395905_0009619 | 3300037471 | Bacteria | 9439 |
| 390 | Ga0395905_0011819 | 3300037471 | Bacteria | 8428 |
| 391 | Ga0395905_0029892 | 3300037471 | Bacteria | 5135 |
| 392 | Ga0395905_0107034 | 3300037471 | Bacteria | 2625 |
| 393 | Ga0395905_0136766 | 3300037471 | Bacteria | 2305 |
| 394 | Ga0395905_0276984 | 3300037471 | Bacteria | 1563 |
| 395 | Ga0395905_0282630 | 3300037471 | Bacteria | 1545 |
| 396 | Ga0395901_0007041 | 3300038443 | Bacteria | 11368 |
| 397 | Ga0395901_0052433 | 3300038443 | Bacteria | 4240 |
| 398 | Ga0395901_0063115 | 3300038443 | Bacteria | 3855 |
| 399 | Ga0395901_0074942 | 3300038443 | Bacteria | 3530 |
| 400 | Ga0395901_0089265 | 3300038443 | Bacteria | 3225 |
| 401 | Ga0395901_0422809 | 3300038443 | Bacteria | 1366 |
| 402 | Ga0395901_0666224 | 3300038443 | Bacteria | 1042 |
| 403 | Ga0395901_0751387 | 3300038443 | Bacteria | 968 |
| 404 | Ga0436361_0148311 | 3300039447 | Bacteria | 30874 |
| 405 | Ga0436361_0261085 | 3300039447 | Bacteria | 1637 |
| 406 | Ga0436361_0287447 | 3300039447 | Bacteria | 113524 |
| 407 | Ga0436361_0351372 | 3300039447 | Bacteria | 183069 |
| 408 | Ga0436361_0656823 | 3300039447 | Bacteria | 15445 |
| 409 | Ga0436361_1007413 | 3300039447 | Bacteria | 98457 |
| 410 | Ga0436361_1146112 | 3300039447 | Bacteria | 18201 |
| 411 | Ga0439436_0005686 | 3300041404 | Bacteria | 3821 |
| 412 | Ga0439436_0018183 | 3300041404 | Bacteria | 2101 |
| 413 | Ga0439439_0016744 | 3300041406 | Bacteria | 1797 |
| 414 | Ga0439439_0018549 | 3300041406 | Bacteria | 1720 |
| 415 | Ga0439461_0039080 | 3300041410 | Bacteria | 1019 |
| 416 | Ga0439466_0003623 | 3300041411 | Bacteria | 5967 |
| 417 | Ga0439466_0013250 | 3300041411 | Bacteria | 3020 |
| 418 | Ga0439465_0000190 | 3300041413 | Bacteria | 15993 |
| 419 | Ga0451807_1484103 | 3300041486 | Bacteria | 2321 |
| 420 | Ga0439431_0002480 | 3300041997 | Bacteria | 4086 |
| 421 | Ga0439433_0004698 | 3300041999 | Bacteria | 2935 |
| 422 | Ga0439442_003056 | 3300042002 | Bacteria | 3309 |
| 423 | Ga0439443_015061 | 3300042003 | Bacteria | 1170 |
| 424 | Ga0439445_0000419 | 3300042004 | Bacteria | 8533 |
| 425 | Ga0439445_0011266 | 3300042004 | Bacteria | 2130 |
| 426 | Ga0439432_005267 | 3300042006 | Bacteria | 4667 |
| 427 | Ga0439432_011515 | 3300042006 | Bacteria | 3048 |
| 428 | Ga0439432_024928 | 3300042006 | Bacteria | 1964 |
| 429 | Ga0439449_0000309 | 3300042007 | Bacteria | 17583 |
| 430 | Ga0439449_0001242 | 3300042007 | Bacteria | 9991 |
| 431 | Ga0439449_0013392 | 3300042007 | Bacteria | 3086 |
| 432 | Ga0439449_0030592 | 3300042007 | Bacteria | 2007 |
| 433 | Ga0439452_008042 | 3300042010 | Bacteria | 3192 |
| 434 | Ga0439452_011631 | 3300042010 | Bacteria | 2522 |
| 435 | Ga0439454_010767 | 3300042011 | Bacteria | 1211 |
| 436 | Ga0439457_002197 | 3300042014 | Bacteria | 5642 |
| 437 | Ga0439462_0001981 | 3300042015 | Bacteria | 4686 |
| 438 | Ga0439462_0007852 | 3300042015 | Bacteria | 2678 |
| 439 | Ga0439462_0036135 | 3300042015 | Bacteria | 1315 |
| 440 | Ga0439462_0060123 | 3300042015 | Bacteria | 1028 |
| 441 | Ga0439462_0100480 | 3300042015 | Bacteria | 797 |
| 442 | Ga0450911_001236 | 3300042115 | Bacteria | 6171 |
| 443 | Ga0450912_000333 | 3300042116 | Bacteria | 2195 |
| 444 | Ga0450917_001070 | 3300042120 | Bacteria | 2010 |
| 445 | Ga0450923_023196 | 3300042125 | Bacteria | 1222 |
| 446 | Ga0450888_000661 | 3300042126 | Bacteria | 3291 |
| 447 | Ga0450890_000366 | 3300042127 | Bacteria | 6606 |
| 448 | Ga0450890_001507 | 3300042127 | Bacteria | 3351 |
| 449 | Ga0450891_002200 | 3300042129 | Bacteria | 1975 |
| 450 | Ga0450891_005902 | 3300042129 | Bacteria | 1129 |
| 451 | Ga0450892_000411 | 3300042130 | Bacteria | 5076 |
| 452 | Ga0450894_006833 | 3300042131 | Bacteria | 1471 |
| 453 | Ga0450898_001687 | 3300042134 | Bacteria | 2965 |
| 454 | Ga0450898_002139 | 3300042134 | Bacteria | 2731 |
| 455 | Ga0450889_004348 | 3300042144 | Bacteria | 1400 |
| 456 | Ga0450907_012319 | 3300042146 | Bacteria | 1422 |
| 457 | Ga0439446_0014496 | 3300042156 | Bacteria | 2176 |
| 458 | Ga0439446_0017366 | 3300042156 | Bacteria | 2011 |
| 459 | Ga0439446_0048456 | 3300042156 | Bacteria | 1265 |
| 460 | Ga0439434_0009388 | 3300042435 | Bacteria | 2875 |
| 461 | Ga0439444_0022321 | 3300042437 | Bacteria | 1127 |
| 462 | Ga0439459_0016257 | 3300042438 | Bacteria | 1374 |
| 463 | Ga0450893_0000278 | 3300042532 | Bacteria | 6986 |
| 464 | Ga0450893_0002086 | 3300042532 | Bacteria | 3113 |
| 465 | Ga0450893_0008270 | 3300042532 | Bacteria | 1693 |
| 466 | Ga0450893_0032503 | 3300042532 | Bacteria | 934 |
| 467 | Ga0451577_0000804 | 3300042876 | Bacteria | 47207 |
| 468 | Ga0451577_0005101 | 3300042876 | Bacteria | 13537 |
| 469 | Ga0451577_0427264 | 3300042876 | Bacteria | 1203 |
| 470 | Ga0466969_0007616 | 3300044656 | Bacteria | 5756 |
| 471 | Ga0466977_0080483 | 3300044666 | Bacteria | 2144 |
| 472 | Ga0453683_0003001 | 3300044673 | Bacteria | 12644 |
| 473 | Ga0453683_0040675 | 3300044673 | Bacteria | 2918 |
| 474 | Ga0466965_0005539 | 3300044683 | Bacteria | 5694 |
| 475 | Ga0466966_0019549 | 3300044684 | Bacteria | 4456 |
| 476 | Ga0466961_0006490 | 3300044693 | Bacteria | 7432 |
| 477 | Ga0466961_0026365 | 3300044693 | Bacteria | 3736 |
| 478 | Ga0453684_0005076 | 3300044712 | Bacteria | 26598 |
| 479 | Ga0453684_0018360 | 3300044712 | Bacteria | 10740 |
| 480 | Ga0453684_0090343 | 3300044712 | Bacteria | 3784 |
| 481 | Ga0453684_0151298 | 3300044712 | Bacteria | 2757 |
| 482 | Ga0466971_0148433 | 3300044719 | Bacteria | 1094 |
| 483 | Ga0466957_0012321 | 3300044842 | Bacteria | 4950 |
| 484 | Ga0466960_0008084 | 3300044901 | Bacteria | 4298 |
| 485 | Ga0466959_0119767 | 3300045049 | Bacteria | 1872 |
| 486 | Ga0451576_0002054 | 3300045051 | Bacteria | 31662 |
| 487 | Ga0451576_0088950 | 3300045051 | Bacteria | 3212 |
| 488 | Ga0451576_0222642 | 3300045051 | Bacteria | 1970 |
| 489 | Ga0451576_0266409 | 3300045051 | Bacteria | 1791 |
| 490 | Ga0451576_0592110 | 3300045051 | Bacteria | 1165 |
| 491 | Ga0495592_0003264 | 3300046454 | Bacteria | 11625 |
| 492 | Ga0495592_0004682 | 3300046454 | Bacteria | 10028 |
| 493 | Ga0495592_0043081 | 3300046454 | Bacteria | 3378 |
| 494 | Ga0495603_0065011 | 3300046455 | Bacteria | 2150 |
| 495 | Ga0495590_0000035 | 3300046457 | Bacteria | 129481 |
| 496 | Ga0495590_0004799 | 3300046457 | Bacteria | 5418 |
| 497 | Ga0495638_0000023 | 3300046460 | Bacteria | 363063 |
| 498 | Ga0495638_0005781 | 3300046460 | Bacteria | 9109 |
| 499 | Ga0495641_0030263 | 3300046461 | Bacteria | 2599 |
| 500 | Ga0495651_0004810 | 3300046462 | Bacteria | 10338 |
| 501 | Ga0495651_0006269 | 3300046462 | Bacteria | 9097 |
| 502 | Ga0495651_0113774 | 3300046462 | Bacteria | 1997 |
| 503 | Ga0495651_0154285 | 3300046462 | Bacteria | 1652 |
| 504 | Ga0495650_0013618 | 3300046471 | Bacteria | 4289 |
| 505 | Ga0495580_0077939 | 3300046472 | Bacteria | 2311 |
| 506 | Ga0495605_0019545 | 3300046474 | Bacteria | 3615 |
| 507 | Ga0495639_0003685 | 3300046475 | Bacteria | 6596 |
| 508 | Ga0495639_0007335 | 3300046475 | Bacteria | 4732 |
| 509 | Ga0495639_0026028 | 3300046475 | Bacteria | 2583 |
| 510 | Ga0495662_0057802 | 3300046476 | Bacteria | 1873 |
| 511 | Ga0495662_0066898 | 3300046476 | Bacteria | 1738 |
| 512 | Ga0495584_0005884 | 3300046491 | Bacteria | 6463 |
| 513 | Ga0495584_0046290 | 3300046491 | Bacteria | 2194 |
| 514 | Ga0495585_0046182 | 3300046492 | Bacteria | 2429 |
| 515 | Ga0495607_0001625 | 3300046501 | Bacteria | 19476 |
| 516 | Ga0495607_0038555 | 3300046501 | Bacteria | 2861 |
| 517 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 518 | Ga0495583_0000257 | 3300046506 | Bacteria | 87964 |
| 519 | Ga0495583_0001806 | 3300046506 | Bacteria | 20194 |
| 520 | Ga0495606_0001324 | 3300046507 | Bacteria | 33820 |
| 521 | Ga0495606_0002149 | 3300046507 | Bacteria | 23757 |
| 522 | Ga0495608_0011002 | 3300046511 | Bacteria | 6306 |
| 523 | Ga0495608_0026023 | 3300046511 | Bacteria | 3992 |
| 524 | Ga0495610_0000430 | 3300046512 | Bacteria | 43081 |
| 525 | Ga0495616_0002745 | 3300046513 | Bacteria | 11527 |
| 526 | Ga0495616_0004849 | 3300046513 | Bacteria | 8424 |
| 527 | Ga0495616_0023343 | 3300046513 | Bacteria | 3328 |
| 528 | Ga0495618_0038839 | 3300046514 | Bacteria | 2992 |
| 529 | Ga0495618_0042318 | 3300046514 | Bacteria | 2871 |
| 530 | Ga0495628_0004940 | 3300046516 | Bacteria | 11726 |
| 531 | Ga0495628_0005051 | 3300046516 | Bacteria | 11598 |
| 532 | Ga0495628_0013204 | 3300046516 | Bacteria | 6945 |
| 533 | Ga0495628_0051387 | 3300046516 | Bacteria | 3259 |
| 534 | Ga0495630_0018101 | 3300046517 | Bacteria | 5171 |
| 535 | Ga0495630_0101432 | 3300046517 | Bacteria | 2177 |
| 536 | Ga0495632_0020100 | 3300046519 | Bacteria | 3624 |
| 537 | Ga0495643_0001307 | 3300046522 | Bacteria | 23666 |
| 538 | Ga0495644_0000870 | 3300046523 | Bacteria | 12493 |
| 539 | Ga0495644_0000884 | 3300046523 | Bacteria | 12417 |
| 540 | Ga0495648_0000025 | 3300046524 | Bacteria | 233415 |
| 541 | Ga0495648_0019950 | 3300046524 | Bacteria | 4691 |
| 542 | Ga0495648_0042317 | 3300046524 | Bacteria | 2867 |
| 543 | Ga0495663_0032179 | 3300046525 | Bacteria | 1561 |
| 544 | Ga0495666_0007394 | 3300046526 | Bacteria | 5504 |
| 545 | Ga0495642_0003530 | 3300046528 | Bacteria | 6163 |
| 546 | Ga0495642_0054242 | 3300046528 | Bacteria | 1653 |
| 547 | Ga0495652_0035079 | 3300046529 | Bacteria | 4367 |
| 548 | Ga0495652_0042675 | 3300046529 | Bacteria | 3910 |
| 549 | Ga0495652_0085482 | 3300046529 | Bacteria | 2592 |
| 550 | Ga0495652_0196884 | 3300046529 | Bacteria | 1533 |
| 551 | Ga0495654_0014865 | 3300046530 | Bacteria | 4136 |
| 552 | Ga0495665_0177201 | 3300046531 | Bacteria | 1108 |
| 553 | Ga0495640_0005312 | 3300046533 | Bacteria | 10234 |
| 554 | Ga0495640_0011753 | 3300046533 | Bacteria | 6719 |
| 555 | Ga0495640_0151970 | 3300046533 | Bacteria | 1487 |
| 556 | Ga0495586_0005086 | 3300046535 | Bacteria | 7039 |
| 557 | Ga0495598_0007405 | 3300046537 | Bacteria | 2518 |
| 558 | Ga0495609_0000598 | 3300046538 | Bacteria | 28270 |
| 559 | Ga0495621_0007614 | 3300046539 | Bacteria | 3213 |
| 560 | Ga0495597_0000361 | 3300046542 | Bacteria | 40182 |
| 561 | Ga0495597_0001192 | 3300046542 | Bacteria | 19460 |
| 562 | Ga0495597_0146436 | 3300046542 | Bacteria | 971 |
| 563 | Ga0495645_0000371 | 3300046543 | Bacteria | 31266 |
| 564 | Ga0495622_0000063 | 3300046557 | Bacteria | 95713 |
| 565 | Ga0495622_0028525 | 3300046557 | Bacteria | 2607 |
| 566 | Ga0495622_0038510 | 3300046557 | Bacteria | 2226 |
| 567 | Ga0495622_0081763 | 3300046557 | Bacteria | 1486 |
| 568 | Ga0495633_0001247 | 3300046558 | Bacteria | 20309 |
| 569 | Ga0495633_0001345 | 3300046558 | Bacteria | 19254 |
| 570 | Ga0495633_0001396 | 3300046558 | Bacteria | 18832 |
| 571 | Ga0495633_0013127 | 3300046558 | Bacteria | 4378 |
| 572 | Ga0495633_0014941 | 3300046558 | Bacteria | 4036 |
| 573 | Ga0495667_0015056 | 3300046559 | Bacteria | 5221 |
| 574 | Ga0495667_0103187 | 3300046559 | Bacteria | 1844 |
| 575 | Ga0495656_0001853 | 3300046615 | Bacteria | 6965 |
| 576 | Ga0495656_0004696 | 3300046615 | Bacteria | 4693 |
| 577 | Ga0495656_0006569 | 3300046615 | Bacteria | 4086 |
| 578 | Ga0495656_0087875 | 3300046615 | Bacteria | 1416 |
| 579 | Ga0495668_0000049 | 3300046616 | Bacteria | 217657 |
| 580 | Ga0495668_0002152 | 3300046616 | Bacteria | 16914 |
| 581 | Ga0495634_0025729 | 3300046642 | Bacteria | 4110 |
| 582 | Ga0495611_0011224 | 3300046648 | Bacteria | 3797 |
| 583 | Ga0495625_0000123 | 3300046660 | Bacteria | 120958 |
| 584 | Ga0495625_0004092 | 3300046660 | Bacteria | 13926 |
| 585 | Ga0495625_0010574 | 3300046660 | Bacteria | 7620 |
| 586 | Ga0495635_0004893 | 3300046663 | Bacteria | 9323 |
| 587 | Ga0495635_0027192 | 3300046663 | Bacteria | 3980 |
| 588 | Ga0495661_0215461 | 3300046665 | Bacteria | 997 |
| 589 | Ga0495588_0071422 | 3300046674 | Bacteria | 1805 |
| 590 | Ga0495657_0057559 | 3300046675 | Bacteria | 2584 |
| 591 | Ga0495657_0075462 | 3300046675 | Bacteria | 2192 |
| 592 | Ga0495599_0003472 | 3300046678 | Bacteria | 9227 |
| 593 | Ga0495599_0022294 | 3300046678 | Bacteria | 3953 |
| 594 | Ga0495647_0003126 | 3300046681 | Bacteria | 5295 |
| 595 | Ga0495658_0010064 | 3300046683 | Bacteria | 4723 |
| 596 | Ga0495658_0021639 | 3300046683 | Bacteria | 3392 |
| 597 | Ga0495658_0206473 | 3300046683 | Bacteria | 1226 |
| 598 | Ga0495613_0053854 | 3300046689 | Bacteria | 2959 |
| 599 | Ga0495624_0110685 | 3300046690 | Bacteria | 1689 |
| 600 | Ga0495670_0034111 | 3300046691 | Bacteria | 2534 |
| 601 | Ga0495670_0048446 | 3300046691 | Bacteria | 2126 |
| 602 | Ga0495671_0009268 | 3300046692 | Bacteria | 5502 |
| 603 | Ga0495671_0015519 | 3300046692 | Bacteria | 4080 |
| 604 | Ga0495600_0000613 | 3300046809 | Bacteria | 18436 |
| 605 | Ga0495600_0063564 | 3300046809 | Bacteria | 2412 |
| 606 | Ga0495600_0351015 | 3300046809 | Bacteria | 924 |
| 607 | Ga0495604_0005868 | 3300047317 | Bacteria | 9737 |
| 608 | Ga0495604_0020921 | 3300047317 | Bacteria | 5221 |
| 609 | Ga0495604_0043060 | 3300047317 | Bacteria | 3536 |
| 610 | Ga0495636_0000628 | 3300047318 | Bacteria | 12926 |
| 611 | Ga0495636_0005854 | 3300047318 | Bacteria | 4823 |
| 612 | Ga0495636_0043143 | 3300047318 | Bacteria | 1876 |
| 613 | Ga0495636_0103100 | 3300047318 | Bacteria | 1249 |
| 614 | Ga0495674_0007872 | 3300047319 | Bacteria | 10177 |
| 615 | Ga0495672_0045832 | 3300047320 | Bacteria | 2613 |
| 616 | Ga0495680_0001187 | 3300047322 | Bacteria | 28585 |
| 617 | Ga0495680_0008833 | 3300047322 | Bacteria | 9118 |
| 618 | Ga0495683_0005503 | 3300047323 | Bacteria | 7020 |
| 619 | Ga0495687_000621 | 3300047443 | Bacteria | 41089 |
| 620 | Ga0495685_000005 | 3300047447 | Bacteria | 112142 |
| 621 | Ga0495685_010046 | 3300047447 | Bacteria | 3170 |
| 622 | Ga0495673_0019557 | 3300047469 | Bacteria | 3390 |
| 623 | Ga0495684_0059651 | 3300047471 | Bacteria | 2905 |
| 624 | Ga0496100_0189770 | 3300048903 | Bacteria | 1491 |
| 625 | Ga0496101_0020434 | 3300048904 | Bacteria | 4533 |
| 626 | Ga0496102_0000425 | 3300048905 | Bacteria | 48803 |
| 627 | Ga0496102_0002618 | 3300048905 | Bacteria | 15298 |
| 628 | Ga0496103_0002424 | 3300048906 | Bacteria | 11733 |
| 629 | Ga0496104_0077219 | 3300048907 | Bacteria | 3173 |
| 630 | Ga0496105_0030209 | 3300048908 | Bacteria | 4440 |
| 631 | Ga0496105_0190863 | 3300048908 | Bacteria | 1675 |
| 632 | Ga0496106_0274792 | 3300048909 | Bacteria | 1349 |
| 633 | Ga0496108_0025470 | 3300048911 | Bacteria | 4876 |
| 634 | Ga0496108_0242916 | 3300048911 | Bacteria | 1566 |
| 635 | Ga0496109_0279544 | 3300048912 | Bacteria | 1573 |
| 636 | Ga0496112_0020391 | 3300048915 | Bacteria | 6283 |
| 637 | Ga0496112_0401830 | 3300048915 | Bacteria | 1310 |
| 638 | Ga0496113_0025739 | 3300048916 | Bacteria | 4199 |
| 639 | Ga0496113_0111509 | 3300048916 | Bacteria | 2130 |
| 640 | Ga0496114_0206885 | 3300048917 | Bacteria | 1720 |
| 641 | Ga0496116_0011775 | 3300048919 | Bacteria | 7202 |
| 642 | Ga0496116_0022753 | 3300048919 | Bacteria | 4687 |
| 643 | Ga0496117_0014121 | 3300048920 | Bacteria | 6905 |
| 644 | Ga0496121_0178025 | 3300048924 | Bacteria | 1538 |
| 645 | Ga0496122_0115029 | 3300048925 | Bacteria | 1754 |
| 646 | Ga0496124_0013398 | 3300048927 | Bacteria | 8004 |
| 647 | Ga0496125_0110007 | 3300048928 | Bacteria | 1999 |
| 648 | Ga0496125_0276206 | 3300048928 | Bacteria | 1044 |
| 649 | Ga0496126_0141855 | 3300048929 | Bacteria | 2067 |
| 650 | Ga0496126_0304010 | 3300048929 | Bacteria | 1315 |
| 651 | Ga0495678_000839 | 3300049459 | Bacteria | 27444 |
| 652 | Ga0495678_010318 | 3300049459 | Bacteria | 4548 |
| 653 | Ga0495682_0008320 | 3300049460 | Bacteria | 4091 |
| 654 | Ga0501299_030210 | 3300049522 | Unclassified | 1042 |
| 655 | Ga0501031_0001227 | 3300049568 | Bacteria | 15705 |
| 656 | Ga0501032_0274135 | 3300049569 | Bacteria | 1093 |
| 657 | Ga0501034_0035730 | 3300049571 | Bacteria | 5037 |
| 658 | Ga0501036_0132543 | 3300049572 | Bacteria | 2103 |
| 659 | Ga0501036_0256120 | 3300049572 | Bacteria | 1466 |
| 660 | Ga0501037_0015776 | 3300049573 | Bacteria | 5559 |
| 661 | Ga0501037_0128649 | 3300049573 | Bacteria | 1817 |
| 662 | Ga0501037_0165878 | 3300049573 | Bacteria | 1573 |
| 663 | Ga0501038_0050608 | 3300049574 | Bacteria | 3589 |
| 664 | Ga0501039_0095417 | 3300049575 | Bacteria | 2319 |
| 665 | Ga0501040_0163007 | 3300049576 | Bacteria | 1576 |
| 666 | Ga0501042_0101307 | 3300049578 | Bacteria | 2071 |
| 667 | Ga0501047_0476411 | 3300049581 | Bacteria | 1076 |
| 668 | Ga0501048_0057851 | 3300049582 | Bacteria | 2749 |
| 669 | Ga0501068_0046749 | 3300049584 | Bacteria | 2610 |
| 670 | Ga0501075_0067126 | 3300049591 | Bacteria | 2708 |
| 671 | Ga0501076_0131964 | 3300049592 | Bacteria | 2026 |
| 672 | Ga0501202_001322 | 3300049652 | Bacteria | 3938 |
| 673 | Ga0501222_000006 | 3300049662 | Bacteria | 129030 |
| 674 | Ga0501223_001770 | 3300049663 | Bacteria | 4898 |
| 675 | Ga0501235_019614 | 3300049669 | Bacteria | 1500 |
| 676 | Ga0501249_016997 | 3300049679 | Bacteria | 1565 |
| 677 | Ga0501221_002212 | 3300049704 | Bacteria | 3231 |
| 678 | Ga0501225_0047697 | 3300049705 | Bacteria | 1189 |
| 679 | Ga0501229_000401 | 3300049706 | Bacteria | 4845 |
| 680 | Ga0501080_0059758 | 3300049742 | Bacteria | 3547 |
| 681 | Ga0501080_0167824 | 3300049742 | Bacteria | 2025 |
| 682 | Ga0501232_002702 | 3300049757 | Bacteria | 1563 |
| 683 | Ga0501266_000779 | 3300049763 | Bacteria | 4121 |
| 684 | Ga0501280_000798 | 3300049776 | Bacteria | 6838 |
| 685 | Ga0501282_000988 | 3300049778 | Bacteria | 3222 |
| 686 | Ga0501044_0129700 | 3300049823 | Bacteria | 2516 |
| 687 | Ga0501044_0510063 | 3300049823 | Bacteria | 1103 |
| 688 | Ga0501045_0332631 | 3300049824 | Bacteria | 1130 |
| 689 | nmdc:mga03683_1093_c2 | 3300050489 | Bacteria | 3796 |
| 690 | nmdc:mga03n38_37354_c1 | 3300050490 | Bacteria | 2094 |
| 691 | nmdc:mga00v17_145916_c1 | 3300050491 | Bacteria | 1519 |
| 692 | nmdc:mga00v17_17446_c1 | 3300050491 | Bacteria | 4065 |
| 693 | nmdc:mga0yw44_109692_c1 | 3300050492 | Bacteria | 1767 |
| 694 | nmdc:mga0yw44_163541_c1 | 3300050492 | Bacteria | 1458 |
| 695 | nmdc:mga0k408_107619_c1 | 3300050493 | Bacteria | 1647 |
| 696 | nmdc:mga0k408_112728_c1 | 3300050493 | Bacteria | 1608 |
| 697 | nmdc:mga0k408_17094_c1 | 3300050493 | Bacteria | 4035 |
| 698 | nmdc:mga0k408_33798_c1 | 3300050493 | Bacteria | 2926 |
| 699 | nmdc:mga04h51_16263_c1 | 3300050495 | Bacteria | 2157 |
| 700 | nmdc:mga07m45_28235_c1 | 3300050496 | Bacteria | 3097 |
| 701 | nmdc:mga07m45_32777_c1 | 3300050496 | Bacteria | 2882 |
| 702 | nmdc:mga07m45_96351_c1 | 3300050496 | Bacteria | 1698 |
| 703 | nmdc:mga07m45_9970_c1 | 3300050496 | Bacteria | 4362 |
| 704 | nmdc:mga05p37_443316_c1 | 3300050507 | Bacteria | 1505 |
| 705 | nmdc:mga09592_38831_c1 | 3300050508 | Bacteria | 3997 |
| 706 | nmdc:mga06r32_138706_c1 | 3300050510 | Bacteria | 2407 |
| 707 | nmdc:mga08y16_101582_c1 | 3300050511 | Bacteria | 2994 |
| 708 | nmdc:mga08y16_280593_c1 | 3300050511 | Bacteria | 1718 |
| 709 | nmdc:mga08y16_8227_c1 | 3300050511 | Bacteria | 10909 |
| 710 | nmdc:mga0n895_51608_c1 | 3300050512 | Bacteria | 4035 |
| 711 | nmdc:mga0n895_960_c1 | 3300050512 | Bacteria | 20894 |
| 712 | nmdc:mga0a205_10918_c1 | 3300050515 | Bacteria | 8355 |
| 713 | Ga0495601_0000765 | 3300053077 | Bacteria | 17303 |
| 714 | Ga0495601_0022680 | 3300053077 | Bacteria | 3857 |
| 715 | Ga0495601_0061445 | 3300053077 | Bacteria | 2385 |
| 716 | Ga0495601_0194841 | 3300053077 | Bacteria | 1324 |
| 717 | Ga0495595_0002524 | 3300053084 | Bacteria | 7183 |
| 718 | Ga0495619_0021555 | 3300053085 | Bacteria | 4115 |
| 719 | Ga0495619_0096169 | 3300053085 | Bacteria | 2010 |
| 720 | Ga0500644_0008575 | 3300053088 | Bacteria | 2701 |
| 721 | Ga0500651_0002431 | 3300053093 | Bacteria | 9837 |
| 722 | Ga0500566_0066833 | 3300053094 | Bacteria | 2025 |
| 723 | Ga0500593_006312 | 3300053117 | Bacteria | 4737 |
| 724 | Ga0500608_016431 | 3300053122 | Bacteria | 3343 |
| 725 | Ga0500628_001055 | 3300053129 | Bacteria | 4812 |
| 726 | Ga0500559_0046548 | 3300053136 | Bacteria | 1903 |
| 727 | Ga0500568_0136398 | 3300053139 | Bacteria | 911 |
| 728 | Ga0500622_0001521 | 3300053156 | Bacteria | 18383 |
| 729 | Ga0500634_0139579 | 3300053161 | Bacteria | 1150 |
| 730 | Ga0500645_000805 | 3300053730 | Bacteria | 18797 |
| 731 | Ga0500587_000565 | 3300053739 | Bacteria | 4580 |
| 732 | Ga0501084_0049144 | 3300054114 | Bacteria | 3531 |
| 733 | Ga0501084_0081221 | 3300054114 | Bacteria | 2719 |
| 734 | Ga0500661_001001 | 3300055283 | Bacteria | 5309 |
| 735 | Ga0590071_000940 | 3300059421 | Bacteria | 8068 |
| 736 | Ga0501082_0636526 | 3300060353 | Bacteria | 933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042156 | Ga0439446_0048456 | Ga0439446_0048456_17_697 | 222 |
| 2 | 3300035086 | Ga0373934_0009596 | Ga0373934_0009596_938_1636 | 225 |
| 3 | 3300035111 | Ga0373923_0052788 | Ga0373923_0052788_709_1407 | 225 |
| 4 | 3300035111 | Ga0373923_0056415 | Ga0373923_0056415_744_1442 | 225 |
| 5 | 3300035113 | Ga0373936_0068977 | Ga0373936_0068977_469_1167 | 225 |
| 6 | 3300035117 | Ga0373953_0077125 | Ga0373953_0077125_53_751 | 225 |
| 7 | 3300035119 | Ga0373956_0007077 | Ga0373956_0007077_363_1061 | 225 |
| 8 | 3300035120 | Ga0373957_0002256 | Ga0373957_0002256_716_1414 | 225 |
| 9 | 3300035695 | Ga0373927_0064882 | Ga0373927_0064882_708_1406 | 225 |
| 10 | 3300035724 | Ga0373933_0281000 | Ga0373933_0281000_36_734 | 225 |
| 11 | 3300036401 | Ga0373937_0102769 | Ga0373937_0102769_1279_1977 | 225 |
| 12 | 3300036401 | Ga0373937_0215819 | Ga0373937_0215819_468_1166 | 225 |
| 13 | 3300037068 | Ga0373925_0053081 | Ga0373925_0053081_1096_1794 | 225 |
| 14 | 3300046462 | Ga0495651_0004810 | Ga0495651_0004810_8015_8713 | 225 |
| 15 | 3300046472 | Ga0495580_0077939 | Ga0495580_0077939_1029_1727 | 225 |
| 16 | 3300046475 | Ga0495639_0003685 | Ga0495639_0003685_4871_5569 | 225 |
| 17 | 3300046476 | Ga0495662_0057802 | Ga0495662_0057802_1085_1783 | 225 |
| 18 | 3300046511 | Ga0495608_0026023 | Ga0495608_0026023_264_962 | 225 |
| 19 | 3300046514 | Ga0495618_0038839 | Ga0495618_0038839_1981_2679 | 225 |
| 20 | 3300046516 | Ga0495628_0051387 | Ga0495628_0051387_1684_2382 | 225 |
| 21 | 3300046526 | Ga0495666_0007394 | Ga0495666_0007394_1604_2302 | 225 |
| 22 | 3300046529 | Ga0495652_0042675 | Ga0495652_0042675_597_1295 | 225 |
| 23 | 3300046531 | Ga0495665_0177201 | Ga0495665_0177201_354_1052 | 225 |
| 24 | 3300046533 | Ga0495640_0005312 | Ga0495640_0005312_1029_1727 | 225 |
| 25 | 3300046559 | Ga0495667_0103187 | Ga0495667_0103187_438_1136 | 225 |
| 26 | 3300046663 | Ga0495635_0004893 | Ga0495635_0004893_7278_7976 | 225 |
| 27 | 3300046675 | Ga0495657_0075462 | Ga0495657_0075462_202_900 | 225 |
| 28 | 3300046681 | Ga0495647_0003126 | Ga0495647_0003126_549_1247 | 225 |
| 29 | 3300046683 | Ga0495658_0010064 | Ga0495658_0010064_317_1015 | 225 |
| 30 | 3300046809 | Ga0495600_0000613 | Ga0495600_0000613_1553_2251 | 225 |
| 31 | 3300047317 | Ga0495604_0020921 | Ga0495604_0020921_2962_3660 | 225 |
| 32 | 3300047319 | Ga0495674_0007872 | Ga0495674_0007872_5055_5753 | 225 |
| 33 | 3300047322 | Ga0495680_0008833 | Ga0495680_0008833_5181_5879 | 225 |
| 34 | 3300047471 | Ga0495684_0059651 | Ga0495684_0059651_1362_2060 | 225 |
| 35 | 3300053077 | Ga0495601_0194841 | Ga0495601_0194841_264_962 | 225 |
| 36 | 3300053084 | Ga0495595_0002524 | Ga0495595_0002524_1411_2109 | 225 |
| 37 | 3300053085 | Ga0495619_0096169 | Ga0495619_0096169_467_1165 | 225 |
| 38 | 3300042015 | Ga0439462_0100480 | Ga0439462_0100480_10_711 | 229 |
| 39 | 3300035089 | Ga0373944_0063361 | Ga0373944_0063361_432_1142 | 233 |
| 40 | 3300006177 | Ga0075362_10146250 | Ga0075362_101462503 | 245 |
| 41 | 3300046454 | Ga0495592_0043081 | Ga0495592_0043081_1314_2108 | 257 |
| 42 | 3300046462 | Ga0495651_0113774 | Ga0495651_0113774_138_932 | 257 |
| 43 | 3300046516 | Ga0495628_0004940 | Ga0495628_0004940_6581_7375 | 257 |
| 44 | 3300046529 | Ga0495652_0035079 | Ga0495652_0035079_2430_3224 | 257 |
| 45 | 3300046678 | Ga0495599_0022294 | Ga0495599_0022294_1117_1911 | 257 |
| 46 | 3300053077 | Ga0495601_0000765 | Ga0495601_0000765_12433_13227 | 257 |
| 47 | 3300035691 | Ga0373931_0002459 | Ga0373931_0002459_3503_4324 | 261 |
| 48 | 3300005842 | Ga0068858_100145889 | Ga0068858_1001458891 | 262 |
| 49 | 3300014968 | Ga0157379_10030130 | Ga0157379_100301302 | 262 |
| 50 | 3300037471 | Ga0395905_0276984 | Ga0395905_0276984_267_1097 | 264 |
| 51 | 3300046455 | Ga0495603_0065011 | Ga0495603_0065011_305_1120 | 264 |
| 52 | 3300003323 | rootH1_10094518 | rootH1_100945182 | 265 |
| 53 | 3300049572 | Ga0501036_0132543 | Ga0501036_0132543_975_1781 | 265 |
| 54 | 3300049575 | Ga0501039_0095417 | Ga0501039_0095417_876_1682 | 265 |
| 55 | 3300049576 | Ga0501040_0163007 | Ga0501040_0163007_629_1435 | 265 |
| 56 | 3300049578 | Ga0501042_0101307 | Ga0501042_0101307_179_985 | 265 |
| 57 | 3300054114 | Ga0501084_0049144 | Ga0501084_0049144_178_984 | 265 |
| 58 | 3300060353 | Ga0501082_0636526 | Ga0501082_0636526_47_853 | 265 |
| 59 | 3300005340 | Ga0070689_100061503 | Ga0070689_1000615033 | 266 |
| 60 | 3300005458 | Ga0070681_10550144 | Ga0070681_105501441 | 266 |
| 61 | 3300005546 | Ga0070696_100016131 | Ga0070696_1000161312 | 266 |
| 62 | 3300005719 | Ga0068861_100390626 | Ga0068861_1003906261 | 266 |
| 63 | 3300005841 | Ga0068863_100160280 | Ga0068863_1001602802 | 266 |
| 64 | 3300005843 | Ga0068860_100190066 | Ga0068860_1001900662 | 266 |
| 65 | 3300006847 | Ga0075431_100078600 | Ga0075431_1000786003 | 266 |
| 66 | 3300006852 | Ga0075433_10001375 | Ga0075433_1000137515 | 266 |
| 67 | 3300006871 | Ga0075434_100000064 | Ga0075434_10000006442 | 266 |
| 68 | 3300006880 | Ga0075429_100073753 | Ga0075429_1000737532 | 266 |
| 69 | 3300006914 | Ga0075436_100001875 | Ga0075436_1000018755 | 266 |
| 70 | 3300007076 | Ga0075435_100001865 | Ga0075435_10000186515 | 266 |
| 71 | 3300009094 | Ga0111539_10108906 | Ga0111539_101089062 | 266 |
| 72 | 3300009147 | Ga0114129_10047107 | Ga0114129_100471075 | 266 |
| 73 | 3300025936 | Ga0207670_10109996 | Ga0207670_101099963 | 266 |
| 74 | 3300026078 | Ga0207702_10168555 | Ga0207702_101685553 | 266 |
| 75 | 3300026088 | Ga0207641_10151766 | Ga0207641_101517663 | 266 |
| 76 | 3300026095 | Ga0207676_10026632 | Ga0207676_100266325 | 266 |
| 77 | 3300026118 | Ga0207675_100529971 | Ga0207675_1005299712 | 266 |
| 78 | 3300028380 | Ga0268265_10659008 | Ga0268265_106590081 | 266 |
| 79 | 3300028381 | Ga0268264_10169873 | Ga0268264_101698732 | 266 |
| 80 | 3300031548 | Ga0307408_100508273 | Ga0307408_1005082732 | 266 |
| 81 | 3300035170 | Ga0373943_0006998 | Ga0373943_0006998_2790_3602 | 266 |
| 82 | 3300035171 | Ga0373946_0032277 | Ga0373946_0032277_903_1715 | 266 |
| 83 | 3300035692 | Ga0373935_0045106 | Ga0373935_0045106_1592_2404 | 266 |
| 84 | 3300035725 | Ga0373947_0014945 | Ga0373947_0014945_2998_3810 | 266 |
| 85 | 3300036401 | Ga0373937_0011507 | Ga0373937_0011507_1064_1876 | 266 |
| 86 | 3300037068 | Ga0373925_0022510 | Ga0373925_0022510_730_1542 | 266 |
| 87 | 3300049522 | Ga0501299_030210 | Ga0501299_030210_169_978 | 266 |
| 88 | 3300050507 | nmdc:mga05p37_443316_c1 | nmdc:mga05p37_443316_c1_433_1239 | 266 |
| 89 | 3300050510 | nmdc:mga06r32_138706_c1 | nmdc:mga06r32_138706_c1_1070_1876 | 266 |
| 90 | 3300050511 | nmdc:mga08y16_101582_c1 | nmdc:mga08y16_101582_c1_1953_2762 | 266 |
| 91 | 3300050512 | nmdc:mga0n895_960_c1 | nmdc:mga0n895_960_c1_6399_7208 | 266 |
| 92 | 3300050515 | nmdc:mga0a205_10918_c1 | nmdc:mga0a205_10918_c1_7184_7993 | 266 |
| 93 | 3300005341 | Ga0070691_10199715 | Ga0070691_101997152 | 267 |
| 94 | 3300005343 | Ga0070687_100316115 | Ga0070687_1003161152 | 267 |
| 95 | 3300026089 | Ga0207648_10784171 | Ga0207648_107841711 | 267 |
| 96 | 3300049572 | Ga0501036_0256120 | Ga0501036_0256120_14_826 | 267 |
| 97 | 3300049573 | Ga0501037_0128649 | Ga0501037_0128649_401_1213 | 267 |
| 98 | 3300049582 | Ga0501048_0057851 | Ga0501048_0057851_59_871 | 267 |
| 99 | 3300049584 | Ga0501068_0046749 | Ga0501068_0046749_1313_2125 | 267 |
| 100 | 3300049591 | Ga0501075_0067126 | Ga0501075_0067126_1166_1978 | 267 |
| 101 | 3300049592 | Ga0501076_0131964 | Ga0501076_0131964_257_1069 | 267 |
| 102 | 3300049742 | Ga0501080_0059758 | Ga0501080_0059758_112_924 | 267 |
| 103 | 3300049824 | Ga0501045_0332631 | Ga0501045_0332631_141_953 | 267 |
| 104 | 3300054114 | Ga0501084_0081221 | Ga0501084_0081221_1790_2602 | 267 |
| 105 | iso_pu_bacteria | 2643221645 | 2644249665 | 267 |
| 106 | iso_pu_bacteria | 2643221664 | 2644356231 | 267 |
| 107 | 3300005343 | Ga0070687_100213944 | Ga0070687_1002139442 | 268 |
| 108 | 3300005444 | Ga0070694_100079143 | Ga0070694_1000791432 | 268 |
| 109 | 3300005536 | Ga0070697_100184512 | Ga0070697_1001845122 | 268 |
| 110 | 3300005615 | Ga0070702_100129681 | Ga0070702_1001296812 | 268 |
| 111 | 3300009094 | Ga0111539_10007990 | Ga0111539_100079905 | 268 |
| 112 | 3300025936 | Ga0207670_10143830 | Ga0207670_101438301 | 268 |
| 113 | 3300027907 | Ga0207428_10014008 | Ga0207428_100140083 | 268 |
| 114 | 3300031548 | Ga0307408_100013147 | Ga0307408_1000131475 | 268 |
| 115 | 3300031731 | Ga0307405_10179141 | Ga0307405_101791412 | 268 |
| 116 | 3300032002 | Ga0307416_100007980 | Ga0307416_1000079805 | 268 |
| 117 | 3300032126 | Ga0307415_100101370 | Ga0307415_1001013702 | 268 |
| 118 | 3300036401 | Ga0373937_0040011 | Ga0373937_0040011_766_1581 | 268 |
| 119 | 3300042876 | Ga0451577_0427264 | Ga0451577_0427264_140_961 | 268 |
| 120 | 3300046454 | Ga0495592_0004682 | Ga0495592_0004682_7395_8210 | 268 |
| 121 | 3300046461 | Ga0495641_0030263 | Ga0495641_0030263_516_1331 | 268 |
| 122 | 3300046476 | Ga0495662_0066898 | Ga0495662_0066898_870_1685 | 268 |
| 123 | 3300046511 | Ga0495608_0011002 | Ga0495608_0011002_3066_3881 | 268 |
| 124 | 3300046514 | Ga0495618_0042318 | Ga0495618_0042318_1950_2765 | 268 |
| 125 | 3300046516 | Ga0495628_0005051 | Ga0495628_0005051_9079_9894 | 268 |
| 126 | 3300046517 | Ga0495630_0018101 | Ga0495630_0018101_1416_2231 | 268 |
| 127 | 3300046517 | Ga0495630_0101432 | Ga0495630_0101432_865_1680 | 268 |
| 128 | 3300046529 | Ga0495652_0085482 | Ga0495652_0085482_628_1443 | 268 |
| 129 | 3300046533 | Ga0495640_0011753 | Ga0495640_0011753_2235_3050 | 268 |
| 130 | 3300046533 | Ga0495640_0151970 | Ga0495640_0151970_462_1277 | 268 |
| 131 | 3300046535 | Ga0495586_0005086 | Ga0495586_0005086_3033_3848 | 268 |
| 132 | 3300046559 | Ga0495667_0015056 | Ga0495667_0015056_3898_4713 | 268 |
| 133 | 3300046642 | Ga0495634_0025729 | Ga0495634_0025729_2428_3243 | 268 |
| 134 | 3300046663 | Ga0495635_0027192 | Ga0495635_0027192_746_1561 | 268 |
| 135 | 3300046683 | Ga0495658_0021639 | Ga0495658_0021639_35_850 | 268 |
| 136 | 3300046689 | Ga0495613_0053854 | Ga0495613_0053854_433_1248 | 268 |
| 137 | 3300046690 | Ga0495624_0110685 | Ga0495624_0110685_556_1371 | 268 |
| 138 | 3300046809 | Ga0495600_0063564 | Ga0495600_0063564_76_891 | 268 |
| 139 | 3300046809 | Ga0495600_0351015 | Ga0495600_0351015_27_842 | 268 |
| 140 | 3300047317 | Ga0495604_0005868 | Ga0495604_0005868_5052_5867 | 268 |
| 141 | 3300047318 | Ga0495636_0005854 | Ga0495636_0005854_3230_4045 | 268 |
| 142 | 3300047322 | Ga0495680_0001187 | Ga0495680_0001187_24459_25274 | 268 |
| 143 | 3300050508 | nmdc:mga09592_38831_c1 | nmdc:mga09592_38831_c1_755_1570 | 268 |
| 144 | 3300050511 | nmdc:mga08y16_8227_c1 | nmdc:mga08y16_8227_c1_9527_10342 | 268 |
| 145 | 3300050512 | nmdc:mga0n895_51608_c1 | nmdc:mga0n895_51608_c1_3196_4011 | 268 |
| 146 | 3300053077 | Ga0495601_0022680 | Ga0495601_0022680_624_1439 | 268 |
| 147 | 3300053077 | Ga0495601_0061445 | Ga0495601_0061445_1408_2223 | 268 |
| 148 | 3300053085 | Ga0495619_0021555 | Ga0495619_0021555_289_1104 | 268 |
| 149 | 3300006051 | Ga0075364_10031006 | Ga0075364_100310063 | 269 |
| 150 | 3300009553 | Ga0105249_10142651 | Ga0105249_101426512 | 269 |
| 151 | 3300017792 | Ga0163161_10018567 | Ga0163161_100185674 | 269 |
| 152 | 3300026118 | Ga0207675_100059637 | Ga0207675_1000596372 | 269 |
| 153 | 3300046557 | Ga0495622_0028525 | Ga0495622_0028525_1065_1904 | 269 |
| 154 | 3300046558 | Ga0495633_0001345 | Ga0495633_0001345_10586_11425 | 269 |
| 155 | 3300049460 | Ga0495682_0008320 | Ga0495682_0008320_827_1666 | 269 |
| 156 | 3300049776 | Ga0501280_000798 | Ga0501280_000798_5798_6613 | 269 |
| 157 | 3300049778 | Ga0501282_000988 | Ga0501282_000988_83_898 | 269 |
| 158 | iso_pu_bacteria | 2585428062 | 2587756254 | 269 |
| 159 | iso_pu_bacteria | 2643221544 | 2643746271 | 269 |
| 160 | iso_pu_bacteria | 2643221639 | 2644217441 | 269 |
| 161 | iso_pu_bacteria | 2643221646 | 2644258821 | 269 |
| 162 | iso_pu_bacteria | 2738541337 | 2739055577 | 269 |
| 163 | iso_pu_bacteria | 2928130867 | 2928133468 | 269 |
| 164 | iso_pu_bacteria | 2989392574 | 2989393335 | 269 |
| 165 | 3300002704 | JGI25155J39150_1000005 | JGI25155J39150_100000563 | 270 |
| 166 | 3300002705 | JGI25156J39149_1000006 | JGI25156J39149_100000663 | 270 |
| 167 | 3300002738 | JGI25154J39366_1000015 | JGI25154J39366_1000015185 | 270 |
| 168 | 3300002739 | JGI25158J39367_1004793 | JGI25158J39367_10047933 | 270 |
| 169 | 3300002739 | JGI25158J39367_1007049 | JGI25158J39367_10070491 | 270 |
| 170 | 3300002741 | JGI25157J39369_1000016 | JGI25157J39369_1000016120 | 270 |
| 171 | 3300003187 | JGI25151J46595_10055061 | JGI25151J46595_100550612 | 270 |
| 172 | 3300003773 | Ga0055537_1001110 | Ga0055537_10011103 | 270 |
| 173 | 3300003791 | Ga0055530_10012241 | Ga0055530_100122411 | 270 |
| 174 | 3300003794 | Ga0055531_10041802 | Ga0055531_100418022 | 270 |
| 175 | 3300017792 | Ga0163161_10034424 | Ga0163161_100344243 | 270 |
| 176 | 3300025206 | Ga0209435_100010 | Ga0209435_10001073 | 270 |
| 177 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012070 | 270 |
| 178 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001726 | 270 |
| 179 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011701 | 270 |
| 180 | 3300025263 | Ga0209565_1000966 | Ga0209565_100096612 | 270 |
| 181 | 3300025295 | Ga0209564_1008921 | Ga0209564_10089212 | 270 |
| 182 | 3300025298 | Ga0209050_1010655 | Ga0209050_10106551 | 270 |
| 183 | 3300031548 | Ga0307408_100001378 | Ga0307408_1000013788 | 270 |
| 184 | 3300031548 | Ga0307408_100001760 | Ga0307408_1000017605 | 270 |
| 185 | 3300042532 | Ga0450893_0032503 | Ga0450893_0032503_42_887 | 270 |
| 186 | 3300044683 | Ga0466965_0005539 | Ga0466965_0005539_2685_3542 | 270 |
| 187 | 3300046457 | Ga0495590_0004799 | Ga0495590_0004799_1642_2487 | 270 |
| 188 | 3300046460 | Ga0495638_0005781 | Ga0495638_0005781_3656_4501 | 270 |
| 189 | 3300046474 | Ga0495605_0019545 | Ga0495605_0019545_222_1067 | 270 |
| 190 | 3300046491 | Ga0495584_0005884 | Ga0495584_0005884_2048_2893 | 270 |
| 191 | 3300046491 | Ga0495584_0046290 | Ga0495584_0046290_241_1086 | 270 |
| 192 | 3300046492 | Ga0495585_0046182 | Ga0495585_0046182_518_1363 | 270 |
| 193 | 3300046501 | Ga0495607_0038555 | Ga0495607_0038555_1237_2082 | 270 |
| 194 | 3300046506 | Ga0495583_0000004 | Ga0495583_0000004_106682_107527 | 270 |
| 195 | 3300046506 | Ga0495583_0000257 | Ga0495583_0000257_41676_42530 | 270 |
| 196 | 3300046513 | Ga0495616_0002745 | Ga0495616_0002745_1788_2633 | 270 |
| 197 | 3300046513 | Ga0495616_0004849 | Ga0495616_0004849_5351_6196 | 270 |
| 198 | 3300046523 | Ga0495644_0000870 | Ga0495644_0000870_1184_2029 | 270 |
| 199 | 3300046523 | Ga0495644_0000884 | Ga0495644_0000884_10389_11234 | 270 |
| 200 | 3300046524 | Ga0495648_0019950 | Ga0495648_0019950_2455_3300 | 270 |
| 201 | 3300046524 | Ga0495648_0042317 | Ga0495648_0042317_910_1806 | 270 |
| 202 | 3300046528 | Ga0495642_0054242 | Ga0495642_0054242_764_1636 | 270 |
| 203 | 3300046542 | Ga0495597_0146436 | Ga0495597_0146436_39_890 | 270 |
| 204 | 3300046557 | Ga0495622_0038510 | Ga0495622_0038510_1161_2006 | 270 |
| 205 | 3300046558 | Ga0495633_0013127 | Ga0495633_0013127_2183_3028 | 270 |
| 206 | 3300046558 | Ga0495633_0014941 | Ga0495633_0014941_2125_2970 | 270 |
| 207 | 3300046615 | Ga0495656_0006569 | Ga0495656_0006569_3222_4067 | 270 |
| 208 | 3300046648 | Ga0495611_0011224 | Ga0495611_0011224_771_1616 | 270 |
| 209 | 3300046660 | Ga0495625_0010574 | Ga0495625_0010574_222_1067 | 270 |
| 210 | 3300046665 | Ga0495661_0215461 | Ga0495661_0215461_59_904 | 270 |
| 211 | 3300046692 | Ga0495671_0009268 | Ga0495671_0009268_2446_3291 | 270 |
| 212 | 3300047318 | Ga0495636_0000628 | Ga0495636_0000628_9679_10524 | 270 |
| 213 | 3300047318 | Ga0495636_0103100 | Ga0495636_0103100_141_992 | 270 |
| 214 | 3300047323 | Ga0495683_0005503 | Ga0495683_0005503_2424_3269 | 270 |
| 215 | 3300047443 | Ga0495687_000621 | Ga0495687_000621_3657_4502 | 270 |
| 216 | 3300047447 | Ga0495685_000005 | Ga0495685_000005_110985_111830 | 270 |
| 217 | 3300047469 | Ga0495673_0019557 | Ga0495673_0019557_899_1744 | 270 |
| 218 | 3300048905 | Ga0496102_0000425 | Ga0496102_0000425_32802_33662 | 270 |
| 219 | 3300048906 | Ga0496103_0002424 | Ga0496103_0002424_8928_9788 | 270 |
| 220 | 3300049459 | Ga0495678_000839 | Ga0495678_000839_24054_24899 | 270 |
| 221 | 3300049581 | Ga0501047_0476411 | Ga0501047_0476411_35_910 | 270 |
| 222 | 3300053139 | Ga0500568_0136398 | Ga0500568_0136398_38_901 | 270 |
| 223 | iso_pu_bacteria | 2511231002 | 2511244030 | 270 |
| 224 | iso_pu_bacteria | 2831864461 | 2831865565 | 270 |
| 225 | 3300002987 | JGI25159J45721_1011231 | JGI25159J45721_10112312 | 271 |
| 226 | 3300003323 | rootH1_10203174 | rootH1_102031741 | 271 |
| 227 | 3300003763 | Ga0055529_1000127 | Ga0055529_100012773 | 271 |
| 228 | 3300003771 | Ga0055526_1005064 | Ga0055526_10050644 | 271 |
| 229 | 3300004625 | Ga0055543_1009791 | Ga0055543_10097912 | 271 |
| 230 | 3300005262 | Ga0065165_1000447 | Ga0065165_100044720 | 271 |
| 231 | 3300005547 | Ga0070693_100011800 | Ga0070693_1000118006 | 271 |
| 232 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003552 | 271 |
| 233 | 3300009551 | Ga0105238_10938854 | Ga0105238_109388541 | 271 |
| 234 | 3300021361 | Ga0213872_10000324 | Ga0213872_1000032412 | 271 |
| 235 | 3300025284 | Ga0209130_1000951 | Ga0209130_10009514 | 271 |
| 236 | 3300035086 | Ga0373934_0000209 | Ga0373934_0000209_10543_11388 | 271 |
| 237 | 3300035111 | Ga0373923_0215049 | Ga0373923_0215049_12_857 | 271 |
| 238 | 3300035117 | Ga0373953_0021321 | Ga0373953_0021321_694_1539 | 271 |
| 239 | 3300035118 | Ga0373954_0033657 | Ga0373954_0033657_758_1603 | 271 |
| 240 | 3300035119 | Ga0373956_0000006 | Ga0373956_0000006_54513_55358 | 271 |
| 241 | 3300035172 | Ga0373955_0011044 | Ga0373955_0011044_1834_2679 | 271 |
| 242 | 3300035724 | Ga0373933_0000217 | Ga0373933_0000217_19578_20423 | 271 |
| 243 | 3300036401 | Ga0373937_0000205 | Ga0373937_0000205_12961_13806 | 271 |
| 244 | 3300039447 | Ga0436361_0148311 | Ga0436361_0148311_15831_16688 | 271 |
| 245 | 3300042007 | Ga0439449_0013392 | Ga0439449_0013392_2089_2910 | 271 |
| 246 | 3300042015 | Ga0439462_0060123 | Ga0439462_0060123_154_975 | 271 |
| 247 | 3300042876 | Ga0451577_0005101 | Ga0451577_0005101_9632_10483 | 271 |
| 248 | 3300045051 | Ga0451576_0222642 | Ga0451576_0222642_232_1083 | 271 |
| 249 | 3300046454 | Ga0495592_0003264 | Ga0495592_0003264_3405_4250 | 271 |
| 250 | 3300046457 | Ga0495590_0000035 | Ga0495590_0000035_56380_57246 | 271 |
| 251 | 3300046460 | Ga0495638_0000023 | Ga0495638_0000023_6362_7228 | 271 |
| 252 | 3300046462 | Ga0495651_0006269 | Ga0495651_0006269_2552_3397 | 271 |
| 253 | 3300046471 | Ga0495650_0013618 | Ga0495650_0013618_2364_3230 | 271 |
| 254 | 3300046475 | Ga0495639_0026028 | Ga0495639_0026028_1653_2519 | 271 |
| 255 | 3300046501 | Ga0495607_0001625 | Ga0495607_0001625_1086_1952 | 271 |
| 256 | 3300046506 | Ga0495583_0001806 | Ga0495583_0001806_12981_13847 | 271 |
| 257 | 3300046507 | Ga0495606_0001324 | Ga0495606_0001324_31547_32419 | 271 |
| 258 | 3300046507 | Ga0495606_0002149 | Ga0495606_0002149_2201_3070 | 271 |
| 259 | 3300046512 | Ga0495610_0000430 | Ga0495610_0000430_32368_33213 | 271 |
| 260 | 3300046516 | Ga0495628_0013204 | Ga0495628_0013204_5352_6197 | 271 |
| 261 | 3300046522 | Ga0495643_0001307 | Ga0495643_0001307_20056_20922 | 271 |
| 262 | 3300046524 | Ga0495648_0000025 | Ga0495648_0000025_226174_227040 | 271 |
| 263 | 3300046528 | Ga0495642_0003530 | Ga0495642_0003530_2535_3401 | 271 |
| 264 | 3300046542 | Ga0495597_0000361 | Ga0495597_0000361_36476_37342 | 271 |
| 265 | 3300046543 | Ga0495645_0000371 | Ga0495645_0000371_14443_15288 | 271 |
| 266 | 3300046557 | Ga0495622_0000063 | Ga0495622_0000063_2796_3662 | 271 |
| 267 | 3300046558 | Ga0495633_0001396 | Ga0495633_0001396_11591_12457 | 271 |
| 268 | 3300046616 | Ga0495668_0000049 | Ga0495668_0000049_169838_170701 | 271 |
| 269 | 3300046616 | Ga0495668_0002152 | Ga0495668_0002152_6186_7052 | 271 |
| 270 | 3300046660 | Ga0495625_0000123 | Ga0495625_0000123_113737_114603 | 271 |
| 271 | 3300046675 | Ga0495657_0057559 | Ga0495657_0057559_170_1015 | 271 |
| 272 | 3300046678 | Ga0495599_0003472 | Ga0495599_0003472_7472_8317 | 271 |
| 273 | 3300046691 | Ga0495670_0048446 | Ga0495670_0048446_59_913 | 271 |
| 274 | 3300049459 | Ga0495678_010318 | Ga0495678_010318_1392_2258 | 271 |
| 275 | 3300053161 | Ga0500634_0139579 | Ga0500634_0139579_254_1081 | 271 |
| 276 | iso_pu_bacteria | 2881101125 | 2881102881 | 271 |
| 277 | iso_pu_bacteria | 2919704043 | 2919707469 | 271 |
| 278 | 3300003187 | JGI25151J46595_10000614 | JGI25151J46595_100006142 | 272 |
| 279 | 3300003187 | JGI25151J46595_10000935 | JGI25151J46595_1000093518 | 272 |
| 280 | 3300003775 | Ga0055524_1000196 | Ga0055524_100019636 | 272 |
| 281 | 3300003775 | Ga0055524_1004096 | Ga0055524_10040962 | 272 |
| 282 | 3300003781 | Ga0055536_1000022 | Ga0055536_100002248 | 272 |
| 283 | 3300003784 | Ga0055534_1000270 | Ga0055534_100027030 | 272 |
| 284 | 3300003784 | Ga0055534_1000368 | Ga0055534_100036826 | 272 |
| 285 | 3300003784 | Ga0055534_1002591 | Ga0055534_10025912 | 272 |
| 286 | 3300005459 | Ga0068867_100000083 | Ga0068867_10000008348 | 272 |
| 287 | 3300009148 | Ga0105243_10026872 | Ga0105243_100268722 | 272 |
| 288 | 3300014745 | Ga0157377_10000104 | Ga0157377_100001046 | 272 |
| 289 | 3300025263 | Ga0209565_1000411 | Ga0209565_100041125 | 272 |
| 290 | 3300025291 | Ga0209675_1000070 | Ga0209675_10000704 | 272 |
| 291 | 3300025291 | Ga0209675_1000383 | Ga0209675_100038330 | 272 |
| 292 | 3300025291 | Ga0209675_1000389 | Ga0209675_100038928 | 272 |
| 293 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012627 | 272 |
| 294 | 3300025294 | Ga0209025_1000124 | Ga0209025_100012485 | 272 |
| 295 | 3300025294 | Ga0209025_1001088 | Ga0209025_10010888 | 272 |
| 296 | 3300025294 | Ga0209025_1001306 | Ga0209025_100130610 | 272 |
| 297 | 3300025295 | Ga0209564_1000350 | Ga0209564_100035013 | 272 |
| 298 | 3300025295 | Ga0209564_1000380 | Ga0209564_10003804 | 272 |
| 299 | 3300025295 | Ga0209564_1000497 | Ga0209564_100049736 | 272 |
| 300 | 3300025299 | Ga0209256_1000059 | Ga0209256_1000059212 | 272 |
| 301 | 3300025299 | Ga0209256_1000842 | Ga0209256_10008424 | 272 |
| 302 | 3300025935 | Ga0207709_10015374 | Ga0207709_100153746 | 272 |
| 303 | 3300026089 | Ga0207648_10000243 | Ga0207648_100002436 | 272 |
| 304 | 3300026142 | Ga0207698_10032373 | Ga0207698_100323732 | 272 |
| 305 | 3300027666 | Ga0209282_1000064 | Ga0209282_100006455 | 272 |
| 306 | 3300041404 | Ga0439436_0005686 | Ga0439436_0005686_1655_2491 | 272 |
| 307 | 3300044656 | Ga0466969_0007616 | Ga0466969_0007616_1068_2177 | 272 |
| 308 | 3300044666 | Ga0466977_0080483 | Ga0466977_0080483_853_1863 | 272 |
| 309 | 3300044693 | Ga0466961_0026365 | Ga0466961_0026365_574_1584 | 272 |
| 310 | 3300046513 | Ga0495616_0023343 | Ga0495616_0023343_104_964 | 272 |
| 311 | 3300046538 | Ga0495609_0000598 | Ga0495609_0000598_26373_27221 | 272 |
| 312 | 3300046692 | Ga0495671_0015519 | Ga0495671_0015519_2208_3056 | 272 |
| 313 | 3300047317 | Ga0495604_0043060 | Ga0495604_0043060_2631_3467 | 272 |
| 314 | 3300047318 | Ga0495636_0043143 | Ga0495636_0043143_868_1716 | 272 |
| 315 | 3300047320 | Ga0495672_0045832 | Ga0495672_0045832_864_1712 | 272 |
| 316 | 3300048919 | Ga0496116_0011775 | Ga0496116_0011775_3055_3915 | 272 |
| 317 | iso_pu_bacteria | 2513237165 | 2514041140 | 272 |
| 318 | iso_pu_bacteria | 2547132374 | 2548498818 | 272 |
| 319 | iso_pu_bacteria | 2643221570 | 2643867029 | 272 |
| 320 | iso_pu_bacteria | 2643221596 | 2643989968 | 272 |
| 321 | iso_pu_bacteria | 2643221609 | 2644058919 | 272 |
| 322 | iso_pu_bacteria | 2643221611 | 2644071143 | 272 |
| 323 | iso_pu_bacteria | 2643221652 | 2644292639 | 272 |
| 324 | iso_pu_bacteria | 2643221717 | 2644648278 | 272 |
| 325 | iso_pu_bacteria | 2721755523 | 2722885152 | 272 |
| 326 | iso_pu_bacteria | 2721755763 | 2723876477 | 272 |
| 327 | iso_pu_bacteria | 2738541277 | 2738723342 | 272 |
| 328 | iso_pu_bacteria | 2738543012 | 2739246176 | 272 |
| 329 | iso_pu_bacteria | 2738543019 | 2739284073 | 272 |
| 330 | iso_pu_bacteria | 2816332133 | 2816471445 | 272 |
| 331 | iso_pu_bacteria | 2834641062 | 2834641324 | 272 |
| 332 | iso_pu_bacteria | 2839138175 | 2839142462 | 272 |
| 333 | iso_pu_bacteria | 2842718218 | 2842721277 | 272 |
| 334 | iso_pu_bacteria | 2885192300 | 2885198017 | 272 |
| 335 | iso_pu_bacteria | 2901300506 | 2901305545 | 272 |
| 336 | iso_pu_bacteria | 2904479285 | 2904480148 | 272 |
| 337 | iso_pu_bacteria | 2932422444 | 2932425290 | 272 |
| 338 | iso_pu_bacteria | 2954767861 | 2954771172 | 272 |
| 339 | iso_pu_bacteria | 2990710928 | 2990711368 | 272 |
| 340 | iso_pu_bacteria | 644736347 | 644748707 | 272 |
| 341 | iso_pu_bacteria | 8003400568 | 8003400994 | 272 |
| 342 | 3300003316 | rootH1_10005867 | rootH1_100058673 | 273 |
| 343 | 3300003322 | rootL2_10010992 | rootL2_100109929 | 273 |
| 344 | 3300003322 | rootL2_10027335 | rootL2_100273351 | 273 |
| 345 | 3300003323 | rootH1_10016719 | rootH1_1001671929 | 273 |
| 346 | 3300003323 | rootH1_10106554 | rootH1_101065542 | 273 |
| 347 | 3300005328 | Ga0070676_10275423 | Ga0070676_102754232 | 273 |
| 348 | 3300005353 | Ga0070669_100033317 | Ga0070669_1000333174 | 273 |
| 349 | 3300005354 | Ga0070675_100087152 | Ga0070675_1000871523 | 273 |
| 350 | 3300005456 | Ga0070678_100071614 | Ga0070678_1000716142 | 273 |
| 351 | 3300005456 | Ga0070678_100234981 | Ga0070678_1002349811 | 273 |
| 352 | 3300005457 | Ga0070662_100002892 | Ga0070662_1000028923 | 273 |
| 353 | 3300005467 | Ga0070706_100240587 | Ga0070706_1002405873 | 273 |
| 354 | 3300005543 | Ga0070672_100160174 | Ga0070672_1001601742 | 273 |
| 355 | 3300005616 | Ga0068852_100062137 | Ga0068852_1000621371 | 273 |
| 356 | 3300005618 | Ga0068864_100075933 | Ga0068864_1000759335 | 273 |
| 357 | 3300005841 | Ga0068863_100210350 | Ga0068863_1002103503 | 273 |
| 358 | 3300005843 | Ga0068860_100205441 | Ga0068860_1002054411 | 273 |
| 359 | 3300006048 | Ga0075363_100088043 | Ga0075363_1000880432 | 273 |
| 360 | 3300006195 | Ga0075366_10002784 | Ga0075366_1000278412 | 273 |
| 361 | 3300006353 | Ga0075370_10197766 | Ga0075370_101977661 | 273 |
| 362 | 3300009177 | Ga0105248_10003706 | Ga0105248_100037068 | 273 |
| 363 | 3300009545 | Ga0105237_10000441 | Ga0105237_1000044146 | 273 |
| 364 | 3300009551 | Ga0105238_10024678 | Ga0105238_100246783 | 273 |
| 365 | 3300010375 | Ga0105239_10000417 | Ga0105239_1000041713 | 273 |
| 366 | 3300013306 | Ga0163162_10602926 | Ga0163162_106029261 | 273 |
| 367 | 3300025303 | Ga0209051_1003952 | Ga0209051_10039523 | 273 |
| 368 | 3300025303 | Ga0209051_1013653 | Ga0209051_10136532 | 273 |
| 369 | 3300025907 | Ga0207645_10271834 | Ga0207645_102718341 | 273 |
| 370 | 3300025910 | Ga0207684_10199097 | Ga0207684_101990973 | 273 |
| 371 | 3300025913 | Ga0207695_10004036 | Ga0207695_1000403614 | 273 |
| 372 | 3300025914 | Ga0207671_10007150 | Ga0207671_100071504 | 273 |
| 373 | 3300025923 | Ga0207681_10030861 | Ga0207681_100308612 | 273 |
| 374 | 3300025924 | Ga0207694_10017517 | Ga0207694_100175173 | 273 |
| 375 | 3300025933 | Ga0207706_10000544 | Ga0207706_1000054424 | 273 |
| 376 | 3300025940 | Ga0207691_10075959 | Ga0207691_100759592 | 273 |
| 377 | 3300025941 | Ga0207711_10016794 | Ga0207711_100167946 | 273 |
| 378 | 3300025960 | Ga0207651_10038244 | Ga0207651_100382443 | 273 |
| 379 | 3300025972 | Ga0207668_10294510 | Ga0207668_102945101 | 273 |
| 380 | 3300026023 | Ga0207677_10322122 | Ga0207677_103221222 | 273 |
| 381 | 3300026041 | Ga0207639_10144109 | Ga0207639_101441093 | 273 |
| 382 | 3300026088 | Ga0207641_10282398 | Ga0207641_102823982 | 273 |
| 383 | 3300026095 | Ga0207676_10050322 | Ga0207676_100503222 | 273 |
| 384 | 3300026121 | Ga0207683_10070600 | Ga0207683_100706002 | 273 |
| 385 | 3300026142 | Ga0207698_10696665 | Ga0207698_106966651 | 273 |
| 386 | 3300028794 | Ga0307515_10006997 | Ga0307515_1000699712 | 273 |
| 387 | 3300028794 | Ga0307515_10014617 | Ga0307515_100146174 | 273 |
| 388 | 3300028794 | Ga0307515_10017471 | Ga0307515_100174713 | 273 |
| 389 | 3300028794 | Ga0307515_10067591 | Ga0307515_100675914 | 273 |
| 390 | 3300028794 | Ga0307515_10428656 | Ga0307515_104286561 | 273 |
| 391 | 3300030522 | Ga0307512_10042866 | Ga0307512_100428661 | 273 |
| 392 | 3300031239 | Ga0265328_10017791 | Ga0265328_100177912 | 273 |
| 393 | 3300031251 | Ga0265327_10000235 | Ga0265327_1000023547 | 273 |
| 394 | 3300031456 | Ga0307513_10007087 | Ga0307513_100070879 | 273 |
| 395 | 3300031456 | Ga0307513_10099934 | Ga0307513_100999342 | 273 |
| 396 | 3300031507 | Ga0307509_10125778 | Ga0307509_101257784 | 273 |
| 397 | 3300031507 | Ga0307509_10140135 | Ga0307509_101401353 | 273 |
| 398 | 3300031548 | Ga0307408_100000165 | Ga0307408_10000016516 | 273 |
| 399 | 3300031649 | Ga0307514_10001054 | Ga0307514_1000105417 | 273 |
| 400 | 3300032004 | Ga0307414_10074486 | Ga0307414_100744862 | 273 |
| 401 | 3300032005 | Ga0307411_10001640 | Ga0307411_100016405 | 273 |
| 402 | 3300034818 | Ga0373950_0009468 | Ga0373950_0009468_16_837 | 273 |
| 403 | 3300035088 | Ga0373940_0011326 | Ga0373940_0011326_1144_1965 | 273 |
| 404 | 3300035091 | Ga0373951_0009094 | Ga0373951_0009094_37_858 | 273 |
| 405 | 3300035114 | Ga0373939_0000372 | Ga0373939_0000372_3322_4143 | 273 |
| 406 | 3300035242 | Ga0373962_0008728 | Ga0373962_0008728_1191_2012 | 273 |
| 407 | 3300035691 | Ga0373931_0008442 | Ga0373931_0008442_3296_4117 | 273 |
| 408 | 3300035691 | Ga0373931_0391223 | Ga0373931_0391223_22_867 | 273 |
| 409 | 3300037312 | Ga0395899_0001005 | Ga0395899_0001005_7506_8351 | 273 |
| 410 | 3300037418 | Ga0395900_0006176 | Ga0395900_0006176_4193_5038 | 273 |
| 411 | 3300037466 | Ga0395898_0007548 | Ga0395898_0007548_5370_6215 | 273 |
| 412 | 3300037471 | Ga0395905_0009619 | Ga0395905_0009619_4162_5007 | 273 |
| 413 | 3300037471 | Ga0395905_0029892 | Ga0395905_0029892_3052_3876 | 273 |
| 414 | 3300038443 | Ga0395901_0007041 | Ga0395901_0007041_6362_7207 | 273 |
| 415 | 3300041486 | Ga0451807_1484103 | Ga0451807_1484103_315_1169 | 273 |
| 416 | 3300042003 | Ga0439443_015061 | Ga0439443_015061_19_843 | 273 |
| 417 | 3300042007 | Ga0439449_0030592 | Ga0439449_0030592_799_1626 | 273 |
| 418 | 3300042015 | Ga0439462_0036135 | Ga0439462_0036135_305_1132 | 273 |
| 419 | 3300042120 | Ga0450917_001070 | Ga0450917_001070_23_847 | 273 |
| 420 | 3300042126 | Ga0450888_000661 | Ga0450888_000661_71_895 | 273 |
| 421 | 3300042127 | Ga0450890_000366 | Ga0450890_000366_474_1298 | 273 |
| 422 | 3300042129 | Ga0450891_002200 | Ga0450891_002200_604_1428 | 273 |
| 423 | 3300042130 | Ga0450892_000411 | Ga0450892_000411_3210_4034 | 273 |
| 424 | 3300042144 | Ga0450889_004348 | Ga0450889_004348_474_1298 | 273 |
| 425 | 3300042532 | Ga0450893_0000278 | Ga0450893_0000278_2176_3000 | 273 |
| 426 | 3300042876 | Ga0451577_0000804 | Ga0451577_0000804_18828_19652 | 273 |
| 427 | 3300044712 | Ga0453684_0005076 | Ga0453684_0005076_22418_23239 | 273 |
| 428 | 3300044712 | Ga0453684_0018360 | Ga0453684_0018360_6151_6975 | 273 |
| 429 | 3300044712 | Ga0453684_0151298 | Ga0453684_0151298_1083_1904 | 273 |
| 430 | 3300045051 | Ga0451576_0266409 | Ga0451576_0266409_361_1185 | 273 |
| 431 | 3300046519 | Ga0495632_0020100 | Ga0495632_0020100_458_1318 | 273 |
| 432 | 3300046537 | Ga0495598_0007405 | Ga0495598_0007405_1640_2461 | 273 |
| 433 | 3300046539 | Ga0495621_0007614 | Ga0495621_0007614_1983_2804 | 273 |
| 434 | 3300046660 | Ga0495625_0004092 | Ga0495625_0004092_12009_12830 | 273 |
| 435 | 3300048907 | Ga0496104_0077219 | Ga0496104_0077219_1977_2804 | 273 |
| 436 | 3300048908 | Ga0496105_0190863 | Ga0496105_0190863_505_1332 | 273 |
| 437 | 3300048912 | Ga0496109_0279544 | Ga0496109_0279544_516_1343 | 273 |
| 438 | 3300048915 | Ga0496112_0020391 | Ga0496112_0020391_2458_3285 | 273 |
| 439 | 3300048916 | Ga0496113_0025739 | Ga0496113_0025739_1506_2333 | 273 |
| 440 | 3300048928 | Ga0496125_0276206 | Ga0496125_0276206_20_850 | 273 |
| 441 | 3300049652 | Ga0501202_001322 | Ga0501202_001322_2930_3754 | 273 |
| 442 | 3300049662 | Ga0501222_000006 | Ga0501222_000006_64292_65137 | 273 |
| 443 | 3300049669 | Ga0501235_019614 | Ga0501235_019614_197_1021 | 273 |
| 444 | 3300049704 | Ga0501221_002212 | Ga0501221_002212_2250_3074 | 273 |
| 445 | 3300049705 | Ga0501225_0047697 | Ga0501225_0047697_160_984 | 273 |
| 446 | 3300049706 | Ga0501229_000401 | Ga0501229_000401_2297_3121 | 273 |
| 447 | 3300049757 | Ga0501232_002702 | Ga0501232_002702_101_925 | 273 |
| 448 | 3300050493 | nmdc:mga0k408_17094_c1 | nmdc:mga0k408_17094_c1_2479_3300 | 273 |
| 449 | 3300050496 | nmdc:mga07m45_32777_c1 | nmdc:mga07m45_32777_c1_757_1578 | 273 |
| 450 | 3300050496 | nmdc:mga07m45_96351_c1 | nmdc:mga07m45_96351_c1_206_1030 | 273 |
| 451 | 3300050511 | nmdc:mga08y16_280593_c1 | nmdc:mga08y16_280593_c1_822_1643 | 273 |
| 452 | 3300053739 | Ga0500587_000565 | Ga0500587_000565_1392_2252 | 273 |
| 453 | 3300059421 | Ga0590071_000940 | Ga0590071_000940_4781_5602 | 273 |
| 454 | 3300002774 | JGI25150J39212_1003538 | JGI25150J39212_10035383 | 274 |
| 455 | 3300002987 | JGI25159J45721_1000065 | JGI25159J45721_100006528 | 274 |
| 456 | 3300003187 | JGI25151J46595_10057071 | JGI25151J46595_100570712 | 274 |
| 457 | 3300003316 | rootH1_10002293 | rootH1_100022932 | 274 |
| 458 | 3300003320 | rootH2_10140946 | rootH2_101409461 | 274 |
| 459 | 3300003322 | rootL2_10005248 | rootL2_1000524815 | 274 |
| 460 | 3300003323 | rootH1_10037528 | rootH1_100375288 | 274 |
| 461 | 3300003354 | JGI25160J50197_1000098 | JGI25160J50197_100009858 | 274 |
| 462 | 3300003374 | JGI25161J50226_1000037 | JGI25161J50226_100003796 | 274 |
| 463 | 3300003771 | Ga0055526_1000985 | Ga0055526_100098516 | 274 |
| 464 | 3300003771 | Ga0055526_1002586 | Ga0055526_10025863 | 274 |
| 465 | 3300003771 | Ga0055526_1005110 | Ga0055526_10051106 | 274 |
| 466 | 3300003773 | Ga0055537_1000463 | Ga0055537_100046319 | 274 |
| 467 | 3300003773 | Ga0055537_1000876 | Ga0055537_10008763 | 274 |
| 468 | 3300003775 | Ga0055524_1000261 | Ga0055524_100026144 | 274 |
| 469 | 3300003775 | Ga0055524_1000761 | Ga0055524_10007612 | 274 |
| 470 | 3300003775 | Ga0055524_1012988 | Ga0055524_10129882 | 274 |
| 471 | 3300003784 | Ga0055534_1022796 | Ga0055534_10227961 | 274 |
| 472 | 3300003790 | Ga0055528_1003437 | Ga0055528_10034374 | 274 |
| 473 | 3300003791 | Ga0055530_10000190 | Ga0055530_1000019030 | 274 |
| 474 | 3300003792 | Ga0055540_1000187 | Ga0055540_100018733 | 274 |
| 475 | 3300003792 | Ga0055540_1010573 | Ga0055540_10105732 | 274 |
| 476 | 3300003794 | Ga0055531_10000765 | Ga0055531_1000076520 | 274 |
| 477 | 3300003794 | Ga0055531_10001838 | Ga0055531_100018386 | 274 |
| 478 | 3300003794 | Ga0055531_10009989 | Ga0055531_100099896 | 274 |
| 479 | 3300003794 | Ga0055531_10012043 | Ga0055531_100120432 | 274 |
| 480 | 3300004625 | Ga0055543_1001040 | Ga0055543_10010407 | 274 |
| 481 | 3300005262 | Ga0065165_1000153 | Ga0065165_100015330 | 274 |
| 482 | 3300005262 | Ga0065165_1000816 | Ga0065165_100081630 | 274 |
| 483 | 3300005530 | Ga0070679_100017823 | Ga0070679_1000178235 | 274 |
| 484 | 3300006038 | Ga0075365_10078840 | Ga0075365_100788402 | 274 |
| 485 | 3300006177 | Ga0075362_10039976 | Ga0075362_100399762 | 274 |
| 486 | 3300006178 | Ga0075367_10085772 | Ga0075367_100857722 | 274 |
| 487 | 3300006944 | Ga0099823_1011917 | Ga0099823_10119174 | 274 |
| 488 | 3300009093 | Ga0105240_10058493 | Ga0105240_100584936 | 274 |
| 489 | 3300009551 | Ga0105238_10191736 | Ga0105238_101917362 | 274 |
| 490 | 3300012497 | Ga0157319_1000016 | Ga0157319_100001679 | 274 |
| 491 | 3300015262 | Ga0182007_10055158 | Ga0182007_100551582 | 274 |
| 492 | 3300021361 | Ga0213872_10000004 | Ga0213872_10000004155 | 274 |
| 493 | 3300021361 | Ga0213872_10000077 | Ga0213872_1000007759 | 274 |
| 494 | 3300021361 | Ga0213872_10001319 | Ga0213872_100013194 | 274 |
| 495 | 3300021361 | Ga0213872_10002068 | Ga0213872_1000206810 | 274 |
| 496 | 3300025208 | Ga0209436_103957 | Ga0209436_1039573 | 274 |
| 497 | 3300025258 | Ga0209129_1011907 | Ga0209129_10119072 | 274 |
| 498 | 3300025263 | Ga0209565_1000102 | Ga0209565_100010243 | 274 |
| 499 | 3300025273 | Ga0209673_1000189 | Ga0209673_100018972 | 274 |
| 500 | 3300025273 | Ga0209673_1008368 | Ga0209673_10083682 | 274 |
| 501 | 3300025273 | Ga0209673_1010389 | Ga0209673_10103892 | 274 |
| 502 | 3300025284 | Ga0209130_1000141 | Ga0209130_100014134 | 274 |
| 503 | 3300025284 | Ga0209130_1000423 | Ga0209130_100042332 | 274 |
| 504 | 3300025291 | Ga0209675_1000288 | Ga0209675_100028811 | 274 |
| 505 | 3300025291 | Ga0209675_1009066 | Ga0209675_10090663 | 274 |
| 506 | 3300025292 | Ga0209676_1000069 | Ga0209676_100006959 | 274 |
| 507 | 3300025292 | Ga0209676_1029305 | Ga0209676_10293052 | 274 |
| 508 | 3300025294 | Ga0209025_1002311 | Ga0209025_10023113 | 274 |
| 509 | 3300025294 | Ga0209025_1003168 | Ga0209025_100316811 | 274 |
| 510 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008772 | 274 |
| 511 | 3300025295 | Ga0209564_1000415 | Ga0209564_100041563 | 274 |
| 512 | 3300025295 | Ga0209564_1001117 | Ga0209564_100111730 | 274 |
| 513 | 3300025295 | Ga0209564_1011606 | Ga0209564_10116062 | 274 |
| 514 | 3300025297 | Ga0209758_1040734 | Ga0209758_10407342 | 274 |
| 515 | 3300025298 | Ga0209050_1000023 | Ga0209050_1000023234 | 274 |
| 516 | 3300025298 | Ga0209050_1002239 | Ga0209050_10022396 | 274 |
| 517 | 3300025298 | Ga0209050_1002352 | Ga0209050_100235215 | 274 |
| 518 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003971 | 274 |
| 519 | 3300025299 | Ga0209256_1000496 | Ga0209256_100049616 | 274 |
| 520 | 3300025299 | Ga0209256_1002703 | Ga0209256_100270315 | 274 |
| 521 | 3300025302 | Ga0207426_1000145 | Ga0207426_100014531 | 274 |
| 522 | 3300025302 | Ga0207426_1004246 | Ga0207426_10042463 | 274 |
| 523 | 3300025303 | Ga0209051_1000017 | Ga0209051_1000017234 | 274 |
| 524 | 3300025303 | Ga0209051_1000639 | Ga0209051_10006399 | 274 |
| 525 | 3300025303 | Ga0209051_1000928 | Ga0209051_100092822 | 274 |
| 526 | 3300025304 | Ga0209257_1000041 | Ga0209257_1000041234 | 274 |
| 527 | 3300025304 | Ga0209257_1000096 | Ga0209257_1000096240 | 274 |
| 528 | 3300025304 | Ga0209257_1003877 | Ga0209257_100387711 | 274 |
| 529 | 3300025304 | Ga0209257_1004170 | Ga0209257_10041703 | 274 |
| 530 | 3300025921 | Ga0207652_10085609 | Ga0207652_100856093 | 274 |
| 531 | 3300025949 | Ga0207667_10413258 | Ga0207667_104132582 | 274 |
| 532 | 3300027312 | Ga0209371_1029846 | Ga0209371_10298462 | 274 |
| 533 | 3300027866 | Ga0209813_10024948 | Ga0209813_100249482 | 274 |
| 534 | 3300030500 | Ga0268256_1030016 | Ga0268256_10300162 | 274 |
| 535 | 3300031238 | Ga0265332_10010386 | Ga0265332_100103863 | 274 |
| 536 | 3300031242 | Ga0265329_10009325 | Ga0265329_100093253 | 274 |
| 537 | 3300031344 | Ga0265316_10153241 | Ga0265316_101532413 | 274 |
| 538 | 3300031548 | Ga0307408_100014599 | Ga0307408_1000145993 | 274 |
| 539 | 3300031548 | Ga0307408_100026194 | Ga0307408_1000261943 | 274 |
| 540 | 3300031711 | Ga0265314_10000727 | Ga0265314_100007272 | 274 |
| 541 | 3300031711 | Ga0265314_10057988 | Ga0265314_100579882 | 274 |
| 542 | 3300031901 | Ga0307406_10014450 | Ga0307406_100144502 | 274 |
| 543 | 3300037312 | Ga0395899_0022001 | Ga0395899_0022001_3754_4590 | 274 |
| 544 | 3300037312 | Ga0395899_0043120 | Ga0395899_0043120_896_1744 | 274 |
| 545 | 3300037312 | Ga0395899_0304823 | Ga0395899_0304823_86_922 | 274 |
| 546 | 3300037418 | Ga0395900_0010004 | Ga0395900_0010004_6750_7598 | 274 |
| 547 | 3300037418 | Ga0395900_0122716 | Ga0395900_0122716_1339_2172 | 274 |
| 548 | 3300037418 | Ga0395900_0233878 | Ga0395900_0233878_371_1201 | 274 |
| 549 | 3300037418 | Ga0395900_0312814 | Ga0395900_0312814_288_1124 | 274 |
| 550 | 3300037466 | Ga0395898_0039793 | Ga0395898_0039793_1726_2616 | 274 |
| 551 | 3300037466 | Ga0395898_0043895 | Ga0395898_0043895_136_984 | 274 |
| 552 | 3300037471 | Ga0395905_0000033 | Ga0395905_0000033_267670_268500 | 274 |
| 553 | 3300037471 | Ga0395905_0003696 | Ga0395905_0003696_14758_15606 | 274 |
| 554 | 3300037471 | Ga0395905_0004869 | Ga0395905_0004869_9266_10096 | 274 |
| 555 | 3300037471 | Ga0395905_0011819 | Ga0395905_0011819_5911_6741 | 274 |
| 556 | 3300037471 | Ga0395905_0107034 | Ga0395905_0107034_73_906 | 274 |
| 557 | 3300037471 | Ga0395905_0136766 | Ga0395905_0136766_1101_1931 | 274 |
| 558 | 3300037471 | Ga0395905_0282630 | Ga0395905_0282630_110_958 | 274 |
| 559 | 3300038443 | Ga0395901_0063115 | Ga0395901_0063115_565_1455 | 274 |
| 560 | 3300038443 | Ga0395901_0074942 | Ga0395901_0074942_26_856 | 274 |
| 561 | 3300038443 | Ga0395901_0089265 | Ga0395901_0089265_418_1266 | 274 |
| 562 | 3300038443 | Ga0395901_0666224 | Ga0395901_0666224_158_994 | 274 |
| 563 | 3300038443 | Ga0395901_0751387 | Ga0395901_0751387_40_876 | 274 |
| 564 | 3300039447 | Ga0436361_0261085 | Ga0436361_0261085_168_1004 | 274 |
| 565 | 3300039447 | Ga0436361_0287447 | Ga0436361_0287447_83368_84195 | 274 |
| 566 | 3300039447 | Ga0436361_0656823 | Ga0436361_0656823_13150_14082 | 274 |
| 567 | 3300039447 | Ga0436361_1007413 | Ga0436361_1007413_73107_73934 | 274 |
| 568 | 3300039447 | Ga0436361_1146112 | Ga0436361_1146112_4736_5563 | 274 |
| 569 | 3300042116 | Ga0450912_000333 | Ga0450912_000333_38_868 | 274 |
| 570 | 3300042127 | Ga0450890_001507 | Ga0450890_001507_365_1195 | 274 |
| 571 | 3300042131 | Ga0450894_006833 | Ga0450894_006833_261_1097 | 274 |
| 572 | 3300042134 | Ga0450898_001687 | Ga0450898_001687_996_1832 | 274 |
| 573 | 3300042156 | Ga0439446_0017366 | Ga0439446_0017366_1005_1841 | 274 |
| 574 | 3300042438 | Ga0439459_0016257 | Ga0439459_0016257_54_890 | 274 |
| 575 | 3300042532 | Ga0450893_0002086 | Ga0450893_0002086_60_890 | 274 |
| 576 | 3300044673 | Ga0453683_0003001 | Ga0453683_0003001_193_1029 | 274 |
| 577 | 3300044684 | Ga0466966_0019549 | Ga0466966_0019549_2306_3154 | 274 |
| 578 | 3300044693 | Ga0466961_0006490 | Ga0466961_0006490_1121_1969 | 274 |
| 579 | 3300044719 | Ga0466971_0148433 | Ga0466971_0148433_43_873 | 274 |
| 580 | 3300044842 | Ga0466957_0012321 | Ga0466957_0012321_3445_4281 | 274 |
| 581 | 3300045049 | Ga0466959_0119767 | Ga0466959_0119767_802_1650 | 274 |
| 582 | 3300045051 | Ga0451576_0592110 | Ga0451576_0592110_286_1122 | 274 |
| 583 | 3300046542 | Ga0495597_0001192 | Ga0495597_0001192_18002_18841 | 274 |
| 584 | 3300046615 | Ga0495656_0004696 | Ga0495656_0004696_2881_3714 | 274 |
| 585 | 3300046615 | Ga0495656_0087875 | Ga0495656_0087875_95_928 | 274 |
| 586 | 3300047447 | Ga0495685_010046 | Ga0495685_010046_1999_2832 | 274 |
| 587 | 3300048927 | Ga0496124_0013398 | Ga0496124_0013398_789_1619 | 274 |
| 588 | 3300048929 | Ga0496126_0304010 | Ga0496126_0304010_378_1208 | 274 |
| 589 | 3300049569 | Ga0501032_0274135 | Ga0501032_0274135_38_874 | 274 |
| 590 | 3300049571 | Ga0501034_0035730 | Ga0501034_0035730_1294_2124 | 274 |
| 591 | 3300049573 | Ga0501037_0165878 | Ga0501037_0165878_649_1485 | 274 |
| 592 | 3300049574 | Ga0501038_0050608 | Ga0501038_0050608_1154_1984 | 274 |
| 593 | 3300049742 | Ga0501080_0167824 | Ga0501080_0167824_12_842 | 274 |
| 594 | 3300049823 | Ga0501044_0129700 | Ga0501044_0129700_1378_2214 | 274 |
| 595 | 3300050491 | nmdc:mga00v17_145916_c1 | nmdc:mga00v17_145916_c1_401_1258 | 274 |
| 596 | 3300050492 | nmdc:mga0yw44_109692_c1 | nmdc:mga0yw44_109692_c1_122_952 | 274 |
| 597 | 3300050492 | nmdc:mga0yw44_163541_c1 | nmdc:mga0yw44_163541_c1_463_1296 | 274 |
| 598 | 3300050495 | nmdc:mga04h51_16263_c1 | nmdc:mga04h51_16263_c1_1232_2065 | 274 |
| 599 | 3300050496 | nmdc:mga07m45_9970_c1 | nmdc:mga07m45_9970_c1_2109_2939 | 274 |
| 600 | 3300053088 | Ga0500644_0008575 | Ga0500644_0008575_1437_2294 | 274 |
| 601 | 3300053094 | Ga0500566_0066833 | Ga0500566_0066833_877_1743 | 274 |
| 602 | 3300053117 | Ga0500593_006312 | Ga0500593_006312_1443_2309 | 274 |
| 603 | 3300053129 | Ga0500628_001055 | Ga0500628_001055_1228_2076 | 274 |
| 604 | 3300053136 | Ga0500559_0046548 | Ga0500559_0046548_495_1331 | 274 |
| 605 | 3300053156 | Ga0500622_0001521 | Ga0500622_0001521_8614_9444 | 274 |
| 606 | 3300055283 | Ga0500661_001001 | Ga0500661_001001_3351_4217 | 274 |
| 607 | 3300001979 | JGI24740J21852_10002764 | JGI24740J21852_100027644 | 275 |
| 608 | 3300003187 | JGI25151J46595_10005710 | JGI25151J46595_100057105 | 275 |
| 609 | 3300003187 | JGI25151J46595_10031914 | JGI25151J46595_100319142 | 275 |
| 610 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004641 | 275 |
| 611 | 3300005262 | Ga0065165_1008081 | Ga0065165_10080813 | 275 |
| 612 | 3300005262 | Ga0065165_1019554 | Ga0065165_10195542 | 275 |
| 613 | 3300005262 | Ga0065165_1048047 | Ga0065165_10480471 | 275 |
| 614 | 3300005288 | Ga0065714_10069965 | Ga0065714_100699654 | 275 |
| 615 | 3300005289 | Ga0065704_10153150 | Ga0065704_101531502 | 275 |
| 616 | 3300005331 | Ga0070670_100039689 | Ga0070670_1000396892 | 275 |
| 617 | 3300005334 | Ga0068869_100122717 | Ga0068869_1001227172 | 275 |
| 618 | 3300005338 | Ga0068868_100012661 | Ga0068868_1000126612 | 275 |
| 619 | 3300005338 | Ga0068868_100049498 | Ga0068868_1000494982 | 275 |
| 620 | 3300005344 | Ga0070661_100359613 | Ga0070661_1003596131 | 275 |
| 621 | 3300005356 | Ga0070674_100107379 | Ga0070674_1001073792 | 275 |
| 622 | 3300005366 | Ga0070659_100003416 | Ga0070659_10000341610 | 275 |
| 623 | 3300005456 | Ga0070678_100242500 | Ga0070678_1002425001 | 275 |
| 624 | 3300005530 | Ga0070679_100027204 | Ga0070679_1000272046 | 275 |
| 625 | 3300005563 | Ga0068855_100205702 | Ga0068855_1002057022 | 275 |
| 626 | 3300005564 | Ga0070664_100385085 | Ga0070664_1003850852 | 275 |
| 627 | 3300005841 | Ga0068863_100553101 | Ga0068863_1005531011 | 275 |
| 628 | 3300005844 | Ga0068862_100218395 | Ga0068862_1002183952 | 275 |
| 629 | 3300006048 | Ga0075363_100022955 | Ga0075363_1000229552 | 275 |
| 630 | 3300006051 | Ga0075364_10019243 | Ga0075364_100192432 | 275 |
| 631 | 3300006177 | Ga0075362_10011298 | Ga0075362_100112982 | 275 |
| 632 | 3300006177 | Ga0075362_10070479 | Ga0075362_100704792 | 275 |
| 633 | 3300006195 | Ga0075366_10010643 | Ga0075366_100106435 | 275 |
| 634 | 3300006195 | Ga0075366_10246065 | Ga0075366_102460652 | 275 |
| 635 | 3300006353 | Ga0075370_10001192 | Ga0075370_100011929 | 275 |
| 636 | 3300006353 | Ga0075370_10001802 | Ga0075370_100018025 | 275 |
| 637 | 3300006946 | Ga0079104_1000003 | Ga0079104_1000003167 | 275 |
| 638 | 3300009092 | Ga0105250_10006305 | Ga0105250_100063053 | 275 |
| 639 | 3300009098 | Ga0105245_10281638 | Ga0105245_102816381 | 275 |
| 640 | 3300009148 | Ga0105243_10000895 | Ga0105243_1000089521 | 275 |
| 641 | 3300009174 | Ga0105241_10049659 | Ga0105241_100496593 | 275 |
| 642 | 3300009176 | Ga0105242_10003270 | Ga0105242_100032706 | 275 |
| 643 | 3300013104 | Ga0157370_10001585 | Ga0157370_100015857 | 275 |
| 644 | 3300013297 | Ga0157378_10284520 | Ga0157378_102845201 | 275 |
| 645 | 3300014497 | Ga0182008_10005352 | Ga0182008_100053522 | 275 |
| 646 | 3300014968 | Ga0157379_10235902 | Ga0157379_102359022 | 275 |
| 647 | 3300014969 | Ga0157376_10070386 | Ga0157376_100703862 | 275 |
| 648 | 3300015262 | Ga0182007_10000761 | Ga0182007_100007616 | 275 |
| 649 | 3300015683 | Ga0183362_10001 | Ga0183362_10001306 | 275 |
| 650 | 3300017792 | Ga0163161_10000127 | Ga0163161_1000012730 | 275 |
| 651 | 3300021361 | Ga0213872_10000012 | Ga0213872_10000012146 | 275 |
| 652 | 3300025230 | Ga0209563_100013 | Ga0209563_100013642 | 275 |
| 653 | 3300025245 | Ga0207425_1006514 | Ga0207425_10065142 | 275 |
| 654 | 3300025263 | Ga0209565_1002030 | Ga0209565_10020306 | 275 |
| 655 | 3300025291 | Ga0209675_1002912 | Ga0209675_10029122 | 275 |
| 656 | 3300025294 | Ga0209025_1005103 | Ga0209025_10051035 | 275 |
| 657 | 3300025294 | Ga0209025_1033082 | Ga0209025_10330822 | 275 |
| 658 | 3300025297 | Ga0209758_1003237 | Ga0209758_10032372 | 275 |
| 659 | 3300025298 | Ga0209050_1004909 | Ga0209050_10049094 | 275 |
| 660 | 3300025711 | Ga0207696_1005757 | Ga0207696_10057572 | 275 |
| 661 | 3300025911 | Ga0207654_10043309 | Ga0207654_100433092 | 275 |
| 662 | 3300025920 | Ga0207649_10002113 | Ga0207649_1000211311 | 275 |
| 663 | 3300025927 | Ga0207687_10182831 | Ga0207687_101828312 | 275 |
| 664 | 3300025932 | Ga0207690_10001070 | Ga0207690_1000107015 | 275 |
| 665 | 3300025934 | Ga0207686_10003771 | Ga0207686_100037713 | 275 |
| 666 | 3300025935 | Ga0207709_10000032 | Ga0207709_1000003257 | 275 |
| 667 | 3300025945 | Ga0207679_10000119 | Ga0207679_1000011927 | 275 |
| 668 | 3300025945 | Ga0207679_10417696 | Ga0207679_104176961 | 275 |
| 669 | 3300026023 | Ga0207677_10006076 | Ga0207677_100060762 | 275 |
| 670 | 3300026023 | Ga0207677_10023415 | Ga0207677_100234152 | 275 |
| 671 | 3300026041 | Ga0207639_10366866 | Ga0207639_103668661 | 275 |
| 672 | 3300026088 | Ga0207641_10514052 | Ga0207641_105140522 | 275 |
| 673 | 3300026121 | Ga0207683_10044447 | Ga0207683_100444473 | 275 |
| 674 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021383 | 275 |
| 675 | 3300027614 | Ga0209970_1000301 | Ga0209970_10003014 | 275 |
| 676 | 3300027682 | Ga0209971_1002004 | Ga0209971_10020042 | 275 |
| 677 | 3300027876 | Ga0209974_10002829 | Ga0209974_100028294 | 275 |
| 678 | 3300028794 | Ga0307515_10002745 | Ga0307515_100027459 | 275 |
| 679 | 3300028794 | Ga0307515_10357348 | Ga0307515_103573482 | 275 |
| 680 | 3300030744 | Ga0316181_1225858 | Ga0316181_12258581 | 275 |
| 681 | 3300030745 | Ga0316182_1383265 | Ga0316182_13832652 | 275 |
| 682 | 3300031251 | Ga0265327_10063536 | Ga0265327_100635362 | 275 |
| 683 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004122 | 275 |
| 684 | 3300031456 | Ga0307513_10000015 | Ga0307513_10000015200 | 275 |
| 685 | 3300031548 | Ga0307408_100000438 | Ga0307408_1000004386 | 275 |
| 686 | 3300031548 | Ga0307408_100013539 | Ga0307408_1000135393 | 275 |
| 687 | 3300031730 | Ga0307516_10008369 | Ga0307516_100083696 | 275 |
| 688 | 3300031730 | Ga0307516_10384694 | Ga0307516_103846942 | 275 |
| 689 | 3300031731 | Ga0307405_10018659 | Ga0307405_100186593 | 275 |
| 690 | 3300031901 | Ga0307406_10003154 | Ga0307406_100031545 | 275 |
| 691 | 3300032005 | Ga0307411_10103341 | Ga0307411_101033412 | 275 |
| 692 | 3300038443 | Ga0395901_0052433 | Ga0395901_0052433_1056_1889 | 275 |
| 693 | 3300038443 | Ga0395901_0422809 | Ga0395901_0422809_299_1132 | 275 |
| 694 | 3300039447 | Ga0436361_0351372 | Ga0436361_0351372_172972_173805 | 275 |
| 695 | 3300041404 | Ga0439436_0018183 | Ga0439436_0018183_582_1448 | 275 |
| 696 | 3300041406 | Ga0439439_0016744 | Ga0439439_0016744_456_1298 | 275 |
| 697 | 3300041406 | Ga0439439_0018549 | Ga0439439_0018549_303_1169 | 275 |
| 698 | 3300041410 | Ga0439461_0039080 | Ga0439461_0039080_52_894 | 275 |
| 699 | 3300041411 | Ga0439466_0003623 | Ga0439466_0003623_3506_4372 | 275 |
| 700 | 3300041411 | Ga0439466_0013250 | Ga0439466_0013250_1587_2429 | 275 |
| 701 | 3300041413 | Ga0439465_0000190 | Ga0439465_0000190_7963_8829 | 275 |
| 702 | 3300041997 | Ga0439431_0002480 | Ga0439431_0002480_2883_3749 | 275 |
| 703 | 3300041999 | Ga0439433_0004698 | Ga0439433_0004698_355_1221 | 275 |
| 704 | 3300042002 | Ga0439442_003056 | Ga0439442_003056_406_1248 | 275 |
| 705 | 3300042004 | Ga0439445_0000419 | Ga0439445_0000419_7107_7973 | 275 |
| 706 | 3300042004 | Ga0439445_0011266 | Ga0439445_0011266_942_1784 | 275 |
| 707 | 3300042006 | Ga0439432_005267 | Ga0439432_005267_1844_2710 | 275 |
| 708 | 3300042006 | Ga0439432_011515 | Ga0439432_011515_1776_2618 | 275 |
| 709 | 3300042006 | Ga0439432_024928 | Ga0439432_024928_1008_1850 | 275 |
| 710 | 3300042007 | Ga0439449_0000309 | Ga0439449_0000309_9766_10632 | 275 |
| 711 | 3300042007 | Ga0439449_0001242 | Ga0439449_0001242_521_1363 | 275 |
| 712 | 3300042010 | Ga0439452_008042 | Ga0439452_008042_283_1149 | 275 |
| 713 | 3300042010 | Ga0439452_011631 | Ga0439452_011631_52_894 | 275 |
| 714 | 3300042011 | Ga0439454_010767 | Ga0439454_010767_274_1116 | 275 |
| 715 | 3300042014 | Ga0439457_002197 | Ga0439457_002197_188_1054 | 275 |
| 716 | 3300042015 | Ga0439462_0001981 | Ga0439462_0001981_3629_4471 | 275 |
| 717 | 3300042015 | Ga0439462_0007852 | Ga0439462_0007852_1468_2334 | 275 |
| 718 | 3300042115 | Ga0450911_001236 | Ga0450911_001236_1025_1867 | 275 |
| 719 | 3300042125 | Ga0450923_023196 | Ga0450923_023196_354_1196 | 275 |
| 720 | 3300042129 | Ga0450891_005902 | Ga0450891_005902_216_1058 | 275 |
| 721 | 3300042134 | Ga0450898_002139 | Ga0450898_002139_1174_2016 | 275 |
| 722 | 3300042146 | Ga0450907_012319 | Ga0450907_012319_483_1325 | 275 |
| 723 | 3300042156 | Ga0439446_0014496 | Ga0439446_0014496_1062_1928 | 275 |
| 724 | 3300042435 | Ga0439434_0009388 | Ga0439434_0009388_1623_2465 | 275 |
| 725 | 3300042437 | Ga0439444_0022321 | Ga0439444_0022321_209_1045 | 275 |
| 726 | 3300042532 | Ga0450893_0008270 | Ga0450893_0008270_774_1616 | 275 |
| 727 | 3300044673 | Ga0453683_0040675 | Ga0453683_0040675_1603_2463 | 275 |
| 728 | 3300044712 | Ga0453684_0090343 | Ga0453684_0090343_291_1151 | 275 |
| 729 | 3300044901 | Ga0466960_0008084 | Ga0466960_0008084_2459_3301 | 275 |
| 730 | 3300045051 | Ga0451576_0002054 | Ga0451576_0002054_21136_21996 | 275 |
| 731 | 3300045051 | Ga0451576_0088950 | Ga0451576_0088950_1560_2393 | 275 |
| 732 | 3300046462 | Ga0495651_0154285 | Ga0495651_0154285_62_913 | 275 |
| 733 | 3300046475 | Ga0495639_0007335 | Ga0495639_0007335_3063_3914 | 275 |
| 734 | 3300046525 | Ga0495663_0032179 | Ga0495663_0032179_232_1074 | 275 |
| 735 | 3300046529 | Ga0495652_0196884 | Ga0495652_0196884_260_1105 | 275 |
| 736 | 3300046530 | Ga0495654_0014865 | Ga0495654_0014865_817_1671 | 275 |
| 737 | 3300046557 | Ga0495622_0081763 | Ga0495622_0081763_612_1463 | 275 |
| 738 | 3300046558 | Ga0495633_0001247 | Ga0495633_0001247_9703_10545 | 275 |
| 739 | 3300046615 | Ga0495656_0001853 | Ga0495656_0001853_1517_2368 | 275 |
| 740 | 3300046674 | Ga0495588_0071422 | Ga0495588_0071422_438_1289 | 275 |
| 741 | 3300046683 | Ga0495658_0206473 | Ga0495658_0206473_156_1007 | 275 |
| 742 | 3300046691 | Ga0495670_0034111 | Ga0495670_0034111_879_1730 | 275 |
| 743 | 3300048903 | Ga0496100_0189770 | Ga0496100_0189770_463_1314 | 275 |
| 744 | 3300048904 | Ga0496101_0020434 | Ga0496101_0020434_3491_4333 | 275 |
| 745 | 3300048905 | Ga0496102_0002618 | Ga0496102_0002618_12014_12865 | 275 |
| 746 | 3300048908 | Ga0496105_0030209 | Ga0496105_0030209_2250_3101 | 275 |
| 747 | 3300048909 | Ga0496106_0274792 | Ga0496106_0274792_340_1191 | 275 |
| 748 | 3300048911 | Ga0496108_0025470 | Ga0496108_0025470_3121_3972 | 275 |
| 749 | 3300048911 | Ga0496108_0242916 | Ga0496108_0242916_139_990 | 275 |
| 750 | 3300048915 | Ga0496112_0401830 | Ga0496112_0401830_82_933 | 275 |
| 751 | 3300048916 | Ga0496113_0111509 | Ga0496113_0111509_479_1330 | 275 |
| 752 | 3300048917 | Ga0496114_0206885 | Ga0496114_0206885_310_1161 | 275 |
| 753 | 3300048919 | Ga0496116_0022753 | Ga0496116_0022753_489_1340 | 275 |
| 754 | 3300048920 | Ga0496117_0014121 | Ga0496117_0014121_2022_2873 | 275 |
| 755 | 3300048924 | Ga0496121_0178025 | Ga0496121_0178025_144_995 | 275 |
| 756 | 3300048925 | Ga0496122_0115029 | Ga0496122_0115029_51_893 | 275 |
| 757 | 3300048928 | Ga0496125_0110007 | Ga0496125_0110007_1102_1944 | 275 |
| 758 | 3300048929 | Ga0496126_0141855 | Ga0496126_0141855_1178_2020 | 275 |
| 759 | 3300049568 | Ga0501031_0001227 | Ga0501031_0001227_1003_1845 | 275 |
| 760 | 3300049573 | Ga0501037_0015776 | Ga0501037_0015776_2067_2912 | 275 |
| 761 | 3300049663 | Ga0501223_001770 | Ga0501223_001770_2117_2959 | 275 |
| 762 | 3300049679 | Ga0501249_016997 | Ga0501249_016997_684_1526 | 275 |
| 763 | 3300049763 | Ga0501266_000779 | Ga0501266_000779_679_1521 | 275 |
| 764 | 3300049823 | Ga0501044_0510063 | Ga0501044_0510063_147_1019 | 275 |
| 765 | 3300050489 | nmdc:mga03683_1093_c2 | nmdc:mga03683_1093_c2_1750_2592 | 275 |
| 766 | 3300050490 | nmdc:mga03n38_37354_c1 | nmdc:mga03n38_37354_c1_562_1404 | 275 |
| 767 | 3300050491 | nmdc:mga00v17_17446_c1 | nmdc:mga00v17_17446_c1_1785_2627 | 275 |
| 768 | 3300050493 | nmdc:mga0k408_107619_c1 | nmdc:mga0k408_107619_c1_28_870 | 275 |
| 769 | 3300050493 | nmdc:mga0k408_112728_c1 | nmdc:mga0k408_112728_c1_577_1419 | 275 |
| 770 | 3300050493 | nmdc:mga0k408_33798_c1 | nmdc:mga0k408_33798_c1_1095_1937 | 275 |
| 771 | 3300050496 | nmdc:mga07m45_28235_c1 | nmdc:mga07m45_28235_c1_985_1827 | 275 |
| 772 | 3300053093 | Ga0500651_0002431 | Ga0500651_0002431_6942_7793 | 275 |
| 773 | 3300053122 | Ga0500608_016431 | Ga0500608_016431_881_1726 | 275 |
| 774 | 3300053730 | Ga0500645_000805 | Ga0500645_000805_1545_2414 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dfj-assembly1.cif.gz_B | crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a | 0.9499 | 1 | 267 |
| 2dfj-assembly1.cif.gz_B | crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a | 0.943 | 1 | 267 |
| 2qjc-assembly1.cif.gz_A | crystal structure of a putative diadenosine tetraphosphatase | 0.8308 | 2 | 268 |
| 2qjc-assembly1.cif.gz_A | crystal structure of a putative diadenosine tetraphosphatase | 0.7712 | 2 | 268 |
| 4j6o-assembly2.cif.gz_B | crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp | 0.6764 | 2 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dfjA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9515 | 1 | 267 | 3.60.21.10 |
| 2dfjA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9446 | 1 | 267 | 3.60.21.10 |
| af_A0A0R0FVP8_67_225_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8941 | 1 | 66 | 3.60.21.10 |
| af_Q4E243_1_156_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8764 | 4 | 66 | 3.60.21.10 |
| 2qjcA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8208 | 2 | 268 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521YCH7-F1-model_v4 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) | 0.9924 | 1 | 274 |
GO:0008803
|
| AF-A0A0Q7AY02-F1-model_v4 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) | 0.9921 | 1 | 268 |
GO:0008803
|
| AF-A0A227J1T3-F1-model_v4 | Bis(5'-nucleosyl)-tetraphosphatase | 0.9921 | 6 | 101 |
GO:0005737
GO:0008803 GO:0016791 GO:0110154 |
| AF-A0A4Q5TMZ8-F1-model_v4 | deleted | 0.9914 | 2 | 269 |
|
| AF-A0A7Y5UL75-F1-model_v4 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) | 0.9908 | 1 | 275 |
GO:0008803
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar