F480234

General Info

Members Datasets Scaffolds Average Seq Length
774 454 736 276

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0007616|Ga0466969_0007616_1068_2177
Length 330
Sequence MNDLGGRRANGARSRHTQAPLIGTTRQDSATNAMRDIYAIGDLQGCQTSFEQLLARLPQDSDLWLAGDLVNRGPRSLDTLRQVIALGDRVTAVLGNHDLHLLAVAAGVRQAHGSDTIDDILNAPDRDALIDWVRHQPLAHFARGHLMVHAGVLPQWDAAQVISLAQDVQTQLRGPDWKTFLSRMFGNQPDQWQEGLGDEDRQRLTINALTRMRFCTADGRIDFKIKEGADAATEALKPWFDAPGRRTSDVTMVFGHWSALGLVMRDRLLGLDTGCVWGGKLTAVKLAETPAGRDLIQIDCPQIRDPFASADGKKRNKHKLDAPLRKGDGS

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221570 Acidovorax sp. Root568 Isolate Unclassified
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221664 Massilia sp. Root418 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2721755523 Delftia sp. HK171 Isolate Unclassified
17 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2816332133 Acidovorax radicis 2721A Isolate Unclassified
23 2831864461 Roseateles noduli HZ7 Isolate Nodule
24 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
25 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
28 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
29 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
30 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
31 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
32 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
33 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
34 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
35 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
36 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
42 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
113 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
145 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
205 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
206 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
207 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
255 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
256 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
257 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
258 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
262 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
263 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
268 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
269 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
270 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
271 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
272 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
273 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
274 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
275 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
276 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
277 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
278 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
279 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
280 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
281 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
282 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
283 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
284 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
285 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
286 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
287 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
290 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
321 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
324 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
325 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
326 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
327 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
339 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
340 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
341 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
358 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
359 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
366 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
367 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
368 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
383 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
390 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
391 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
392 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
407 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
408 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
409 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
410 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
411 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
412 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
413 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
414 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
415 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
416 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
417 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
418 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
419 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
421 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
422 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
423 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
424 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
425 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
426 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
427 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
428 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
429 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
430 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
431 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
432 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
433 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
440 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
441 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
442 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
445 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
446 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
447 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
448 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
449 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
450 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
451 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
452 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
453 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
454 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.09
Metatranscriptomes 0
Isolates 4.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.16
Nodule 1.03
Rhizoplane 2.33
Rhizosphere 67.31
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002764 3300001979 Bacteria 7850
2 JGI25155J39150_1000005 3300002704 Bacteria 261712
3 JGI25156J39149_1000006 3300002705 Bacteria 261778
4 JGI25154J39366_1000015 3300002738 Bacteria 261778
5 JGI25158J39367_1004793 3300002739 Bacteria 2014
6 JGI25158J39367_1007049 3300002739 Bacteria 1596
7 JGI25157J39369_1000016 3300002741 Bacteria 192349
8 JGI25150J39212_1003538 3300002774 Bacteria 3647
9 JGI25159J45721_1000065 3300002987 Bacteria 51403
10 JGI25159J45721_1011231 3300002987 Bacteria 2215
11 JGI25151J46595_10000614 3300003187 Bacteria 31207
12 JGI25151J46595_10000935 3300003187 Bacteria 22615
13 JGI25151J46595_10005710 3300003187 Bacteria 6384
14 JGI25151J46595_10031914 3300003187 Bacteria 2049
15 JGI25151J46595_10055061 3300003187 Bacteria 1314
16 JGI25151J46595_10057071 3300003187 Bacteria 1275
17 rootH1_10002293 3300003316 Bacteria 5018
18 rootH1_10005867 3300003316 Bacteria 7077
19 rootH2_10140946 3300003320 Bacteria 2542
20 rootL2_10005248 3300003322 Bacteria 26533
21 rootL2_10010992 3300003322 Bacteria 49384
22 rootL2_10027335 3300003322 Bacteria 1194
23 rootH1_10016719 3300003323 Bacteria 30697
24 rootH1_10037528 3300003323 Bacteria 5424
25 rootH1_10094518 3300003323 Bacteria 3692
26 rootH1_10106554 3300003323 Bacteria 2349
27 rootH1_10203174 3300003323 Bacteria 1676
28 JGI25160J50197_1000098 3300003354 Bacteria 87307
29 JGI25161J50226_1000037 3300003374 Bacteria 133331
30 Ga0055525_1000004 3300003759 Bacteria 888039
31 Ga0055529_1000127 3300003763 Bacteria 109148
32 Ga0055526_1000985 3300003771 Bacteria 20948
33 Ga0055526_1002586 3300003771 Bacteria 12095
34 Ga0055526_1005064 3300003771 Bacteria 7695
35 Ga0055526_1005110 3300003771 Bacteria 7652
36 Ga0055537_1000463 3300003773 Bacteria 25524
37 Ga0055537_1000876 3300003773 Bacteria 14379
38 Ga0055537_1001110 3300003773 Bacteria 11640
39 Ga0055524_1000196 3300003775 Bacteria 66415
40 Ga0055524_1000261 3300003775 Bacteria 53201
41 Ga0055524_1000761 3300003775 Bacteria 21714
42 Ga0055524_1004096 3300003775 Bacteria 6840
43 Ga0055524_1012988 3300003775 Bacteria 3167
44 Ga0055536_1000022 3300003781 Bacteria 198244
45 Ga0055534_1000270 3300003784 Bacteria 35440
46 Ga0055534_1000368 3300003784 Bacteria 28258
47 Ga0055534_1002591 3300003784 Bacteria 6176
48 Ga0055534_1022796 3300003784 Bacteria 1032
49 Ga0055528_1003437 3300003790 Bacteria 7948
50 Ga0055530_10000190 3300003791 Bacteria 55126
51 Ga0055530_10012241 3300003791 Bacteria 3007
52 Ga0055540_1000187 3300003792 Bacteria 59910
53 Ga0055540_1010573 3300003792 Bacteria 3060
54 Ga0055531_10000765 3300003794 Bacteria 26813
55 Ga0055531_10001838 3300003794 Bacteria 14978
56 Ga0055531_10009989 3300003794 Bacteria 4784
57 Ga0055531_10012043 3300003794 Bacteria 4105
58 Ga0055531_10041802 3300003794 Bacteria 1321
59 Ga0055543_1001040 3300004625 Bacteria 12317
60 Ga0055543_1009791 3300004625 Bacteria 2039
61 Ga0065165_1000153 3300005262 Bacteria 120209
62 Ga0065165_1000447 3300005262 Bacteria 64800
63 Ga0065165_1000816 3300005262 Bacteria 41256
64 Ga0065165_1008081 3300005262 Bacteria 5019
65 Ga0065165_1019554 3300005262 Bacteria 2411
66 Ga0065165_1048047 3300005262 Bacteria 1228
67 Ga0065714_10069965 3300005288 Bacteria 4019
68 Ga0065704_10153150 3300005289 Bacteria 1413
69 Ga0070676_10275423 3300005328 Bacteria 1132
70 Ga0070670_100039689 3300005331 Bacteria 4048
71 Ga0068869_100122717 3300005334 Bacteria 1989
72 Ga0068868_100012661 3300005338 Bacteria 6170
73 Ga0068868_100049498 3300005338 Bacteria 3298
74 Ga0070689_100061503 3300005340 Bacteria 2921
75 Ga0070691_10199715 3300005341 Bacteria 1050
76 Ga0070687_100213944 3300005343 Bacteria 1176
77 Ga0070687_100316115 3300005343 Bacteria 996
78 Ga0070661_100359613 3300005344 Bacteria 1144
79 Ga0070669_100033317 3300005353 Bacteria 3726
80 Ga0070675_100087152 3300005354 Bacteria 2611
81 Ga0070674_100107379 3300005356 Bacteria 2044
82 Ga0070659_100003416 3300005366 Bacteria 11314
83 Ga0070694_100079143 3300005444 Bacteria 2281
84 Ga0070678_100071614 3300005456 Bacteria 2595
85 Ga0070678_100234981 3300005456 Bacteria 1530
86 Ga0070678_100242500 3300005456 Bacteria 1508
87 Ga0070662_100002892 3300005457 Bacteria 10661
88 Ga0070681_10550144 3300005458 Bacteria 1068
89 Ga0068867_100000083 3300005459 Bacteria 58784
90 Ga0070706_100240587 3300005467 Bacteria 1690
91 Ga0070679_100017823 3300005530 Bacteria 6876
92 Ga0070679_100027204 3300005530 Bacteria 5626
93 Ga0070697_100184512 3300005536 Bacteria 1769
94 Ga0070672_100160174 3300005543 Bacteria 1866
95 Ga0070696_100016131 3300005546 Bacteria 5025
96 Ga0070693_100011800 3300005547 Bacteria 4407
97 Ga0068855_100205702 3300005563 Bacteria 2214
98 Ga0070664_100385085 3300005564 Bacteria 1280
99 Ga0070702_100129681 3300005615 Bacteria 1591
100 Ga0068852_100062137 3300005616 Bacteria 3248
101 Ga0068864_100075933 3300005618 Bacteria 2935
102 Ga0068861_100390626 3300005719 Bacteria 1232
103 Ga0068863_100160280 3300005841 Bacteria 2155
104 Ga0068863_100210350 3300005841 Bacteria 1873
105 Ga0068863_100553101 3300005841 Bacteria 1136
106 Ga0068858_100145889 3300005842 Bacteria 2223
107 Ga0068860_100190066 3300005843 Bacteria 1987
108 Ga0068860_100205441 3300005843 Bacteria 1910
109 Ga0068862_100218395 3300005844 Bacteria 1725
110 Ga0075365_10078840 3300006038 Bacteria 2228
111 Ga0075363_100022955 3300006048 Bacteria 3158
112 Ga0075363_100088043 3300006048 Bacteria 1706
113 Ga0075364_10019243 3300006051 Bacteria 4284
114 Ga0075364_10031006 3300006051 Bacteria 3434
115 Ga0075362_10011298 3300006177 Bacteria 3514
116 Ga0075362_10039976 3300006177 Bacteria 2063
117 Ga0075362_10070479 3300006177 Bacteria 1595
118 Ga0075362_10146250 3300006177 Bacteria 1132
119 Ga0075367_10085772 3300006178 Bacteria 1910
120 Ga0075366_10002784 3300006195 Bacteria 9050
121 Ga0075366_10010643 3300006195 Bacteria 5168
122 Ga0075366_10246065 3300006195 Bacteria 1090
123 Ga0075370_10001192 3300006353 Bacteria 10958
124 Ga0075370_10001802 3300006353 Bacteria 9581
125 Ga0075370_10197766 3300006353 Bacteria 1185
126 Ga0075431_100078600 3300006847 Bacteria 3405
127 Ga0075433_10001375 3300006852 Bacteria 17875
128 Ga0075434_100000064 3300006871 Bacteria 54394
129 Ga0075429_100073753 3300006880 Bacteria 2972
130 Ga0075436_100001875 3300006914 Bacteria 14444
131 Ga0099823_1011917 3300006944 Bacteria 8811
132 Ga0079104_1000003 3300006946 Bacteria 468966
133 Ga0099826_10000003 3300006948 Bacteria 1067817
134 Ga0075435_100001865 3300007076 Bacteria 13702
135 Ga0105250_10006305 3300009092 Bacteria 5197
136 Ga0105240_10058493 3300009093 Bacteria 4812
137 Ga0111539_10007990 3300009094 Bacteria 13496
138 Ga0111539_10108906 3300009094 Bacteria 3251
139 Ga0105245_10281638 3300009098 Bacteria 1625
140 Ga0114129_10047107 3300009147 Bacteria 6059
141 Ga0105243_10000895 3300009148 Bacteria 28043
142 Ga0105243_10026872 3300009148 Bacteria 4408
143 Ga0105241_10049659 3300009174 Bacteria 3196
144 Ga0105242_10003270 3300009176 Bacteria 12633
145 Ga0105248_10003706 3300009177 Bacteria 16936
146 Ga0105237_10000441 3300009545 Bacteria 59156
147 Ga0105238_10024678 3300009551 Bacteria 6129
148 Ga0105238_10191736 3300009551 Bacteria 2020
149 Ga0105238_10938854 3300009551 Unclassified 884
150 Ga0105249_10142651 3300009553 Bacteria 2298
151 Ga0105239_10000417 3300010375 Bacteria 62040
152 Ga0157319_1000016 3300012497 Bacteria 127256
153 Ga0157370_10001585 3300013104 Bacteria 28149
154 Ga0157378_10284520 3300013297 Bacteria 1595
155 Ga0163162_10602926 3300013306 Bacteria 1224
156 Ga0182008_10005352 3300014497 Bacteria 7328
157 Ga0157377_10000104 3300014745 Bacteria 58794
158 Ga0157379_10030130 3300014968 Bacteria 4827
159 Ga0157379_10235902 3300014968 Bacteria 1659
160 Ga0157376_10070386 3300014969 Bacteria 2969
161 Ga0182007_10000761 3300015262 Bacteria 18052
162 Ga0182007_10055158 3300015262 Bacteria 1307
163 Ga0183362_10001 3300015683 Bacteria 2046624
164 Ga0163161_10000127 3300017792 Bacteria 71051
165 Ga0163161_10018567 3300017792 Bacteria 4873
166 Ga0163161_10034424 3300017792 Bacteria 3624
167 Ga0213872_10000004 3300021361 Bacteria 306230
168 Ga0213872_10000012 3300021361 Bacteria 191291
169 Ga0213872_10000077 3300021361 Bacteria 90250
170 Ga0213872_10000324 3300021361 Bacteria 40551
171 Ga0213872_10001319 3300021361 Bacteria 16438
172 Ga0213872_10002068 3300021361 Bacteria 12145
173 Ga0209435_100010 3300025206 Bacteria 475373
174 Ga0209436_103957 3300025208 Bacteria 3764
175 Ga0209563_100013 3300025230 Bacteria 941463
176 Ga0207425_1006514 3300025245 Bacteria 3185
177 Ga0209646_1000001 3300025246 Bacteria 3092932
178 Ga0209026_1000001 3300025250 Bacteria 1228671
179 Ga0209759_1000001 3300025256 Bacteria 2799452
180 Ga0209129_1011907 3300025258 Bacteria 2042
181 Ga0209565_1000102 3300025263 Bacteria 127545
182 Ga0209565_1000411 3300025263 Bacteria 35316
183 Ga0209565_1000966 3300025263 Bacteria 14968
184 Ga0209565_1002030 3300025263 Bacteria 7799
185 Ga0209673_1000189 3300025273 Bacteria 123470
186 Ga0209673_1008368 3300025273 Bacteria 4611
187 Ga0209673_1010389 3300025273 Bacteria 3927
188 Ga0209130_1000141 3300025284 Bacteria 115378
189 Ga0209130_1000423 3300025284 Bacteria 45537
190 Ga0209130_1000951 3300025284 Bacteria 22947
191 Ga0209675_1000070 3300025291 Bacteria 169161
192 Ga0209675_1000288 3300025291 Bacteria 47740
193 Ga0209675_1000383 3300025291 Bacteria 36811
194 Ga0209675_1000389 3300025291 Bacteria 36614
195 Ga0209675_1002912 3300025291 Bacteria 8476
196 Ga0209675_1009066 3300025291 Bacteria 3559
197 Ga0209676_1000012 3300025292 Bacteria 841431
198 Ga0209676_1000069 3300025292 Bacteria 312462
199 Ga0209676_1029305 3300025292 Bacteria 1701
200 Ga0209025_1000124 3300025294 Bacteria 201973
201 Ga0209025_1001088 3300025294 Bacteria 39306
202 Ga0209025_1001306 3300025294 Bacteria 34010
203 Ga0209025_1002311 3300025294 Bacteria 20651
204 Ga0209025_1003168 3300025294 Bacteria 16001
205 Ga0209025_1005103 3300025294 Bacteria 10918
206 Ga0209025_1033082 3300025294 Bacteria 2399
207 Ga0209564_1000008 3300025295 Bacteria 953227
208 Ga0209564_1000350 3300025295 Bacteria 86762
209 Ga0209564_1000380 3300025295 Bacteria 81287
210 Ga0209564_1000415 3300025295 Bacteria 75119
211 Ga0209564_1000497 3300025295 Bacteria 64942
212 Ga0209564_1001117 3300025295 Bacteria 31602
213 Ga0209564_1008921 3300025295 Bacteria 4864
214 Ga0209564_1011606 3300025295 Bacteria 3929
215 Ga0209758_1003237 3300025297 Bacteria 15125
216 Ga0209758_1040734 3300025297 Bacteria 1748
217 Ga0209050_1000023 3300025298 Bacteria 537172
218 Ga0209050_1002239 3300025298 Bacteria 17258
219 Ga0209050_1002352 3300025298 Bacteria 16517
220 Ga0209050_1004909 3300025298 Bacteria 8742
221 Ga0209050_1010655 3300025298 Bacteria 4492
222 Ga0209256_1000003 3300025299 Bacteria 1661127
223 Ga0209256_1000059 3300025299 Bacteria 272170
224 Ga0209256_1000496 3300025299 Bacteria 57666
225 Ga0209256_1000842 3300025299 Bacteria 38479
226 Ga0209256_1002703 3300025299 Bacteria 13836
227 Ga0207426_1000145 3300025302 Bacteria 191065
228 Ga0207426_1004246 3300025302 Bacteria 7111
229 Ga0209051_1000017 3300025303 Bacteria 537172
230 Ga0209051_1000639 3300025303 Bacteria 40255
231 Ga0209051_1000928 3300025303 Bacteria 29063
232 Ga0209051_1003952 3300025303 Bacteria 9439
233 Ga0209051_1013653 3300025303 Bacteria 3848
234 Ga0209257_1000041 3300025304 Bacteria 537172
235 Ga0209257_1000096 3300025304 Bacteria 259390
236 Ga0209257_1003877 3300025304 Bacteria 12209
237 Ga0209257_1004170 3300025304 Bacteria 11478
238 Ga0207696_1005757 3300025711 Bacteria 5092
239 Ga0207645_10271834 3300025907 Bacteria 1124
240 Ga0207684_10199097 3300025910 Bacteria 1728
241 Ga0207654_10043309 3300025911 Bacteria 2551
242 Ga0207695_10004036 3300025913 Bacteria 20195
243 Ga0207671_10007150 3300025914 Bacteria 9741
244 Ga0207649_10002113 3300025920 Bacteria 11254
245 Ga0207652_10085609 3300025921 Bacteria 2762
246 Ga0207681_10030861 3300025923 Bacteria 3497
247 Ga0207694_10017517 3300025924 Bacteria 5415
248 Ga0207687_10182831 3300025927 Bacteria 1625
249 Ga0207690_10001070 3300025932 Bacteria 17526
250 Ga0207706_10000544 3300025933 Bacteria 39990
251 Ga0207686_10003771 3300025934 Bacteria 8132
252 Ga0207709_10000032 3300025935 Bacteria 324478
253 Ga0207709_10015374 3300025935 Bacteria 4242
254 Ga0207670_10109996 3300025936 Bacteria 1984
255 Ga0207670_10143830 3300025936 Bacteria 1761
256 Ga0207691_10075959 3300025940 Bacteria 3028
257 Ga0207711_10016794 3300025941 Bacteria 6079
258 Ga0207679_10000119 3300025945 Bacteria 63967
259 Ga0207679_10417696 3300025945 Bacteria 1183
260 Ga0207667_10413258 3300025949 Bacteria 1373
261 Ga0207651_10038244 3300025960 Bacteria 3152
262 Ga0207668_10294510 3300025972 Bacteria 1337
263 Ga0207677_10006076 3300026023 Bacteria 6589
264 Ga0207677_10023415 3300026023 Bacteria 3815
265 Ga0207677_10322122 3300026023 Bacteria 1285
266 Ga0207639_10144109 3300026041 Bacteria 1988
267 Ga0207639_10366866 3300026041 Bacteria 1290
268 Ga0207702_10168555 3300026078 Bacteria 2006
269 Ga0207641_10151766 3300026088 Bacteria 2099
270 Ga0207641_10282398 3300026088 Bacteria 1562
271 Ga0207641_10514052 3300026088 Bacteria 1164
272 Ga0207648_10000243 3300026089 Bacteria 58746
273 Ga0207648_10784171 3300026089 Bacteria 886
274 Ga0207676_10026632 3300026095 Bacteria 4300
275 Ga0207676_10050322 3300026095 Bacteria 3248
276 Ga0207675_100059637 3300026118 Bacteria 3561
277 Ga0207675_100529971 3300026118 Bacteria 1175
278 Ga0207683_10044447 3300026121 Bacteria 3883
279 Ga0207683_10070600 3300026121 Bacteria 3086
280 Ga0207698_10032373 3300026142 Bacteria 3787
281 Ga0207698_10696665 3300026142 Bacteria 1010
282 Ga0209281_1000002 3300027111 Bacteria 1924012
283 Ga0209371_1029846 3300027312 Bacteria 1200
284 Ga0209970_1000301 3300027614 Bacteria 8157
285 Ga0209282_1000064 3300027666 Bacteria 91973
286 Ga0209971_1002004 3300027682 Bacteria 4953
287 Ga0209813_10024948 3300027866 Bacteria 1715
288 Ga0209974_10002829 3300027876 Bacteria 6302
289 Ga0207428_10014008 3300027907 Bacteria 6984
290 Ga0268265_10659008 3300028380 Bacteria 1007
291 Ga0268264_10169873 3300028381 Bacteria 1971
292 Ga0307515_10002745 3300028794 Bacteria 37653
293 Ga0307515_10006997 3300028794 Bacteria 22401
294 Ga0307515_10014617 3300028794 Bacteria 14532
295 Ga0307515_10017471 3300028794 Bacteria 13059
296 Ga0307515_10067591 3300028794 Bacteria 4926
297 Ga0307515_10357348 3300028794 Bacteria 1104
298 Ga0307515_10428656 3300028794 Bacteria 941
299 Ga0268256_1030016 3300030500 Bacteria 1323
300 Ga0307512_10042866 3300030522 Bacteria 3741
301 Ga0316181_1225858 3300030744 Bacteria 1474
302 Ga0316182_1383265 3300030745 Bacteria 2027
303 Ga0265332_10010386 3300031238 Bacteria 4144
304 Ga0265328_10017791 3300031239 Bacteria 2750
305 Ga0265329_10009325 3300031242 Bacteria 3667
306 Ga0265327_10000235 3300031251 Bacteria 111362
307 Ga0265327_10063536 3300031251 Bacteria 1874
308 Ga0265316_10153241 3300031344 Bacteria 1726
309 Ga0307513_10000004 3300031456 Bacteria 558931
310 Ga0307513_10000015 3300031456 Bacteria 296183
311 Ga0307513_10007087 3300031456 Bacteria 14577
312 Ga0307513_10099934 3300031456 Bacteria 2928
313 Ga0307509_10125778 3300031507 Bacteria 2530
314 Ga0307509_10140135 3300031507 Bacteria 2355
315 Ga0307408_100000165 3300031548 Bacteria 73853
316 Ga0307408_100000438 3300031548 Bacteria 36836
317 Ga0307408_100001378 3300031548 Bacteria 18115
318 Ga0307408_100001760 3300031548 Bacteria 15807
319 Ga0307408_100013147 3300031548 Bacteria 5493
320 Ga0307408_100013539 3300031548 Bacteria 5414
321 Ga0307408_100014599 3300031548 Bacteria 5219
322 Ga0307408_100026194 3300031548 Bacteria 4002
323 Ga0307408_100508273 3300031548 Bacteria 1056
324 Ga0307514_10001054 3300031649 Bacteria 39555
325 Ga0265314_10000727 3300031711 Bacteria 39795
326 Ga0265314_10057988 3300031711 Bacteria 2655
327 Ga0307516_10008369 3300031730 Bacteria 11721
328 Ga0307516_10384694 3300031730 Bacteria 1064
329 Ga0307405_10018659 3300031731 Bacteria 3832
330 Ga0307405_10179141 3300031731 Bacteria 1520
331 Ga0307406_10003154 3300031901 Bacteria 8971
332 Ga0307406_10014450 3300031901 Bacteria 4544
333 Ga0307416_100007980 3300032002 Bacteria 6780
334 Ga0307414_10074486 3300032004 Bacteria 2460
335 Ga0307411_10001640 3300032005 Bacteria 9332
336 Ga0307411_10103341 3300032005 Bacteria 2021
337 Ga0307415_100101370 3300032126 Bacteria 2113
338 Ga0373950_0009468 3300034818 Bacteria 1557
339 Ga0373934_0000209 3300035086 Bacteria 21432
340 Ga0373934_0009596 3300035086 Bacteria 3628
341 Ga0373940_0011326 3300035088 Bacteria 2116
342 Ga0373944_0063361 3300035089 Bacteria 1190
343 Ga0373951_0009094 3300035091 Bacteria 2240
344 Ga0373923_0052788 3300035111 Bacteria 1708
345 Ga0373923_0056415 3300035111 Bacteria 1658
346 Ga0373923_0215049 3300035111 Bacteria 892
347 Ga0373936_0068977 3300035113 Bacteria 1454
348 Ga0373939_0000372 3300035114 Bacteria 11306
349 Ga0373953_0021321 3300035117 Bacteria 2429
350 Ga0373953_0077125 3300035117 Bacteria 1381
351 Ga0373954_0033657 3300035118 Bacteria 2371
352 Ga0373956_0000006 3300035119 Bacteria 65782
353 Ga0373956_0007077 3300035119 Bacteria 4513
354 Ga0373957_0002256 3300035120 Bacteria 5462
355 Ga0373943_0006998 3300035170 Bacteria 5059
356 Ga0373946_0032277 3300035171 Bacteria 2102
357 Ga0373955_0011044 3300035172 Bacteria 4289
358 Ga0373962_0008728 3300035242 Bacteria 2500
359 Ga0373931_0002459 3300035691 Bacteria 8205
360 Ga0373931_0008442 3300035691 Bacteria 4886
361 Ga0373931_0391223 3300035691 Bacteria 878
362 Ga0373935_0045106 3300035692 Bacteria 2780
363 Ga0373927_0064882 3300035695 Bacteria 2362
364 Ga0373933_0000217 3300035724 Bacteria 37933
365 Ga0373933_0281000 3300035724 Bacteria 1075
366 Ga0373947_0014945 3300035725 Bacteria 4455
367 Ga0373937_0000205 3300036401 Bacteria 57080
368 Ga0373937_0011507 3300036401 Bacteria 7767
369 Ga0373937_0040011 3300036401 Bacteria 4273
370 Ga0373937_0102769 3300036401 Bacteria 2653
371 Ga0373937_0215819 3300036401 Bacteria 1805
372 Ga0373925_0022510 3300037068 Bacteria 4597
373 Ga0373925_0053081 3300037068 Bacteria 3029
374 Ga0395899_0001005 3300037312 Bacteria 25863
375 Ga0395899_0022001 3300037312 Bacteria 4835
376 Ga0395899_0043120 3300037312 Bacteria 3366
377 Ga0395899_0304823 3300037312 Bacteria 1077
378 Ga0395900_0006176 3300037418 Bacteria 12511
379 Ga0395900_0010004 3300037418 Bacteria 9704
380 Ga0395900_0122716 3300037418 Bacteria 2665
381 Ga0395900_0233878 3300037418 Bacteria 1847
382 Ga0395900_0312814 3300037418 Bacteria 1553
383 Ga0395898_0007548 3300037466 Bacteria 11551
384 Ga0395898_0039793 3300037466 Bacteria 4651
385 Ga0395898_0043895 3300037466 Bacteria 4404
386 Ga0395905_0000033 3300037471 Bacteria 279363
387 Ga0395905_0003696 3300037471 Bacteria 16194
388 Ga0395905_0004869 3300037471 Bacteria 13838
389 Ga0395905_0009619 3300037471 Bacteria 9439
390 Ga0395905_0011819 3300037471 Bacteria 8428
391 Ga0395905_0029892 3300037471 Bacteria 5135
392 Ga0395905_0107034 3300037471 Bacteria 2625
393 Ga0395905_0136766 3300037471 Bacteria 2305
394 Ga0395905_0276984 3300037471 Bacteria 1563
395 Ga0395905_0282630 3300037471 Bacteria 1545
396 Ga0395901_0007041 3300038443 Bacteria 11368
397 Ga0395901_0052433 3300038443 Bacteria 4240
398 Ga0395901_0063115 3300038443 Bacteria 3855
399 Ga0395901_0074942 3300038443 Bacteria 3530
400 Ga0395901_0089265 3300038443 Bacteria 3225
401 Ga0395901_0422809 3300038443 Bacteria 1366
402 Ga0395901_0666224 3300038443 Bacteria 1042
403 Ga0395901_0751387 3300038443 Bacteria 968
404 Ga0436361_0148311 3300039447 Bacteria 30874
405 Ga0436361_0261085 3300039447 Bacteria 1637
406 Ga0436361_0287447 3300039447 Bacteria 113524
407 Ga0436361_0351372 3300039447 Bacteria 183069
408 Ga0436361_0656823 3300039447 Bacteria 15445
409 Ga0436361_1007413 3300039447 Bacteria 98457
410 Ga0436361_1146112 3300039447 Bacteria 18201
411 Ga0439436_0005686 3300041404 Bacteria 3821
412 Ga0439436_0018183 3300041404 Bacteria 2101
413 Ga0439439_0016744 3300041406 Bacteria 1797
414 Ga0439439_0018549 3300041406 Bacteria 1720
415 Ga0439461_0039080 3300041410 Bacteria 1019
416 Ga0439466_0003623 3300041411 Bacteria 5967
417 Ga0439466_0013250 3300041411 Bacteria 3020
418 Ga0439465_0000190 3300041413 Bacteria 15993
419 Ga0451807_1484103 3300041486 Bacteria 2321
420 Ga0439431_0002480 3300041997 Bacteria 4086
421 Ga0439433_0004698 3300041999 Bacteria 2935
422 Ga0439442_003056 3300042002 Bacteria 3309
423 Ga0439443_015061 3300042003 Bacteria 1170
424 Ga0439445_0000419 3300042004 Bacteria 8533
425 Ga0439445_0011266 3300042004 Bacteria 2130
426 Ga0439432_005267 3300042006 Bacteria 4667
427 Ga0439432_011515 3300042006 Bacteria 3048
428 Ga0439432_024928 3300042006 Bacteria 1964
429 Ga0439449_0000309 3300042007 Bacteria 17583
430 Ga0439449_0001242 3300042007 Bacteria 9991
431 Ga0439449_0013392 3300042007 Bacteria 3086
432 Ga0439449_0030592 3300042007 Bacteria 2007
433 Ga0439452_008042 3300042010 Bacteria 3192
434 Ga0439452_011631 3300042010 Bacteria 2522
435 Ga0439454_010767 3300042011 Bacteria 1211
436 Ga0439457_002197 3300042014 Bacteria 5642
437 Ga0439462_0001981 3300042015 Bacteria 4686
438 Ga0439462_0007852 3300042015 Bacteria 2678
439 Ga0439462_0036135 3300042015 Bacteria 1315
440 Ga0439462_0060123 3300042015 Bacteria 1028
441 Ga0439462_0100480 3300042015 Bacteria 797
442 Ga0450911_001236 3300042115 Bacteria 6171
443 Ga0450912_000333 3300042116 Bacteria 2195
444 Ga0450917_001070 3300042120 Bacteria 2010
445 Ga0450923_023196 3300042125 Bacteria 1222
446 Ga0450888_000661 3300042126 Bacteria 3291
447 Ga0450890_000366 3300042127 Bacteria 6606
448 Ga0450890_001507 3300042127 Bacteria 3351
449 Ga0450891_002200 3300042129 Bacteria 1975
450 Ga0450891_005902 3300042129 Bacteria 1129
451 Ga0450892_000411 3300042130 Bacteria 5076
452 Ga0450894_006833 3300042131 Bacteria 1471
453 Ga0450898_001687 3300042134 Bacteria 2965
454 Ga0450898_002139 3300042134 Bacteria 2731
455 Ga0450889_004348 3300042144 Bacteria 1400
456 Ga0450907_012319 3300042146 Bacteria 1422
457 Ga0439446_0014496 3300042156 Bacteria 2176
458 Ga0439446_0017366 3300042156 Bacteria 2011
459 Ga0439446_0048456 3300042156 Bacteria 1265
460 Ga0439434_0009388 3300042435 Bacteria 2875
461 Ga0439444_0022321 3300042437 Bacteria 1127
462 Ga0439459_0016257 3300042438 Bacteria 1374
463 Ga0450893_0000278 3300042532 Bacteria 6986
464 Ga0450893_0002086 3300042532 Bacteria 3113
465 Ga0450893_0008270 3300042532 Bacteria 1693
466 Ga0450893_0032503 3300042532 Bacteria 934
467 Ga0451577_0000804 3300042876 Bacteria 47207
468 Ga0451577_0005101 3300042876 Bacteria 13537
469 Ga0451577_0427264 3300042876 Bacteria 1203
470 Ga0466969_0007616 3300044656 Bacteria 5756
471 Ga0466977_0080483 3300044666 Bacteria 2144
472 Ga0453683_0003001 3300044673 Bacteria 12644
473 Ga0453683_0040675 3300044673 Bacteria 2918
474 Ga0466965_0005539 3300044683 Bacteria 5694
475 Ga0466966_0019549 3300044684 Bacteria 4456
476 Ga0466961_0006490 3300044693 Bacteria 7432
477 Ga0466961_0026365 3300044693 Bacteria 3736
478 Ga0453684_0005076 3300044712 Bacteria 26598
479 Ga0453684_0018360 3300044712 Bacteria 10740
480 Ga0453684_0090343 3300044712 Bacteria 3784
481 Ga0453684_0151298 3300044712 Bacteria 2757
482 Ga0466971_0148433 3300044719 Bacteria 1094
483 Ga0466957_0012321 3300044842 Bacteria 4950
484 Ga0466960_0008084 3300044901 Bacteria 4298
485 Ga0466959_0119767 3300045049 Bacteria 1872
486 Ga0451576_0002054 3300045051 Bacteria 31662
487 Ga0451576_0088950 3300045051 Bacteria 3212
488 Ga0451576_0222642 3300045051 Bacteria 1970
489 Ga0451576_0266409 3300045051 Bacteria 1791
490 Ga0451576_0592110 3300045051 Bacteria 1165
491 Ga0495592_0003264 3300046454 Bacteria 11625
492 Ga0495592_0004682 3300046454 Bacteria 10028
493 Ga0495592_0043081 3300046454 Bacteria 3378
494 Ga0495603_0065011 3300046455 Bacteria 2150
495 Ga0495590_0000035 3300046457 Bacteria 129481
496 Ga0495590_0004799 3300046457 Bacteria 5418
497 Ga0495638_0000023 3300046460 Bacteria 363063
498 Ga0495638_0005781 3300046460 Bacteria 9109
499 Ga0495641_0030263 3300046461 Bacteria 2599
500 Ga0495651_0004810 3300046462 Bacteria 10338
501 Ga0495651_0006269 3300046462 Bacteria 9097
502 Ga0495651_0113774 3300046462 Bacteria 1997
503 Ga0495651_0154285 3300046462 Bacteria 1652
504 Ga0495650_0013618 3300046471 Bacteria 4289
505 Ga0495580_0077939 3300046472 Bacteria 2311
506 Ga0495605_0019545 3300046474 Bacteria 3615
507 Ga0495639_0003685 3300046475 Bacteria 6596
508 Ga0495639_0007335 3300046475 Bacteria 4732
509 Ga0495639_0026028 3300046475 Bacteria 2583
510 Ga0495662_0057802 3300046476 Bacteria 1873
511 Ga0495662_0066898 3300046476 Bacteria 1738
512 Ga0495584_0005884 3300046491 Bacteria 6463
513 Ga0495584_0046290 3300046491 Bacteria 2194
514 Ga0495585_0046182 3300046492 Bacteria 2429
515 Ga0495607_0001625 3300046501 Bacteria 19476
516 Ga0495607_0038555 3300046501 Bacteria 2861
517 Ga0495583_0000004 3300046506 Bacteria 655287
518 Ga0495583_0000257 3300046506 Bacteria 87964
519 Ga0495583_0001806 3300046506 Bacteria 20194
520 Ga0495606_0001324 3300046507 Bacteria 33820
521 Ga0495606_0002149 3300046507 Bacteria 23757
522 Ga0495608_0011002 3300046511 Bacteria 6306
523 Ga0495608_0026023 3300046511 Bacteria 3992
524 Ga0495610_0000430 3300046512 Bacteria 43081
525 Ga0495616_0002745 3300046513 Bacteria 11527
526 Ga0495616_0004849 3300046513 Bacteria 8424
527 Ga0495616_0023343 3300046513 Bacteria 3328
528 Ga0495618_0038839 3300046514 Bacteria 2992
529 Ga0495618_0042318 3300046514 Bacteria 2871
530 Ga0495628_0004940 3300046516 Bacteria 11726
531 Ga0495628_0005051 3300046516 Bacteria 11598
532 Ga0495628_0013204 3300046516 Bacteria 6945
533 Ga0495628_0051387 3300046516 Bacteria 3259
534 Ga0495630_0018101 3300046517 Bacteria 5171
535 Ga0495630_0101432 3300046517 Bacteria 2177
536 Ga0495632_0020100 3300046519 Bacteria 3624
537 Ga0495643_0001307 3300046522 Bacteria 23666
538 Ga0495644_0000870 3300046523 Bacteria 12493
539 Ga0495644_0000884 3300046523 Bacteria 12417
540 Ga0495648_0000025 3300046524 Bacteria 233415
541 Ga0495648_0019950 3300046524 Bacteria 4691
542 Ga0495648_0042317 3300046524 Bacteria 2867
543 Ga0495663_0032179 3300046525 Bacteria 1561
544 Ga0495666_0007394 3300046526 Bacteria 5504
545 Ga0495642_0003530 3300046528 Bacteria 6163
546 Ga0495642_0054242 3300046528 Bacteria 1653
547 Ga0495652_0035079 3300046529 Bacteria 4367
548 Ga0495652_0042675 3300046529 Bacteria 3910
549 Ga0495652_0085482 3300046529 Bacteria 2592
550 Ga0495652_0196884 3300046529 Bacteria 1533
551 Ga0495654_0014865 3300046530 Bacteria 4136
552 Ga0495665_0177201 3300046531 Bacteria 1108
553 Ga0495640_0005312 3300046533 Bacteria 10234
554 Ga0495640_0011753 3300046533 Bacteria 6719
555 Ga0495640_0151970 3300046533 Bacteria 1487
556 Ga0495586_0005086 3300046535 Bacteria 7039
557 Ga0495598_0007405 3300046537 Bacteria 2518
558 Ga0495609_0000598 3300046538 Bacteria 28270
559 Ga0495621_0007614 3300046539 Bacteria 3213
560 Ga0495597_0000361 3300046542 Bacteria 40182
561 Ga0495597_0001192 3300046542 Bacteria 19460
562 Ga0495597_0146436 3300046542 Bacteria 971
563 Ga0495645_0000371 3300046543 Bacteria 31266
564 Ga0495622_0000063 3300046557 Bacteria 95713
565 Ga0495622_0028525 3300046557 Bacteria 2607
566 Ga0495622_0038510 3300046557 Bacteria 2226
567 Ga0495622_0081763 3300046557 Bacteria 1486
568 Ga0495633_0001247 3300046558 Bacteria 20309
569 Ga0495633_0001345 3300046558 Bacteria 19254
570 Ga0495633_0001396 3300046558 Bacteria 18832
571 Ga0495633_0013127 3300046558 Bacteria 4378
572 Ga0495633_0014941 3300046558 Bacteria 4036
573 Ga0495667_0015056 3300046559 Bacteria 5221
574 Ga0495667_0103187 3300046559 Bacteria 1844
575 Ga0495656_0001853 3300046615 Bacteria 6965
576 Ga0495656_0004696 3300046615 Bacteria 4693
577 Ga0495656_0006569 3300046615 Bacteria 4086
578 Ga0495656_0087875 3300046615 Bacteria 1416
579 Ga0495668_0000049 3300046616 Bacteria 217657
580 Ga0495668_0002152 3300046616 Bacteria 16914
581 Ga0495634_0025729 3300046642 Bacteria 4110
582 Ga0495611_0011224 3300046648 Bacteria 3797
583 Ga0495625_0000123 3300046660 Bacteria 120958
584 Ga0495625_0004092 3300046660 Bacteria 13926
585 Ga0495625_0010574 3300046660 Bacteria 7620
586 Ga0495635_0004893 3300046663 Bacteria 9323
587 Ga0495635_0027192 3300046663 Bacteria 3980
588 Ga0495661_0215461 3300046665 Bacteria 997
589 Ga0495588_0071422 3300046674 Bacteria 1805
590 Ga0495657_0057559 3300046675 Bacteria 2584
591 Ga0495657_0075462 3300046675 Bacteria 2192
592 Ga0495599_0003472 3300046678 Bacteria 9227
593 Ga0495599_0022294 3300046678 Bacteria 3953
594 Ga0495647_0003126 3300046681 Bacteria 5295
595 Ga0495658_0010064 3300046683 Bacteria 4723
596 Ga0495658_0021639 3300046683 Bacteria 3392
597 Ga0495658_0206473 3300046683 Bacteria 1226
598 Ga0495613_0053854 3300046689 Bacteria 2959
599 Ga0495624_0110685 3300046690 Bacteria 1689
600 Ga0495670_0034111 3300046691 Bacteria 2534
601 Ga0495670_0048446 3300046691 Bacteria 2126
602 Ga0495671_0009268 3300046692 Bacteria 5502
603 Ga0495671_0015519 3300046692 Bacteria 4080
604 Ga0495600_0000613 3300046809 Bacteria 18436
605 Ga0495600_0063564 3300046809 Bacteria 2412
606 Ga0495600_0351015 3300046809 Bacteria 924
607 Ga0495604_0005868 3300047317 Bacteria 9737
608 Ga0495604_0020921 3300047317 Bacteria 5221
609 Ga0495604_0043060 3300047317 Bacteria 3536
610 Ga0495636_0000628 3300047318 Bacteria 12926
611 Ga0495636_0005854 3300047318 Bacteria 4823
612 Ga0495636_0043143 3300047318 Bacteria 1876
613 Ga0495636_0103100 3300047318 Bacteria 1249
614 Ga0495674_0007872 3300047319 Bacteria 10177
615 Ga0495672_0045832 3300047320 Bacteria 2613
616 Ga0495680_0001187 3300047322 Bacteria 28585
617 Ga0495680_0008833 3300047322 Bacteria 9118
618 Ga0495683_0005503 3300047323 Bacteria 7020
619 Ga0495687_000621 3300047443 Bacteria 41089
620 Ga0495685_000005 3300047447 Bacteria 112142
621 Ga0495685_010046 3300047447 Bacteria 3170
622 Ga0495673_0019557 3300047469 Bacteria 3390
623 Ga0495684_0059651 3300047471 Bacteria 2905
624 Ga0496100_0189770 3300048903 Bacteria 1491
625 Ga0496101_0020434 3300048904 Bacteria 4533
626 Ga0496102_0000425 3300048905 Bacteria 48803
627 Ga0496102_0002618 3300048905 Bacteria 15298
628 Ga0496103_0002424 3300048906 Bacteria 11733
629 Ga0496104_0077219 3300048907 Bacteria 3173
630 Ga0496105_0030209 3300048908 Bacteria 4440
631 Ga0496105_0190863 3300048908 Bacteria 1675
632 Ga0496106_0274792 3300048909 Bacteria 1349
633 Ga0496108_0025470 3300048911 Bacteria 4876
634 Ga0496108_0242916 3300048911 Bacteria 1566
635 Ga0496109_0279544 3300048912 Bacteria 1573
636 Ga0496112_0020391 3300048915 Bacteria 6283
637 Ga0496112_0401830 3300048915 Bacteria 1310
638 Ga0496113_0025739 3300048916 Bacteria 4199
639 Ga0496113_0111509 3300048916 Bacteria 2130
640 Ga0496114_0206885 3300048917 Bacteria 1720
641 Ga0496116_0011775 3300048919 Bacteria 7202
642 Ga0496116_0022753 3300048919 Bacteria 4687
643 Ga0496117_0014121 3300048920 Bacteria 6905
644 Ga0496121_0178025 3300048924 Bacteria 1538
645 Ga0496122_0115029 3300048925 Bacteria 1754
646 Ga0496124_0013398 3300048927 Bacteria 8004
647 Ga0496125_0110007 3300048928 Bacteria 1999
648 Ga0496125_0276206 3300048928 Bacteria 1044
649 Ga0496126_0141855 3300048929 Bacteria 2067
650 Ga0496126_0304010 3300048929 Bacteria 1315
651 Ga0495678_000839 3300049459 Bacteria 27444
652 Ga0495678_010318 3300049459 Bacteria 4548
653 Ga0495682_0008320 3300049460 Bacteria 4091
654 Ga0501299_030210 3300049522 Unclassified 1042
655 Ga0501031_0001227 3300049568 Bacteria 15705
656 Ga0501032_0274135 3300049569 Bacteria 1093
657 Ga0501034_0035730 3300049571 Bacteria 5037
658 Ga0501036_0132543 3300049572 Bacteria 2103
659 Ga0501036_0256120 3300049572 Bacteria 1466
660 Ga0501037_0015776 3300049573 Bacteria 5559
661 Ga0501037_0128649 3300049573 Bacteria 1817
662 Ga0501037_0165878 3300049573 Bacteria 1573
663 Ga0501038_0050608 3300049574 Bacteria 3589
664 Ga0501039_0095417 3300049575 Bacteria 2319
665 Ga0501040_0163007 3300049576 Bacteria 1576
666 Ga0501042_0101307 3300049578 Bacteria 2071
667 Ga0501047_0476411 3300049581 Bacteria 1076
668 Ga0501048_0057851 3300049582 Bacteria 2749
669 Ga0501068_0046749 3300049584 Bacteria 2610
670 Ga0501075_0067126 3300049591 Bacteria 2708
671 Ga0501076_0131964 3300049592 Bacteria 2026
672 Ga0501202_001322 3300049652 Bacteria 3938
673 Ga0501222_000006 3300049662 Bacteria 129030
674 Ga0501223_001770 3300049663 Bacteria 4898
675 Ga0501235_019614 3300049669 Bacteria 1500
676 Ga0501249_016997 3300049679 Bacteria 1565
677 Ga0501221_002212 3300049704 Bacteria 3231
678 Ga0501225_0047697 3300049705 Bacteria 1189
679 Ga0501229_000401 3300049706 Bacteria 4845
680 Ga0501080_0059758 3300049742 Bacteria 3547
681 Ga0501080_0167824 3300049742 Bacteria 2025
682 Ga0501232_002702 3300049757 Bacteria 1563
683 Ga0501266_000779 3300049763 Bacteria 4121
684 Ga0501280_000798 3300049776 Bacteria 6838
685 Ga0501282_000988 3300049778 Bacteria 3222
686 Ga0501044_0129700 3300049823 Bacteria 2516
687 Ga0501044_0510063 3300049823 Bacteria 1103
688 Ga0501045_0332631 3300049824 Bacteria 1130
689 nmdc:mga03683_1093_c2 3300050489 Bacteria 3796
690 nmdc:mga03n38_37354_c1 3300050490 Bacteria 2094
691 nmdc:mga00v17_145916_c1 3300050491 Bacteria 1519
692 nmdc:mga00v17_17446_c1 3300050491 Bacteria 4065
693 nmdc:mga0yw44_109692_c1 3300050492 Bacteria 1767
694 nmdc:mga0yw44_163541_c1 3300050492 Bacteria 1458
695 nmdc:mga0k408_107619_c1 3300050493 Bacteria 1647
696 nmdc:mga0k408_112728_c1 3300050493 Bacteria 1608
697 nmdc:mga0k408_17094_c1 3300050493 Bacteria 4035
698 nmdc:mga0k408_33798_c1 3300050493 Bacteria 2926
699 nmdc:mga04h51_16263_c1 3300050495 Bacteria 2157
700 nmdc:mga07m45_28235_c1 3300050496 Bacteria 3097
701 nmdc:mga07m45_32777_c1 3300050496 Bacteria 2882
702 nmdc:mga07m45_96351_c1 3300050496 Bacteria 1698
703 nmdc:mga07m45_9970_c1 3300050496 Bacteria 4362
704 nmdc:mga05p37_443316_c1 3300050507 Bacteria 1505
705 nmdc:mga09592_38831_c1 3300050508 Bacteria 3997
706 nmdc:mga06r32_138706_c1 3300050510 Bacteria 2407
707 nmdc:mga08y16_101582_c1 3300050511 Bacteria 2994
708 nmdc:mga08y16_280593_c1 3300050511 Bacteria 1718
709 nmdc:mga08y16_8227_c1 3300050511 Bacteria 10909
710 nmdc:mga0n895_51608_c1 3300050512 Bacteria 4035
711 nmdc:mga0n895_960_c1 3300050512 Bacteria 20894
712 nmdc:mga0a205_10918_c1 3300050515 Bacteria 8355
713 Ga0495601_0000765 3300053077 Bacteria 17303
714 Ga0495601_0022680 3300053077 Bacteria 3857
715 Ga0495601_0061445 3300053077 Bacteria 2385
716 Ga0495601_0194841 3300053077 Bacteria 1324
717 Ga0495595_0002524 3300053084 Bacteria 7183
718 Ga0495619_0021555 3300053085 Bacteria 4115
719 Ga0495619_0096169 3300053085 Bacteria 2010
720 Ga0500644_0008575 3300053088 Bacteria 2701
721 Ga0500651_0002431 3300053093 Bacteria 9837
722 Ga0500566_0066833 3300053094 Bacteria 2025
723 Ga0500593_006312 3300053117 Bacteria 4737
724 Ga0500608_016431 3300053122 Bacteria 3343
725 Ga0500628_001055 3300053129 Bacteria 4812
726 Ga0500559_0046548 3300053136 Bacteria 1903
727 Ga0500568_0136398 3300053139 Bacteria 911
728 Ga0500622_0001521 3300053156 Bacteria 18383
729 Ga0500634_0139579 3300053161 Bacteria 1150
730 Ga0500645_000805 3300053730 Bacteria 18797
731 Ga0500587_000565 3300053739 Bacteria 4580
732 Ga0501084_0049144 3300054114 Bacteria 3531
733 Ga0501084_0081221 3300054114 Bacteria 2719
734 Ga0500661_001001 3300055283 Bacteria 5309
735 Ga0590071_000940 3300059421 Bacteria 8068
736 Ga0501082_0636526 3300060353 Bacteria 933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0048456 Ga0439446_0048456_17_697 222
2 3300035086 Ga0373934_0009596 Ga0373934_0009596_938_1636 225
3 3300035111 Ga0373923_0052788 Ga0373923_0052788_709_1407 225
4 3300035111 Ga0373923_0056415 Ga0373923_0056415_744_1442 225
5 3300035113 Ga0373936_0068977 Ga0373936_0068977_469_1167 225
6 3300035117 Ga0373953_0077125 Ga0373953_0077125_53_751 225
7 3300035119 Ga0373956_0007077 Ga0373956_0007077_363_1061 225
8 3300035120 Ga0373957_0002256 Ga0373957_0002256_716_1414 225
9 3300035695 Ga0373927_0064882 Ga0373927_0064882_708_1406 225
10 3300035724 Ga0373933_0281000 Ga0373933_0281000_36_734 225
11 3300036401 Ga0373937_0102769 Ga0373937_0102769_1279_1977 225
12 3300036401 Ga0373937_0215819 Ga0373937_0215819_468_1166 225
13 3300037068 Ga0373925_0053081 Ga0373925_0053081_1096_1794 225
14 3300046462 Ga0495651_0004810 Ga0495651_0004810_8015_8713 225
15 3300046472 Ga0495580_0077939 Ga0495580_0077939_1029_1727 225
16 3300046475 Ga0495639_0003685 Ga0495639_0003685_4871_5569 225
17 3300046476 Ga0495662_0057802 Ga0495662_0057802_1085_1783 225
18 3300046511 Ga0495608_0026023 Ga0495608_0026023_264_962 225
19 3300046514 Ga0495618_0038839 Ga0495618_0038839_1981_2679 225
20 3300046516 Ga0495628_0051387 Ga0495628_0051387_1684_2382 225
21 3300046526 Ga0495666_0007394 Ga0495666_0007394_1604_2302 225
22 3300046529 Ga0495652_0042675 Ga0495652_0042675_597_1295 225
23 3300046531 Ga0495665_0177201 Ga0495665_0177201_354_1052 225
24 3300046533 Ga0495640_0005312 Ga0495640_0005312_1029_1727 225
25 3300046559 Ga0495667_0103187 Ga0495667_0103187_438_1136 225
26 3300046663 Ga0495635_0004893 Ga0495635_0004893_7278_7976 225
27 3300046675 Ga0495657_0075462 Ga0495657_0075462_202_900 225
28 3300046681 Ga0495647_0003126 Ga0495647_0003126_549_1247 225
29 3300046683 Ga0495658_0010064 Ga0495658_0010064_317_1015 225
30 3300046809 Ga0495600_0000613 Ga0495600_0000613_1553_2251 225
31 3300047317 Ga0495604_0020921 Ga0495604_0020921_2962_3660 225
32 3300047319 Ga0495674_0007872 Ga0495674_0007872_5055_5753 225
33 3300047322 Ga0495680_0008833 Ga0495680_0008833_5181_5879 225
34 3300047471 Ga0495684_0059651 Ga0495684_0059651_1362_2060 225
35 3300053077 Ga0495601_0194841 Ga0495601_0194841_264_962 225
36 3300053084 Ga0495595_0002524 Ga0495595_0002524_1411_2109 225
37 3300053085 Ga0495619_0096169 Ga0495619_0096169_467_1165 225
38 3300042015 Ga0439462_0100480 Ga0439462_0100480_10_711 229
39 3300035089 Ga0373944_0063361 Ga0373944_0063361_432_1142 233
40 3300006177 Ga0075362_10146250 Ga0075362_101462503 245
41 3300046454 Ga0495592_0043081 Ga0495592_0043081_1314_2108 257
42 3300046462 Ga0495651_0113774 Ga0495651_0113774_138_932 257
43 3300046516 Ga0495628_0004940 Ga0495628_0004940_6581_7375 257
44 3300046529 Ga0495652_0035079 Ga0495652_0035079_2430_3224 257
45 3300046678 Ga0495599_0022294 Ga0495599_0022294_1117_1911 257
46 3300053077 Ga0495601_0000765 Ga0495601_0000765_12433_13227 257
47 3300035691 Ga0373931_0002459 Ga0373931_0002459_3503_4324 261
48 3300005842 Ga0068858_100145889 Ga0068858_1001458891 262
49 3300014968 Ga0157379_10030130 Ga0157379_100301302 262
50 3300037471 Ga0395905_0276984 Ga0395905_0276984_267_1097 264
51 3300046455 Ga0495603_0065011 Ga0495603_0065011_305_1120 264
52 3300003323 rootH1_10094518 rootH1_100945182 265
53 3300049572 Ga0501036_0132543 Ga0501036_0132543_975_1781 265
54 3300049575 Ga0501039_0095417 Ga0501039_0095417_876_1682 265
55 3300049576 Ga0501040_0163007 Ga0501040_0163007_629_1435 265
56 3300049578 Ga0501042_0101307 Ga0501042_0101307_179_985 265
57 3300054114 Ga0501084_0049144 Ga0501084_0049144_178_984 265
58 3300060353 Ga0501082_0636526 Ga0501082_0636526_47_853 265
59 3300005340 Ga0070689_100061503 Ga0070689_1000615033 266
60 3300005458 Ga0070681_10550144 Ga0070681_105501441 266
61 3300005546 Ga0070696_100016131 Ga0070696_1000161312 266
62 3300005719 Ga0068861_100390626 Ga0068861_1003906261 266
63 3300005841 Ga0068863_100160280 Ga0068863_1001602802 266
64 3300005843 Ga0068860_100190066 Ga0068860_1001900662 266
65 3300006847 Ga0075431_100078600 Ga0075431_1000786003 266
66 3300006852 Ga0075433_10001375 Ga0075433_1000137515 266
67 3300006871 Ga0075434_100000064 Ga0075434_10000006442 266
68 3300006880 Ga0075429_100073753 Ga0075429_1000737532 266
69 3300006914 Ga0075436_100001875 Ga0075436_1000018755 266
70 3300007076 Ga0075435_100001865 Ga0075435_10000186515 266
71 3300009094 Ga0111539_10108906 Ga0111539_101089062 266
72 3300009147 Ga0114129_10047107 Ga0114129_100471075 266
73 3300025936 Ga0207670_10109996 Ga0207670_101099963 266
74 3300026078 Ga0207702_10168555 Ga0207702_101685553 266
75 3300026088 Ga0207641_10151766 Ga0207641_101517663 266
76 3300026095 Ga0207676_10026632 Ga0207676_100266325 266
77 3300026118 Ga0207675_100529971 Ga0207675_1005299712 266
78 3300028380 Ga0268265_10659008 Ga0268265_106590081 266
79 3300028381 Ga0268264_10169873 Ga0268264_101698732 266
80 3300031548 Ga0307408_100508273 Ga0307408_1005082732 266
81 3300035170 Ga0373943_0006998 Ga0373943_0006998_2790_3602 266
82 3300035171 Ga0373946_0032277 Ga0373946_0032277_903_1715 266
83 3300035692 Ga0373935_0045106 Ga0373935_0045106_1592_2404 266
84 3300035725 Ga0373947_0014945 Ga0373947_0014945_2998_3810 266
85 3300036401 Ga0373937_0011507 Ga0373937_0011507_1064_1876 266
86 3300037068 Ga0373925_0022510 Ga0373925_0022510_730_1542 266
87 3300049522 Ga0501299_030210 Ga0501299_030210_169_978 266
88 3300050507 nmdc:mga05p37_443316_c1 nmdc:mga05p37_443316_c1_433_1239 266
89 3300050510 nmdc:mga06r32_138706_c1 nmdc:mga06r32_138706_c1_1070_1876 266
90 3300050511 nmdc:mga08y16_101582_c1 nmdc:mga08y16_101582_c1_1953_2762 266
91 3300050512 nmdc:mga0n895_960_c1 nmdc:mga0n895_960_c1_6399_7208 266
92 3300050515 nmdc:mga0a205_10918_c1 nmdc:mga0a205_10918_c1_7184_7993 266
93 3300005341 Ga0070691_10199715 Ga0070691_101997152 267
94 3300005343 Ga0070687_100316115 Ga0070687_1003161152 267
95 3300026089 Ga0207648_10784171 Ga0207648_107841711 267
96 3300049572 Ga0501036_0256120 Ga0501036_0256120_14_826 267
97 3300049573 Ga0501037_0128649 Ga0501037_0128649_401_1213 267
98 3300049582 Ga0501048_0057851 Ga0501048_0057851_59_871 267
99 3300049584 Ga0501068_0046749 Ga0501068_0046749_1313_2125 267
100 3300049591 Ga0501075_0067126 Ga0501075_0067126_1166_1978 267
101 3300049592 Ga0501076_0131964 Ga0501076_0131964_257_1069 267
102 3300049742 Ga0501080_0059758 Ga0501080_0059758_112_924 267
103 3300049824 Ga0501045_0332631 Ga0501045_0332631_141_953 267
104 3300054114 Ga0501084_0081221 Ga0501084_0081221_1790_2602 267
105 iso_pu_bacteria 2643221645 2644249665 267
106 iso_pu_bacteria 2643221664 2644356231 267
107 3300005343 Ga0070687_100213944 Ga0070687_1002139442 268
108 3300005444 Ga0070694_100079143 Ga0070694_1000791432 268
109 3300005536 Ga0070697_100184512 Ga0070697_1001845122 268
110 3300005615 Ga0070702_100129681 Ga0070702_1001296812 268
111 3300009094 Ga0111539_10007990 Ga0111539_100079905 268
112 3300025936 Ga0207670_10143830 Ga0207670_101438301 268
113 3300027907 Ga0207428_10014008 Ga0207428_100140083 268
114 3300031548 Ga0307408_100013147 Ga0307408_1000131475 268
115 3300031731 Ga0307405_10179141 Ga0307405_101791412 268
116 3300032002 Ga0307416_100007980 Ga0307416_1000079805 268
117 3300032126 Ga0307415_100101370 Ga0307415_1001013702 268
118 3300036401 Ga0373937_0040011 Ga0373937_0040011_766_1581 268
119 3300042876 Ga0451577_0427264 Ga0451577_0427264_140_961 268
120 3300046454 Ga0495592_0004682 Ga0495592_0004682_7395_8210 268
121 3300046461 Ga0495641_0030263 Ga0495641_0030263_516_1331 268
122 3300046476 Ga0495662_0066898 Ga0495662_0066898_870_1685 268
123 3300046511 Ga0495608_0011002 Ga0495608_0011002_3066_3881 268
124 3300046514 Ga0495618_0042318 Ga0495618_0042318_1950_2765 268
125 3300046516 Ga0495628_0005051 Ga0495628_0005051_9079_9894 268
126 3300046517 Ga0495630_0018101 Ga0495630_0018101_1416_2231 268
127 3300046517 Ga0495630_0101432 Ga0495630_0101432_865_1680 268
128 3300046529 Ga0495652_0085482 Ga0495652_0085482_628_1443 268
129 3300046533 Ga0495640_0011753 Ga0495640_0011753_2235_3050 268
130 3300046533 Ga0495640_0151970 Ga0495640_0151970_462_1277 268
131 3300046535 Ga0495586_0005086 Ga0495586_0005086_3033_3848 268
132 3300046559 Ga0495667_0015056 Ga0495667_0015056_3898_4713 268
133 3300046642 Ga0495634_0025729 Ga0495634_0025729_2428_3243 268
134 3300046663 Ga0495635_0027192 Ga0495635_0027192_746_1561 268
135 3300046683 Ga0495658_0021639 Ga0495658_0021639_35_850 268
136 3300046689 Ga0495613_0053854 Ga0495613_0053854_433_1248 268
137 3300046690 Ga0495624_0110685 Ga0495624_0110685_556_1371 268
138 3300046809 Ga0495600_0063564 Ga0495600_0063564_76_891 268
139 3300046809 Ga0495600_0351015 Ga0495600_0351015_27_842 268
140 3300047317 Ga0495604_0005868 Ga0495604_0005868_5052_5867 268
141 3300047318 Ga0495636_0005854 Ga0495636_0005854_3230_4045 268
142 3300047322 Ga0495680_0001187 Ga0495680_0001187_24459_25274 268
143 3300050508 nmdc:mga09592_38831_c1 nmdc:mga09592_38831_c1_755_1570 268
144 3300050511 nmdc:mga08y16_8227_c1 nmdc:mga08y16_8227_c1_9527_10342 268
145 3300050512 nmdc:mga0n895_51608_c1 nmdc:mga0n895_51608_c1_3196_4011 268
146 3300053077 Ga0495601_0022680 Ga0495601_0022680_624_1439 268
147 3300053077 Ga0495601_0061445 Ga0495601_0061445_1408_2223 268
148 3300053085 Ga0495619_0021555 Ga0495619_0021555_289_1104 268
149 3300006051 Ga0075364_10031006 Ga0075364_100310063 269
150 3300009553 Ga0105249_10142651 Ga0105249_101426512 269
151 3300017792 Ga0163161_10018567 Ga0163161_100185674 269
152 3300026118 Ga0207675_100059637 Ga0207675_1000596372 269
153 3300046557 Ga0495622_0028525 Ga0495622_0028525_1065_1904 269
154 3300046558 Ga0495633_0001345 Ga0495633_0001345_10586_11425 269
155 3300049460 Ga0495682_0008320 Ga0495682_0008320_827_1666 269
156 3300049776 Ga0501280_000798 Ga0501280_000798_5798_6613 269
157 3300049778 Ga0501282_000988 Ga0501282_000988_83_898 269
158 iso_pu_bacteria 2585428062 2587756254 269
159 iso_pu_bacteria 2643221544 2643746271 269
160 iso_pu_bacteria 2643221639 2644217441 269
161 iso_pu_bacteria 2643221646 2644258821 269
162 iso_pu_bacteria 2738541337 2739055577 269
163 iso_pu_bacteria 2928130867 2928133468 269
164 iso_pu_bacteria 2989392574 2989393335 269
165 3300002704 JGI25155J39150_1000005 JGI25155J39150_100000563 270
166 3300002705 JGI25156J39149_1000006 JGI25156J39149_100000663 270
167 3300002738 JGI25154J39366_1000015 JGI25154J39366_1000015185 270
168 3300002739 JGI25158J39367_1004793 JGI25158J39367_10047933 270
169 3300002739 JGI25158J39367_1007049 JGI25158J39367_10070491 270
170 3300002741 JGI25157J39369_1000016 JGI25157J39369_1000016120 270
171 3300003187 JGI25151J46595_10055061 JGI25151J46595_100550612 270
172 3300003773 Ga0055537_1001110 Ga0055537_10011103 270
173 3300003791 Ga0055530_10012241 Ga0055530_100122411 270
174 3300003794 Ga0055531_10041802 Ga0055531_100418022 270
175 3300017792 Ga0163161_10034424 Ga0163161_100344243 270
176 3300025206 Ga0209435_100010 Ga0209435_10001073 270
177 3300025246 Ga0209646_1000001 Ga0209646_10000012070 270
178 3300025250 Ga0209026_1000001 Ga0209026_1000001726 270
179 3300025256 Ga0209759_1000001 Ga0209759_10000011701 270
180 3300025263 Ga0209565_1000966 Ga0209565_100096612 270
181 3300025295 Ga0209564_1008921 Ga0209564_10089212 270
182 3300025298 Ga0209050_1010655 Ga0209050_10106551 270
183 3300031548 Ga0307408_100001378 Ga0307408_1000013788 270
184 3300031548 Ga0307408_100001760 Ga0307408_1000017605 270
185 3300042532 Ga0450893_0032503 Ga0450893_0032503_42_887 270
186 3300044683 Ga0466965_0005539 Ga0466965_0005539_2685_3542 270
187 3300046457 Ga0495590_0004799 Ga0495590_0004799_1642_2487 270
188 3300046460 Ga0495638_0005781 Ga0495638_0005781_3656_4501 270
189 3300046474 Ga0495605_0019545 Ga0495605_0019545_222_1067 270
190 3300046491 Ga0495584_0005884 Ga0495584_0005884_2048_2893 270
191 3300046491 Ga0495584_0046290 Ga0495584_0046290_241_1086 270
192 3300046492 Ga0495585_0046182 Ga0495585_0046182_518_1363 270
193 3300046501 Ga0495607_0038555 Ga0495607_0038555_1237_2082 270
194 3300046506 Ga0495583_0000004 Ga0495583_0000004_106682_107527 270
195 3300046506 Ga0495583_0000257 Ga0495583_0000257_41676_42530 270
196 3300046513 Ga0495616_0002745 Ga0495616_0002745_1788_2633 270
197 3300046513 Ga0495616_0004849 Ga0495616_0004849_5351_6196 270
198 3300046523 Ga0495644_0000870 Ga0495644_0000870_1184_2029 270
199 3300046523 Ga0495644_0000884 Ga0495644_0000884_10389_11234 270
200 3300046524 Ga0495648_0019950 Ga0495648_0019950_2455_3300 270
201 3300046524 Ga0495648_0042317 Ga0495648_0042317_910_1806 270
202 3300046528 Ga0495642_0054242 Ga0495642_0054242_764_1636 270
203 3300046542 Ga0495597_0146436 Ga0495597_0146436_39_890 270
204 3300046557 Ga0495622_0038510 Ga0495622_0038510_1161_2006 270
205 3300046558 Ga0495633_0013127 Ga0495633_0013127_2183_3028 270
206 3300046558 Ga0495633_0014941 Ga0495633_0014941_2125_2970 270
207 3300046615 Ga0495656_0006569 Ga0495656_0006569_3222_4067 270
208 3300046648 Ga0495611_0011224 Ga0495611_0011224_771_1616 270
209 3300046660 Ga0495625_0010574 Ga0495625_0010574_222_1067 270
210 3300046665 Ga0495661_0215461 Ga0495661_0215461_59_904 270
211 3300046692 Ga0495671_0009268 Ga0495671_0009268_2446_3291 270
212 3300047318 Ga0495636_0000628 Ga0495636_0000628_9679_10524 270
213 3300047318 Ga0495636_0103100 Ga0495636_0103100_141_992 270
214 3300047323 Ga0495683_0005503 Ga0495683_0005503_2424_3269 270
215 3300047443 Ga0495687_000621 Ga0495687_000621_3657_4502 270
216 3300047447 Ga0495685_000005 Ga0495685_000005_110985_111830 270
217 3300047469 Ga0495673_0019557 Ga0495673_0019557_899_1744 270
218 3300048905 Ga0496102_0000425 Ga0496102_0000425_32802_33662 270
219 3300048906 Ga0496103_0002424 Ga0496103_0002424_8928_9788 270
220 3300049459 Ga0495678_000839 Ga0495678_000839_24054_24899 270
221 3300049581 Ga0501047_0476411 Ga0501047_0476411_35_910 270
222 3300053139 Ga0500568_0136398 Ga0500568_0136398_38_901 270
223 iso_pu_bacteria 2511231002 2511244030 270
224 iso_pu_bacteria 2831864461 2831865565 270
225 3300002987 JGI25159J45721_1011231 JGI25159J45721_10112312 271
226 3300003323 rootH1_10203174 rootH1_102031741 271
227 3300003763 Ga0055529_1000127 Ga0055529_100012773 271
228 3300003771 Ga0055526_1005064 Ga0055526_10050644 271
229 3300004625 Ga0055543_1009791 Ga0055543_10097912 271
230 3300005262 Ga0065165_1000447 Ga0065165_100044720 271
231 3300005547 Ga0070693_100011800 Ga0070693_1000118006 271
232 3300006948 Ga0099826_10000003 Ga0099826_10000003552 271
233 3300009551 Ga0105238_10938854 Ga0105238_109388541 271
234 3300021361 Ga0213872_10000324 Ga0213872_1000032412 271
235 3300025284 Ga0209130_1000951 Ga0209130_10009514 271
236 3300035086 Ga0373934_0000209 Ga0373934_0000209_10543_11388 271
237 3300035111 Ga0373923_0215049 Ga0373923_0215049_12_857 271
238 3300035117 Ga0373953_0021321 Ga0373953_0021321_694_1539 271
239 3300035118 Ga0373954_0033657 Ga0373954_0033657_758_1603 271
240 3300035119 Ga0373956_0000006 Ga0373956_0000006_54513_55358 271
241 3300035172 Ga0373955_0011044 Ga0373955_0011044_1834_2679 271
242 3300035724 Ga0373933_0000217 Ga0373933_0000217_19578_20423 271
243 3300036401 Ga0373937_0000205 Ga0373937_0000205_12961_13806 271
244 3300039447 Ga0436361_0148311 Ga0436361_0148311_15831_16688 271
245 3300042007 Ga0439449_0013392 Ga0439449_0013392_2089_2910 271
246 3300042015 Ga0439462_0060123 Ga0439462_0060123_154_975 271
247 3300042876 Ga0451577_0005101 Ga0451577_0005101_9632_10483 271
248 3300045051 Ga0451576_0222642 Ga0451576_0222642_232_1083 271
249 3300046454 Ga0495592_0003264 Ga0495592_0003264_3405_4250 271
250 3300046457 Ga0495590_0000035 Ga0495590_0000035_56380_57246 271
251 3300046460 Ga0495638_0000023 Ga0495638_0000023_6362_7228 271
252 3300046462 Ga0495651_0006269 Ga0495651_0006269_2552_3397 271
253 3300046471 Ga0495650_0013618 Ga0495650_0013618_2364_3230 271
254 3300046475 Ga0495639_0026028 Ga0495639_0026028_1653_2519 271
255 3300046501 Ga0495607_0001625 Ga0495607_0001625_1086_1952 271
256 3300046506 Ga0495583_0001806 Ga0495583_0001806_12981_13847 271
257 3300046507 Ga0495606_0001324 Ga0495606_0001324_31547_32419 271
258 3300046507 Ga0495606_0002149 Ga0495606_0002149_2201_3070 271
259 3300046512 Ga0495610_0000430 Ga0495610_0000430_32368_33213 271
260 3300046516 Ga0495628_0013204 Ga0495628_0013204_5352_6197 271
261 3300046522 Ga0495643_0001307 Ga0495643_0001307_20056_20922 271
262 3300046524 Ga0495648_0000025 Ga0495648_0000025_226174_227040 271
263 3300046528 Ga0495642_0003530 Ga0495642_0003530_2535_3401 271
264 3300046542 Ga0495597_0000361 Ga0495597_0000361_36476_37342 271
265 3300046543 Ga0495645_0000371 Ga0495645_0000371_14443_15288 271
266 3300046557 Ga0495622_0000063 Ga0495622_0000063_2796_3662 271
267 3300046558 Ga0495633_0001396 Ga0495633_0001396_11591_12457 271
268 3300046616 Ga0495668_0000049 Ga0495668_0000049_169838_170701 271
269 3300046616 Ga0495668_0002152 Ga0495668_0002152_6186_7052 271
270 3300046660 Ga0495625_0000123 Ga0495625_0000123_113737_114603 271
271 3300046675 Ga0495657_0057559 Ga0495657_0057559_170_1015 271
272 3300046678 Ga0495599_0003472 Ga0495599_0003472_7472_8317 271
273 3300046691 Ga0495670_0048446 Ga0495670_0048446_59_913 271
274 3300049459 Ga0495678_010318 Ga0495678_010318_1392_2258 271
275 3300053161 Ga0500634_0139579 Ga0500634_0139579_254_1081 271
276 iso_pu_bacteria 2881101125 2881102881 271
277 iso_pu_bacteria 2919704043 2919707469 271
278 3300003187 JGI25151J46595_10000614 JGI25151J46595_100006142 272
279 3300003187 JGI25151J46595_10000935 JGI25151J46595_1000093518 272
280 3300003775 Ga0055524_1000196 Ga0055524_100019636 272
281 3300003775 Ga0055524_1004096 Ga0055524_10040962 272
282 3300003781 Ga0055536_1000022 Ga0055536_100002248 272
283 3300003784 Ga0055534_1000270 Ga0055534_100027030 272
284 3300003784 Ga0055534_1000368 Ga0055534_100036826 272
285 3300003784 Ga0055534_1002591 Ga0055534_10025912 272
286 3300005459 Ga0068867_100000083 Ga0068867_10000008348 272
287 3300009148 Ga0105243_10026872 Ga0105243_100268722 272
288 3300014745 Ga0157377_10000104 Ga0157377_100001046 272
289 3300025263 Ga0209565_1000411 Ga0209565_100041125 272
290 3300025291 Ga0209675_1000070 Ga0209675_10000704 272
291 3300025291 Ga0209675_1000383 Ga0209675_100038330 272
292 3300025291 Ga0209675_1000389 Ga0209675_100038928 272
293 3300025292 Ga0209676_1000012 Ga0209676_1000012627 272
294 3300025294 Ga0209025_1000124 Ga0209025_100012485 272
295 3300025294 Ga0209025_1001088 Ga0209025_10010888 272
296 3300025294 Ga0209025_1001306 Ga0209025_100130610 272
297 3300025295 Ga0209564_1000350 Ga0209564_100035013 272
298 3300025295 Ga0209564_1000380 Ga0209564_10003804 272
299 3300025295 Ga0209564_1000497 Ga0209564_100049736 272
300 3300025299 Ga0209256_1000059 Ga0209256_1000059212 272
301 3300025299 Ga0209256_1000842 Ga0209256_10008424 272
302 3300025935 Ga0207709_10015374 Ga0207709_100153746 272
303 3300026089 Ga0207648_10000243 Ga0207648_100002436 272
304 3300026142 Ga0207698_10032373 Ga0207698_100323732 272
305 3300027666 Ga0209282_1000064 Ga0209282_100006455 272
306 3300041404 Ga0439436_0005686 Ga0439436_0005686_1655_2491 272
307 3300044656 Ga0466969_0007616 Ga0466969_0007616_1068_2177 272
308 3300044666 Ga0466977_0080483 Ga0466977_0080483_853_1863 272
309 3300044693 Ga0466961_0026365 Ga0466961_0026365_574_1584 272
310 3300046513 Ga0495616_0023343 Ga0495616_0023343_104_964 272
311 3300046538 Ga0495609_0000598 Ga0495609_0000598_26373_27221 272
312 3300046692 Ga0495671_0015519 Ga0495671_0015519_2208_3056 272
313 3300047317 Ga0495604_0043060 Ga0495604_0043060_2631_3467 272
314 3300047318 Ga0495636_0043143 Ga0495636_0043143_868_1716 272
315 3300047320 Ga0495672_0045832 Ga0495672_0045832_864_1712 272
316 3300048919 Ga0496116_0011775 Ga0496116_0011775_3055_3915 272
317 iso_pu_bacteria 2513237165 2514041140 272
318 iso_pu_bacteria 2547132374 2548498818 272
319 iso_pu_bacteria 2643221570 2643867029 272
320 iso_pu_bacteria 2643221596 2643989968 272
321 iso_pu_bacteria 2643221609 2644058919 272
322 iso_pu_bacteria 2643221611 2644071143 272
323 iso_pu_bacteria 2643221652 2644292639 272
324 iso_pu_bacteria 2643221717 2644648278 272
325 iso_pu_bacteria 2721755523 2722885152 272
326 iso_pu_bacteria 2721755763 2723876477 272
327 iso_pu_bacteria 2738541277 2738723342 272
328 iso_pu_bacteria 2738543012 2739246176 272
329 iso_pu_bacteria 2738543019 2739284073 272
330 iso_pu_bacteria 2816332133 2816471445 272
331 iso_pu_bacteria 2834641062 2834641324 272
332 iso_pu_bacteria 2839138175 2839142462 272
333 iso_pu_bacteria 2842718218 2842721277 272
334 iso_pu_bacteria 2885192300 2885198017 272
335 iso_pu_bacteria 2901300506 2901305545 272
336 iso_pu_bacteria 2904479285 2904480148 272
337 iso_pu_bacteria 2932422444 2932425290 272
338 iso_pu_bacteria 2954767861 2954771172 272
339 iso_pu_bacteria 2990710928 2990711368 272
340 iso_pu_bacteria 644736347 644748707 272
341 iso_pu_bacteria 8003400568 8003400994 272
342 3300003316 rootH1_10005867 rootH1_100058673 273
343 3300003322 rootL2_10010992 rootL2_100109929 273
344 3300003322 rootL2_10027335 rootL2_100273351 273
345 3300003323 rootH1_10016719 rootH1_1001671929 273
346 3300003323 rootH1_10106554 rootH1_101065542 273
347 3300005328 Ga0070676_10275423 Ga0070676_102754232 273
348 3300005353 Ga0070669_100033317 Ga0070669_1000333174 273
349 3300005354 Ga0070675_100087152 Ga0070675_1000871523 273
350 3300005456 Ga0070678_100071614 Ga0070678_1000716142 273
351 3300005456 Ga0070678_100234981 Ga0070678_1002349811 273
352 3300005457 Ga0070662_100002892 Ga0070662_1000028923 273
353 3300005467 Ga0070706_100240587 Ga0070706_1002405873 273
354 3300005543 Ga0070672_100160174 Ga0070672_1001601742 273
355 3300005616 Ga0068852_100062137 Ga0068852_1000621371 273
356 3300005618 Ga0068864_100075933 Ga0068864_1000759335 273
357 3300005841 Ga0068863_100210350 Ga0068863_1002103503 273
358 3300005843 Ga0068860_100205441 Ga0068860_1002054411 273
359 3300006048 Ga0075363_100088043 Ga0075363_1000880432 273
360 3300006195 Ga0075366_10002784 Ga0075366_1000278412 273
361 3300006353 Ga0075370_10197766 Ga0075370_101977661 273
362 3300009177 Ga0105248_10003706 Ga0105248_100037068 273
363 3300009545 Ga0105237_10000441 Ga0105237_1000044146 273
364 3300009551 Ga0105238_10024678 Ga0105238_100246783 273
365 3300010375 Ga0105239_10000417 Ga0105239_1000041713 273
366 3300013306 Ga0163162_10602926 Ga0163162_106029261 273
367 3300025303 Ga0209051_1003952 Ga0209051_10039523 273
368 3300025303 Ga0209051_1013653 Ga0209051_10136532 273
369 3300025907 Ga0207645_10271834 Ga0207645_102718341 273
370 3300025910 Ga0207684_10199097 Ga0207684_101990973 273
371 3300025913 Ga0207695_10004036 Ga0207695_1000403614 273
372 3300025914 Ga0207671_10007150 Ga0207671_100071504 273
373 3300025923 Ga0207681_10030861 Ga0207681_100308612 273
374 3300025924 Ga0207694_10017517 Ga0207694_100175173 273
375 3300025933 Ga0207706_10000544 Ga0207706_1000054424 273
376 3300025940 Ga0207691_10075959 Ga0207691_100759592 273
377 3300025941 Ga0207711_10016794 Ga0207711_100167946 273
378 3300025960 Ga0207651_10038244 Ga0207651_100382443 273
379 3300025972 Ga0207668_10294510 Ga0207668_102945101 273
380 3300026023 Ga0207677_10322122 Ga0207677_103221222 273
381 3300026041 Ga0207639_10144109 Ga0207639_101441093 273
382 3300026088 Ga0207641_10282398 Ga0207641_102823982 273
383 3300026095 Ga0207676_10050322 Ga0207676_100503222 273
384 3300026121 Ga0207683_10070600 Ga0207683_100706002 273
385 3300026142 Ga0207698_10696665 Ga0207698_106966651 273
386 3300028794 Ga0307515_10006997 Ga0307515_1000699712 273
387 3300028794 Ga0307515_10014617 Ga0307515_100146174 273
388 3300028794 Ga0307515_10017471 Ga0307515_100174713 273
389 3300028794 Ga0307515_10067591 Ga0307515_100675914 273
390 3300028794 Ga0307515_10428656 Ga0307515_104286561 273
391 3300030522 Ga0307512_10042866 Ga0307512_100428661 273
392 3300031239 Ga0265328_10017791 Ga0265328_100177912 273
393 3300031251 Ga0265327_10000235 Ga0265327_1000023547 273
394 3300031456 Ga0307513_10007087 Ga0307513_100070879 273
395 3300031456 Ga0307513_10099934 Ga0307513_100999342 273
396 3300031507 Ga0307509_10125778 Ga0307509_101257784 273
397 3300031507 Ga0307509_10140135 Ga0307509_101401353 273
398 3300031548 Ga0307408_100000165 Ga0307408_10000016516 273
399 3300031649 Ga0307514_10001054 Ga0307514_1000105417 273
400 3300032004 Ga0307414_10074486 Ga0307414_100744862 273
401 3300032005 Ga0307411_10001640 Ga0307411_100016405 273
402 3300034818 Ga0373950_0009468 Ga0373950_0009468_16_837 273
403 3300035088 Ga0373940_0011326 Ga0373940_0011326_1144_1965 273
404 3300035091 Ga0373951_0009094 Ga0373951_0009094_37_858 273
405 3300035114 Ga0373939_0000372 Ga0373939_0000372_3322_4143 273
406 3300035242 Ga0373962_0008728 Ga0373962_0008728_1191_2012 273
407 3300035691 Ga0373931_0008442 Ga0373931_0008442_3296_4117 273
408 3300035691 Ga0373931_0391223 Ga0373931_0391223_22_867 273
409 3300037312 Ga0395899_0001005 Ga0395899_0001005_7506_8351 273
410 3300037418 Ga0395900_0006176 Ga0395900_0006176_4193_5038 273
411 3300037466 Ga0395898_0007548 Ga0395898_0007548_5370_6215 273
412 3300037471 Ga0395905_0009619 Ga0395905_0009619_4162_5007 273
413 3300037471 Ga0395905_0029892 Ga0395905_0029892_3052_3876 273
414 3300038443 Ga0395901_0007041 Ga0395901_0007041_6362_7207 273
415 3300041486 Ga0451807_1484103 Ga0451807_1484103_315_1169 273
416 3300042003 Ga0439443_015061 Ga0439443_015061_19_843 273
417 3300042007 Ga0439449_0030592 Ga0439449_0030592_799_1626 273
418 3300042015 Ga0439462_0036135 Ga0439462_0036135_305_1132 273
419 3300042120 Ga0450917_001070 Ga0450917_001070_23_847 273
420 3300042126 Ga0450888_000661 Ga0450888_000661_71_895 273
421 3300042127 Ga0450890_000366 Ga0450890_000366_474_1298 273
422 3300042129 Ga0450891_002200 Ga0450891_002200_604_1428 273
423 3300042130 Ga0450892_000411 Ga0450892_000411_3210_4034 273
424 3300042144 Ga0450889_004348 Ga0450889_004348_474_1298 273
425 3300042532 Ga0450893_0000278 Ga0450893_0000278_2176_3000 273
426 3300042876 Ga0451577_0000804 Ga0451577_0000804_18828_19652 273
427 3300044712 Ga0453684_0005076 Ga0453684_0005076_22418_23239 273
428 3300044712 Ga0453684_0018360 Ga0453684_0018360_6151_6975 273
429 3300044712 Ga0453684_0151298 Ga0453684_0151298_1083_1904 273
430 3300045051 Ga0451576_0266409 Ga0451576_0266409_361_1185 273
431 3300046519 Ga0495632_0020100 Ga0495632_0020100_458_1318 273
432 3300046537 Ga0495598_0007405 Ga0495598_0007405_1640_2461 273
433 3300046539 Ga0495621_0007614 Ga0495621_0007614_1983_2804 273
434 3300046660 Ga0495625_0004092 Ga0495625_0004092_12009_12830 273
435 3300048907 Ga0496104_0077219 Ga0496104_0077219_1977_2804 273
436 3300048908 Ga0496105_0190863 Ga0496105_0190863_505_1332 273
437 3300048912 Ga0496109_0279544 Ga0496109_0279544_516_1343 273
438 3300048915 Ga0496112_0020391 Ga0496112_0020391_2458_3285 273
439 3300048916 Ga0496113_0025739 Ga0496113_0025739_1506_2333 273
440 3300048928 Ga0496125_0276206 Ga0496125_0276206_20_850 273
441 3300049652 Ga0501202_001322 Ga0501202_001322_2930_3754 273
442 3300049662 Ga0501222_000006 Ga0501222_000006_64292_65137 273
443 3300049669 Ga0501235_019614 Ga0501235_019614_197_1021 273
444 3300049704 Ga0501221_002212 Ga0501221_002212_2250_3074 273
445 3300049705 Ga0501225_0047697 Ga0501225_0047697_160_984 273
446 3300049706 Ga0501229_000401 Ga0501229_000401_2297_3121 273
447 3300049757 Ga0501232_002702 Ga0501232_002702_101_925 273
448 3300050493 nmdc:mga0k408_17094_c1 nmdc:mga0k408_17094_c1_2479_3300 273
449 3300050496 nmdc:mga07m45_32777_c1 nmdc:mga07m45_32777_c1_757_1578 273
450 3300050496 nmdc:mga07m45_96351_c1 nmdc:mga07m45_96351_c1_206_1030 273
451 3300050511 nmdc:mga08y16_280593_c1 nmdc:mga08y16_280593_c1_822_1643 273
452 3300053739 Ga0500587_000565 Ga0500587_000565_1392_2252 273
453 3300059421 Ga0590071_000940 Ga0590071_000940_4781_5602 273
454 3300002774 JGI25150J39212_1003538 JGI25150J39212_10035383 274
455 3300002987 JGI25159J45721_1000065 JGI25159J45721_100006528 274
456 3300003187 JGI25151J46595_10057071 JGI25151J46595_100570712 274
457 3300003316 rootH1_10002293 rootH1_100022932 274
458 3300003320 rootH2_10140946 rootH2_101409461 274
459 3300003322 rootL2_10005248 rootL2_1000524815 274
460 3300003323 rootH1_10037528 rootH1_100375288 274
461 3300003354 JGI25160J50197_1000098 JGI25160J50197_100009858 274
462 3300003374 JGI25161J50226_1000037 JGI25161J50226_100003796 274
463 3300003771 Ga0055526_1000985 Ga0055526_100098516 274
464 3300003771 Ga0055526_1002586 Ga0055526_10025863 274
465 3300003771 Ga0055526_1005110 Ga0055526_10051106 274
466 3300003773 Ga0055537_1000463 Ga0055537_100046319 274
467 3300003773 Ga0055537_1000876 Ga0055537_10008763 274
468 3300003775 Ga0055524_1000261 Ga0055524_100026144 274
469 3300003775 Ga0055524_1000761 Ga0055524_10007612 274
470 3300003775 Ga0055524_1012988 Ga0055524_10129882 274
471 3300003784 Ga0055534_1022796 Ga0055534_10227961 274
472 3300003790 Ga0055528_1003437 Ga0055528_10034374 274
473 3300003791 Ga0055530_10000190 Ga0055530_1000019030 274
474 3300003792 Ga0055540_1000187 Ga0055540_100018733 274
475 3300003792 Ga0055540_1010573 Ga0055540_10105732 274
476 3300003794 Ga0055531_10000765 Ga0055531_1000076520 274
477 3300003794 Ga0055531_10001838 Ga0055531_100018386 274
478 3300003794 Ga0055531_10009989 Ga0055531_100099896 274
479 3300003794 Ga0055531_10012043 Ga0055531_100120432 274
480 3300004625 Ga0055543_1001040 Ga0055543_10010407 274
481 3300005262 Ga0065165_1000153 Ga0065165_100015330 274
482 3300005262 Ga0065165_1000816 Ga0065165_100081630 274
483 3300005530 Ga0070679_100017823 Ga0070679_1000178235 274
484 3300006038 Ga0075365_10078840 Ga0075365_100788402 274
485 3300006177 Ga0075362_10039976 Ga0075362_100399762 274
486 3300006178 Ga0075367_10085772 Ga0075367_100857722 274
487 3300006944 Ga0099823_1011917 Ga0099823_10119174 274
488 3300009093 Ga0105240_10058493 Ga0105240_100584936 274
489 3300009551 Ga0105238_10191736 Ga0105238_101917362 274
490 3300012497 Ga0157319_1000016 Ga0157319_100001679 274
491 3300015262 Ga0182007_10055158 Ga0182007_100551582 274
492 3300021361 Ga0213872_10000004 Ga0213872_10000004155 274
493 3300021361 Ga0213872_10000077 Ga0213872_1000007759 274
494 3300021361 Ga0213872_10001319 Ga0213872_100013194 274
495 3300021361 Ga0213872_10002068 Ga0213872_1000206810 274
496 3300025208 Ga0209436_103957 Ga0209436_1039573 274
497 3300025258 Ga0209129_1011907 Ga0209129_10119072 274
498 3300025263 Ga0209565_1000102 Ga0209565_100010243 274
499 3300025273 Ga0209673_1000189 Ga0209673_100018972 274
500 3300025273 Ga0209673_1008368 Ga0209673_10083682 274
501 3300025273 Ga0209673_1010389 Ga0209673_10103892 274
502 3300025284 Ga0209130_1000141 Ga0209130_100014134 274
503 3300025284 Ga0209130_1000423 Ga0209130_100042332 274
504 3300025291 Ga0209675_1000288 Ga0209675_100028811 274
505 3300025291 Ga0209675_1009066 Ga0209675_10090663 274
506 3300025292 Ga0209676_1000069 Ga0209676_100006959 274
507 3300025292 Ga0209676_1029305 Ga0209676_10293052 274
508 3300025294 Ga0209025_1002311 Ga0209025_10023113 274
509 3300025294 Ga0209025_1003168 Ga0209025_100316811 274
510 3300025295 Ga0209564_1000008 Ga0209564_1000008772 274
511 3300025295 Ga0209564_1000415 Ga0209564_100041563 274
512 3300025295 Ga0209564_1001117 Ga0209564_100111730 274
513 3300025295 Ga0209564_1011606 Ga0209564_10116062 274
514 3300025297 Ga0209758_1040734 Ga0209758_10407342 274
515 3300025298 Ga0209050_1000023 Ga0209050_1000023234 274
516 3300025298 Ga0209050_1002239 Ga0209050_10022396 274
517 3300025298 Ga0209050_1002352 Ga0209050_100235215 274
518 3300025299 Ga0209256_1000003 Ga0209256_1000003971 274
519 3300025299 Ga0209256_1000496 Ga0209256_100049616 274
520 3300025299 Ga0209256_1002703 Ga0209256_100270315 274
521 3300025302 Ga0207426_1000145 Ga0207426_100014531 274
522 3300025302 Ga0207426_1004246 Ga0207426_10042463 274
523 3300025303 Ga0209051_1000017 Ga0209051_1000017234 274
524 3300025303 Ga0209051_1000639 Ga0209051_10006399 274
525 3300025303 Ga0209051_1000928 Ga0209051_100092822 274
526 3300025304 Ga0209257_1000041 Ga0209257_1000041234 274
527 3300025304 Ga0209257_1000096 Ga0209257_1000096240 274
528 3300025304 Ga0209257_1003877 Ga0209257_100387711 274
529 3300025304 Ga0209257_1004170 Ga0209257_10041703 274
530 3300025921 Ga0207652_10085609 Ga0207652_100856093 274
531 3300025949 Ga0207667_10413258 Ga0207667_104132582 274
532 3300027312 Ga0209371_1029846 Ga0209371_10298462 274
533 3300027866 Ga0209813_10024948 Ga0209813_100249482 274
534 3300030500 Ga0268256_1030016 Ga0268256_10300162 274
535 3300031238 Ga0265332_10010386 Ga0265332_100103863 274
536 3300031242 Ga0265329_10009325 Ga0265329_100093253 274
537 3300031344 Ga0265316_10153241 Ga0265316_101532413 274
538 3300031548 Ga0307408_100014599 Ga0307408_1000145993 274
539 3300031548 Ga0307408_100026194 Ga0307408_1000261943 274
540 3300031711 Ga0265314_10000727 Ga0265314_100007272 274
541 3300031711 Ga0265314_10057988 Ga0265314_100579882 274
542 3300031901 Ga0307406_10014450 Ga0307406_100144502 274
543 3300037312 Ga0395899_0022001 Ga0395899_0022001_3754_4590 274
544 3300037312 Ga0395899_0043120 Ga0395899_0043120_896_1744 274
545 3300037312 Ga0395899_0304823 Ga0395899_0304823_86_922 274
546 3300037418 Ga0395900_0010004 Ga0395900_0010004_6750_7598 274
547 3300037418 Ga0395900_0122716 Ga0395900_0122716_1339_2172 274
548 3300037418 Ga0395900_0233878 Ga0395900_0233878_371_1201 274
549 3300037418 Ga0395900_0312814 Ga0395900_0312814_288_1124 274
550 3300037466 Ga0395898_0039793 Ga0395898_0039793_1726_2616 274
551 3300037466 Ga0395898_0043895 Ga0395898_0043895_136_984 274
552 3300037471 Ga0395905_0000033 Ga0395905_0000033_267670_268500 274
553 3300037471 Ga0395905_0003696 Ga0395905_0003696_14758_15606 274
554 3300037471 Ga0395905_0004869 Ga0395905_0004869_9266_10096 274
555 3300037471 Ga0395905_0011819 Ga0395905_0011819_5911_6741 274
556 3300037471 Ga0395905_0107034 Ga0395905_0107034_73_906 274
557 3300037471 Ga0395905_0136766 Ga0395905_0136766_1101_1931 274
558 3300037471 Ga0395905_0282630 Ga0395905_0282630_110_958 274
559 3300038443 Ga0395901_0063115 Ga0395901_0063115_565_1455 274
560 3300038443 Ga0395901_0074942 Ga0395901_0074942_26_856 274
561 3300038443 Ga0395901_0089265 Ga0395901_0089265_418_1266 274
562 3300038443 Ga0395901_0666224 Ga0395901_0666224_158_994 274
563 3300038443 Ga0395901_0751387 Ga0395901_0751387_40_876 274
564 3300039447 Ga0436361_0261085 Ga0436361_0261085_168_1004 274
565 3300039447 Ga0436361_0287447 Ga0436361_0287447_83368_84195 274
566 3300039447 Ga0436361_0656823 Ga0436361_0656823_13150_14082 274
567 3300039447 Ga0436361_1007413 Ga0436361_1007413_73107_73934 274
568 3300039447 Ga0436361_1146112 Ga0436361_1146112_4736_5563 274
569 3300042116 Ga0450912_000333 Ga0450912_000333_38_868 274
570 3300042127 Ga0450890_001507 Ga0450890_001507_365_1195 274
571 3300042131 Ga0450894_006833 Ga0450894_006833_261_1097 274
572 3300042134 Ga0450898_001687 Ga0450898_001687_996_1832 274
573 3300042156 Ga0439446_0017366 Ga0439446_0017366_1005_1841 274
574 3300042438 Ga0439459_0016257 Ga0439459_0016257_54_890 274
575 3300042532 Ga0450893_0002086 Ga0450893_0002086_60_890 274
576 3300044673 Ga0453683_0003001 Ga0453683_0003001_193_1029 274
577 3300044684 Ga0466966_0019549 Ga0466966_0019549_2306_3154 274
578 3300044693 Ga0466961_0006490 Ga0466961_0006490_1121_1969 274
579 3300044719 Ga0466971_0148433 Ga0466971_0148433_43_873 274
580 3300044842 Ga0466957_0012321 Ga0466957_0012321_3445_4281 274
581 3300045049 Ga0466959_0119767 Ga0466959_0119767_802_1650 274
582 3300045051 Ga0451576_0592110 Ga0451576_0592110_286_1122 274
583 3300046542 Ga0495597_0001192 Ga0495597_0001192_18002_18841 274
584 3300046615 Ga0495656_0004696 Ga0495656_0004696_2881_3714 274
585 3300046615 Ga0495656_0087875 Ga0495656_0087875_95_928 274
586 3300047447 Ga0495685_010046 Ga0495685_010046_1999_2832 274
587 3300048927 Ga0496124_0013398 Ga0496124_0013398_789_1619 274
588 3300048929 Ga0496126_0304010 Ga0496126_0304010_378_1208 274
589 3300049569 Ga0501032_0274135 Ga0501032_0274135_38_874 274
590 3300049571 Ga0501034_0035730 Ga0501034_0035730_1294_2124 274
591 3300049573 Ga0501037_0165878 Ga0501037_0165878_649_1485 274
592 3300049574 Ga0501038_0050608 Ga0501038_0050608_1154_1984 274
593 3300049742 Ga0501080_0167824 Ga0501080_0167824_12_842 274
594 3300049823 Ga0501044_0129700 Ga0501044_0129700_1378_2214 274
595 3300050491 nmdc:mga00v17_145916_c1 nmdc:mga00v17_145916_c1_401_1258 274
596 3300050492 nmdc:mga0yw44_109692_c1 nmdc:mga0yw44_109692_c1_122_952 274
597 3300050492 nmdc:mga0yw44_163541_c1 nmdc:mga0yw44_163541_c1_463_1296 274
598 3300050495 nmdc:mga04h51_16263_c1 nmdc:mga04h51_16263_c1_1232_2065 274
599 3300050496 nmdc:mga07m45_9970_c1 nmdc:mga07m45_9970_c1_2109_2939 274
600 3300053088 Ga0500644_0008575 Ga0500644_0008575_1437_2294 274
601 3300053094 Ga0500566_0066833 Ga0500566_0066833_877_1743 274
602 3300053117 Ga0500593_006312 Ga0500593_006312_1443_2309 274
603 3300053129 Ga0500628_001055 Ga0500628_001055_1228_2076 274
604 3300053136 Ga0500559_0046548 Ga0500559_0046548_495_1331 274
605 3300053156 Ga0500622_0001521 Ga0500622_0001521_8614_9444 274
606 3300055283 Ga0500661_001001 Ga0500661_001001_3351_4217 274
607 3300001979 JGI24740J21852_10002764 JGI24740J21852_100027644 275
608 3300003187 JGI25151J46595_10005710 JGI25151J46595_100057105 275
609 3300003187 JGI25151J46595_10031914 JGI25151J46595_100319142 275
610 3300003759 Ga0055525_1000004 Ga0055525_1000004641 275
611 3300005262 Ga0065165_1008081 Ga0065165_10080813 275
612 3300005262 Ga0065165_1019554 Ga0065165_10195542 275
613 3300005262 Ga0065165_1048047 Ga0065165_10480471 275
614 3300005288 Ga0065714_10069965 Ga0065714_100699654 275
615 3300005289 Ga0065704_10153150 Ga0065704_101531502 275
616 3300005331 Ga0070670_100039689 Ga0070670_1000396892 275
617 3300005334 Ga0068869_100122717 Ga0068869_1001227172 275
618 3300005338 Ga0068868_100012661 Ga0068868_1000126612 275
619 3300005338 Ga0068868_100049498 Ga0068868_1000494982 275
620 3300005344 Ga0070661_100359613 Ga0070661_1003596131 275
621 3300005356 Ga0070674_100107379 Ga0070674_1001073792 275
622 3300005366 Ga0070659_100003416 Ga0070659_10000341610 275
623 3300005456 Ga0070678_100242500 Ga0070678_1002425001 275
624 3300005530 Ga0070679_100027204 Ga0070679_1000272046 275
625 3300005563 Ga0068855_100205702 Ga0068855_1002057022 275
626 3300005564 Ga0070664_100385085 Ga0070664_1003850852 275
627 3300005841 Ga0068863_100553101 Ga0068863_1005531011 275
628 3300005844 Ga0068862_100218395 Ga0068862_1002183952 275
629 3300006048 Ga0075363_100022955 Ga0075363_1000229552 275
630 3300006051 Ga0075364_10019243 Ga0075364_100192432 275
631 3300006177 Ga0075362_10011298 Ga0075362_100112982 275
632 3300006177 Ga0075362_10070479 Ga0075362_100704792 275
633 3300006195 Ga0075366_10010643 Ga0075366_100106435 275
634 3300006195 Ga0075366_10246065 Ga0075366_102460652 275
635 3300006353 Ga0075370_10001192 Ga0075370_100011929 275
636 3300006353 Ga0075370_10001802 Ga0075370_100018025 275
637 3300006946 Ga0079104_1000003 Ga0079104_1000003167 275
638 3300009092 Ga0105250_10006305 Ga0105250_100063053 275
639 3300009098 Ga0105245_10281638 Ga0105245_102816381 275
640 3300009148 Ga0105243_10000895 Ga0105243_1000089521 275
641 3300009174 Ga0105241_10049659 Ga0105241_100496593 275
642 3300009176 Ga0105242_10003270 Ga0105242_100032706 275
643 3300013104 Ga0157370_10001585 Ga0157370_100015857 275
644 3300013297 Ga0157378_10284520 Ga0157378_102845201 275
645 3300014497 Ga0182008_10005352 Ga0182008_100053522 275
646 3300014968 Ga0157379_10235902 Ga0157379_102359022 275
647 3300014969 Ga0157376_10070386 Ga0157376_100703862 275
648 3300015262 Ga0182007_10000761 Ga0182007_100007616 275
649 3300015683 Ga0183362_10001 Ga0183362_10001306 275
650 3300017792 Ga0163161_10000127 Ga0163161_1000012730 275
651 3300021361 Ga0213872_10000012 Ga0213872_10000012146 275
652 3300025230 Ga0209563_100013 Ga0209563_100013642 275
653 3300025245 Ga0207425_1006514 Ga0207425_10065142 275
654 3300025263 Ga0209565_1002030 Ga0209565_10020306 275
655 3300025291 Ga0209675_1002912 Ga0209675_10029122 275
656 3300025294 Ga0209025_1005103 Ga0209025_10051035 275
657 3300025294 Ga0209025_1033082 Ga0209025_10330822 275
658 3300025297 Ga0209758_1003237 Ga0209758_10032372 275
659 3300025298 Ga0209050_1004909 Ga0209050_10049094 275
660 3300025711 Ga0207696_1005757 Ga0207696_10057572 275
661 3300025911 Ga0207654_10043309 Ga0207654_100433092 275
662 3300025920 Ga0207649_10002113 Ga0207649_1000211311 275
663 3300025927 Ga0207687_10182831 Ga0207687_101828312 275
664 3300025932 Ga0207690_10001070 Ga0207690_1000107015 275
665 3300025934 Ga0207686_10003771 Ga0207686_100037713 275
666 3300025935 Ga0207709_10000032 Ga0207709_1000003257 275
667 3300025945 Ga0207679_10000119 Ga0207679_1000011927 275
668 3300025945 Ga0207679_10417696 Ga0207679_104176961 275
669 3300026023 Ga0207677_10006076 Ga0207677_100060762 275
670 3300026023 Ga0207677_10023415 Ga0207677_100234152 275
671 3300026041 Ga0207639_10366866 Ga0207639_103668661 275
672 3300026088 Ga0207641_10514052 Ga0207641_105140522 275
673 3300026121 Ga0207683_10044447 Ga0207683_100444473 275
674 3300027111 Ga0209281_1000002 Ga0209281_10000021383 275
675 3300027614 Ga0209970_1000301 Ga0209970_10003014 275
676 3300027682 Ga0209971_1002004 Ga0209971_10020042 275
677 3300027876 Ga0209974_10002829 Ga0209974_100028294 275
678 3300028794 Ga0307515_10002745 Ga0307515_100027459 275
679 3300028794 Ga0307515_10357348 Ga0307515_103573482 275
680 3300030744 Ga0316181_1225858 Ga0316181_12258581 275
681 3300030745 Ga0316182_1383265 Ga0316182_13832652 275
682 3300031251 Ga0265327_10063536 Ga0265327_100635362 275
683 3300031456 Ga0307513_10000004 Ga0307513_10000004122 275
684 3300031456 Ga0307513_10000015 Ga0307513_10000015200 275
685 3300031548 Ga0307408_100000438 Ga0307408_1000004386 275
686 3300031548 Ga0307408_100013539 Ga0307408_1000135393 275
687 3300031730 Ga0307516_10008369 Ga0307516_100083696 275
688 3300031730 Ga0307516_10384694 Ga0307516_103846942 275
689 3300031731 Ga0307405_10018659 Ga0307405_100186593 275
690 3300031901 Ga0307406_10003154 Ga0307406_100031545 275
691 3300032005 Ga0307411_10103341 Ga0307411_101033412 275
692 3300038443 Ga0395901_0052433 Ga0395901_0052433_1056_1889 275
693 3300038443 Ga0395901_0422809 Ga0395901_0422809_299_1132 275
694 3300039447 Ga0436361_0351372 Ga0436361_0351372_172972_173805 275
695 3300041404 Ga0439436_0018183 Ga0439436_0018183_582_1448 275
696 3300041406 Ga0439439_0016744 Ga0439439_0016744_456_1298 275
697 3300041406 Ga0439439_0018549 Ga0439439_0018549_303_1169 275
698 3300041410 Ga0439461_0039080 Ga0439461_0039080_52_894 275
699 3300041411 Ga0439466_0003623 Ga0439466_0003623_3506_4372 275
700 3300041411 Ga0439466_0013250 Ga0439466_0013250_1587_2429 275
701 3300041413 Ga0439465_0000190 Ga0439465_0000190_7963_8829 275
702 3300041997 Ga0439431_0002480 Ga0439431_0002480_2883_3749 275
703 3300041999 Ga0439433_0004698 Ga0439433_0004698_355_1221 275
704 3300042002 Ga0439442_003056 Ga0439442_003056_406_1248 275
705 3300042004 Ga0439445_0000419 Ga0439445_0000419_7107_7973 275
706 3300042004 Ga0439445_0011266 Ga0439445_0011266_942_1784 275
707 3300042006 Ga0439432_005267 Ga0439432_005267_1844_2710 275
708 3300042006 Ga0439432_011515 Ga0439432_011515_1776_2618 275
709 3300042006 Ga0439432_024928 Ga0439432_024928_1008_1850 275
710 3300042007 Ga0439449_0000309 Ga0439449_0000309_9766_10632 275
711 3300042007 Ga0439449_0001242 Ga0439449_0001242_521_1363 275
712 3300042010 Ga0439452_008042 Ga0439452_008042_283_1149 275
713 3300042010 Ga0439452_011631 Ga0439452_011631_52_894 275
714 3300042011 Ga0439454_010767 Ga0439454_010767_274_1116 275
715 3300042014 Ga0439457_002197 Ga0439457_002197_188_1054 275
716 3300042015 Ga0439462_0001981 Ga0439462_0001981_3629_4471 275
717 3300042015 Ga0439462_0007852 Ga0439462_0007852_1468_2334 275
718 3300042115 Ga0450911_001236 Ga0450911_001236_1025_1867 275
719 3300042125 Ga0450923_023196 Ga0450923_023196_354_1196 275
720 3300042129 Ga0450891_005902 Ga0450891_005902_216_1058 275
721 3300042134 Ga0450898_002139 Ga0450898_002139_1174_2016 275
722 3300042146 Ga0450907_012319 Ga0450907_012319_483_1325 275
723 3300042156 Ga0439446_0014496 Ga0439446_0014496_1062_1928 275
724 3300042435 Ga0439434_0009388 Ga0439434_0009388_1623_2465 275
725 3300042437 Ga0439444_0022321 Ga0439444_0022321_209_1045 275
726 3300042532 Ga0450893_0008270 Ga0450893_0008270_774_1616 275
727 3300044673 Ga0453683_0040675 Ga0453683_0040675_1603_2463 275
728 3300044712 Ga0453684_0090343 Ga0453684_0090343_291_1151 275
729 3300044901 Ga0466960_0008084 Ga0466960_0008084_2459_3301 275
730 3300045051 Ga0451576_0002054 Ga0451576_0002054_21136_21996 275
731 3300045051 Ga0451576_0088950 Ga0451576_0088950_1560_2393 275
732 3300046462 Ga0495651_0154285 Ga0495651_0154285_62_913 275
733 3300046475 Ga0495639_0007335 Ga0495639_0007335_3063_3914 275
734 3300046525 Ga0495663_0032179 Ga0495663_0032179_232_1074 275
735 3300046529 Ga0495652_0196884 Ga0495652_0196884_260_1105 275
736 3300046530 Ga0495654_0014865 Ga0495654_0014865_817_1671 275
737 3300046557 Ga0495622_0081763 Ga0495622_0081763_612_1463 275
738 3300046558 Ga0495633_0001247 Ga0495633_0001247_9703_10545 275
739 3300046615 Ga0495656_0001853 Ga0495656_0001853_1517_2368 275
740 3300046674 Ga0495588_0071422 Ga0495588_0071422_438_1289 275
741 3300046683 Ga0495658_0206473 Ga0495658_0206473_156_1007 275
742 3300046691 Ga0495670_0034111 Ga0495670_0034111_879_1730 275
743 3300048903 Ga0496100_0189770 Ga0496100_0189770_463_1314 275
744 3300048904 Ga0496101_0020434 Ga0496101_0020434_3491_4333 275
745 3300048905 Ga0496102_0002618 Ga0496102_0002618_12014_12865 275
746 3300048908 Ga0496105_0030209 Ga0496105_0030209_2250_3101 275
747 3300048909 Ga0496106_0274792 Ga0496106_0274792_340_1191 275
748 3300048911 Ga0496108_0025470 Ga0496108_0025470_3121_3972 275
749 3300048911 Ga0496108_0242916 Ga0496108_0242916_139_990 275
750 3300048915 Ga0496112_0401830 Ga0496112_0401830_82_933 275
751 3300048916 Ga0496113_0111509 Ga0496113_0111509_479_1330 275
752 3300048917 Ga0496114_0206885 Ga0496114_0206885_310_1161 275
753 3300048919 Ga0496116_0022753 Ga0496116_0022753_489_1340 275
754 3300048920 Ga0496117_0014121 Ga0496117_0014121_2022_2873 275
755 3300048924 Ga0496121_0178025 Ga0496121_0178025_144_995 275
756 3300048925 Ga0496122_0115029 Ga0496122_0115029_51_893 275
757 3300048928 Ga0496125_0110007 Ga0496125_0110007_1102_1944 275
758 3300048929 Ga0496126_0141855 Ga0496126_0141855_1178_2020 275
759 3300049568 Ga0501031_0001227 Ga0501031_0001227_1003_1845 275
760 3300049573 Ga0501037_0015776 Ga0501037_0015776_2067_2912 275
761 3300049663 Ga0501223_001770 Ga0501223_001770_2117_2959 275
762 3300049679 Ga0501249_016997 Ga0501249_016997_684_1526 275
763 3300049763 Ga0501266_000779 Ga0501266_000779_679_1521 275
764 3300049823 Ga0501044_0510063 Ga0501044_0510063_147_1019 275
765 3300050489 nmdc:mga03683_1093_c2 nmdc:mga03683_1093_c2_1750_2592 275
766 3300050490 nmdc:mga03n38_37354_c1 nmdc:mga03n38_37354_c1_562_1404 275
767 3300050491 nmdc:mga00v17_17446_c1 nmdc:mga00v17_17446_c1_1785_2627 275
768 3300050493 nmdc:mga0k408_107619_c1 nmdc:mga0k408_107619_c1_28_870 275
769 3300050493 nmdc:mga0k408_112728_c1 nmdc:mga0k408_112728_c1_577_1419 275
770 3300050493 nmdc:mga0k408_33798_c1 nmdc:mga0k408_33798_c1_1095_1937 275
771 3300050496 nmdc:mga07m45_28235_c1 nmdc:mga07m45_28235_c1_985_1827 275
772 3300053093 Ga0500651_0002431 Ga0500651_0002431_6942_7793 275
773 3300053122 Ga0500608_016431 Ga0500608_016431_881_1726 275
774 3300053730 Ga0500645_000805 Ga0500645_000805_1545_2414 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

35

211

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dfj-assembly1.cif.gz_B crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a 0.9499 1 267
2dfj-assembly1.cif.gz_B crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a 0.943 1 267
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.8308 2 268
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.7712 2 268
4j6o-assembly2.cif.gz_B crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp 0.6764 2 275
ID Description Score Start End Superfamily
2dfjA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9515 1 267 3.60.21.10
2dfjA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9446 1 267 3.60.21.10
af_A0A0R0FVP8_67_225_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8941 1 66 3.60.21.10
af_Q4E243_1_156_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8764 4 66 3.60.21.10
2qjcA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8208 2 268 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A521YCH7-F1-model_v4 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) 0.9924 1 274 GO:0008803
AF-A0A0Q7AY02-F1-model_v4 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) 0.9921 1 268 GO:0008803
AF-A0A227J1T3-F1-model_v4 Bis(5'-nucleosyl)-tetraphosphatase 0.9921 6 101 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A4Q5TMZ8-F1-model_v4 deleted 0.9914 2 269
AF-A0A7Y5UL75-F1-model_v4 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase) 0.9908 1 275 GO:0008803

Feature Viewer

pLDDT pTM Quality
94.79 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map