F480225
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 774 | 308 | 1548 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1010022|Ga0079104_10100223 |
| Length | 299 |
| Sequence | MENGQPLARPKPAGKAAANESQIEWRLDSAAATSHFPEQQNGEEXXMSEEVLVSVADGVLEVTINRPEARNAMSKAVAEGISAAMDRLEAENDLRCAILTGAGGTFCSGMDLKGFLAGEMPIVPGRGFGGLTDWTPKKPVIAAVDGFALAGGMELALACDMIVAHTDAKFGIPEAKRGLVAGGGGVVHLPRLLPRQLAMELALTGDPITARRAYELGLVNRVTDGPAIEAARALARTIAENGPLAVAASKAIIRDSWLWDVAELNAKQGPYIAAVFMSEDAREGATAFAQKRKPEWKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 137 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 138 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 140 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 168 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 294 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 295 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 296 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 300 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 301 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 302 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 303 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 304 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 305 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 306 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 307 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 308 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.78 |
| Nodule | 0.13 |
| Rhizoplane | 2.84 |
| Rhizosphere | 89.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0079104_1010022 | 3300006946 | Bacteria | 3157 |
| 2 | SwRhRL2b_contig_580954 | 2162886007 | Bacteria | 12792 |
| 3 | MRS1b_contig_2119021 | 2162886011 | Unclassified | 1248 |
| 4 | rootL2_10257678 | 3300003322 | Bacteria | 1801 |
| 5 | Ga0065704_10070372 | 3300005289 | Bacteria | 28821 |
| 6 | Ga0065715_10258604 | 3300005293 | Bacteria | 1145 |
| 7 | Ga0065707_10000474 | 3300005295 | Bacteria | 37237 |
| 8 | Ga0065707_10001944 | 3300005295 | Bacteria | 9205 |
| 9 | Ga0065707_10039849 | 3300005295 | Unclassified | 944 |
| 10 | Ga0065707_10100554 | 3300005295 | Bacteria | 2922 |
| 11 | Ga0070658_10000394 | 3300005327 | Bacteria | 37936 |
| 12 | Ga0070683_100017502 | 3300005329 | Bacteria | 6335 |
| 13 | Ga0070683_100188918 | 3300005329 | Bacteria | 1956 |
| 14 | Ga0070683_100215039 | 3300005329 | Bacteria | 1826 |
| 15 | Ga0070703_10063611 | 3300005406 | Unclassified | 1213 |
| 16 | Ga0070709_10000473 | 3300005434 | Bacteria | 23818 |
| 17 | Ga0070709_10146325 | 3300005434 | Bacteria | 1628 |
| 18 | Ga0070714_100000688 | 3300005435 | Bacteria | 23874 |
| 19 | Ga0070714_100010843 | 3300005435 | Bacteria | 7219 |
| 20 | Ga0070714_100017227 | 3300005435 | Bacteria | 5850 |
| 21 | Ga0070714_100020820 | 3300005435 | Bacteria | 5360 |
| 22 | Ga0070714_100066392 | 3300005435 | Bacteria | 3109 |
| 23 | Ga0070714_100110607 | 3300005435 | Bacteria | 2432 |
| 24 | Ga0070714_100124417 | 3300005435 | Unclassified | 2297 |
| 25 | Ga0070714_100143347 | 3300005435 | Bacteria | 2147 |
| 26 | Ga0070714_100207599 | 3300005435 | Bacteria | 1794 |
| 27 | Ga0070714_100281209 | 3300005435 | Bacteria | 1546 |
| 28 | Ga0070713_100000648 | 3300005436 | Bacteria | 22247 |
| 29 | Ga0070713_100035457 | 3300005436 | Bacteria | 4016 |
| 30 | Ga0070713_100054007 | 3300005436 | Bacteria | 3331 |
| 31 | Ga0070713_100104746 | 3300005436 | Bacteria | 2456 |
| 32 | Ga0070713_100322210 | 3300005436 | Bacteria | 1428 |
| 33 | Ga0070713_100358938 | 3300005436 | Bacteria | 1353 |
| 34 | Ga0070713_100388600 | 3300005436 | Bacteria | 1301 |
| 35 | Ga0070713_100389948 | 3300005436 | Bacteria | 1299 |
| 36 | Ga0070710_10001154 | 3300005437 | Bacteria | 12504 |
| 37 | Ga0070710_10001779 | 3300005437 | Bacteria | 10194 |
| 38 | Ga0070710_10037902 | 3300005437 | Bacteria | 2645 |
| 39 | Ga0070710_10085405 | 3300005437 | Bacteria | 1851 |
| 40 | Ga0070710_10110065 | 3300005437 | Bacteria | 1653 |
| 41 | Ga0070710_10537356 | 3300005437 | Bacteria | 805 |
| 42 | Ga0070711_100006427 | 3300005439 | Bacteria | 7089 |
| 43 | Ga0070711_100019082 | 3300005439 | Bacteria | 4392 |
| 44 | Ga0070711_100029016 | 3300005439 | Bacteria | 3646 |
| 45 | Ga0070711_100340650 | 3300005439 | Bacteria | 1203 |
| 46 | Ga0070705_100102762 | 3300005440 | Bacteria | 1808 |
| 47 | Ga0070700_100271087 | 3300005441 | Unclassified | 1226 |
| 48 | Ga0070694_100430937 | 3300005444 | Bacteria | 1038 |
| 49 | Ga0070708_100002326 | 3300005445 | Bacteria | 14705 |
| 50 | Ga0070708_100012830 | 3300005445 | Bacteria | 6844 |
| 51 | Ga0070708_100381198 | 3300005445 | Bacteria | 1329 |
| 52 | Ga0070708_100460030 | 3300005445 | Bacteria | 1200 |
| 53 | Ga0070678_100124274 | 3300005456 | Bacteria | 2040 |
| 54 | Ga0070706_100000498 | 3300005467 | Bacteria | 46152 |
| 55 | Ga0070706_100016333 | 3300005467 | Bacteria | 6858 |
| 56 | Ga0070706_100038070 | 3300005467 | Bacteria | 4441 |
| 57 | Ga0070706_100046112 | 3300005467 | Bacteria | 4023 |
| 58 | Ga0070706_100053723 | 3300005467 | Bacteria | 3718 |
| 59 | Ga0070706_100086671 | 3300005467 | Bacteria | 2901 |
| 60 | Ga0070706_100089395 | 3300005467 | Bacteria | 2856 |
| 61 | Ga0070706_100137121 | 3300005467 | Bacteria | 2283 |
| 62 | Ga0070707_100001191 | 3300005468 | Bacteria | 25607 |
| 63 | Ga0070707_100019926 | 3300005468 | Bacteria | 6322 |
| 64 | Ga0070707_100040521 | 3300005468 | Bacteria | 4456 |
| 65 | Ga0070707_100046079 | 3300005468 | Bacteria | 4172 |
| 66 | Ga0070707_100051340 | 3300005468 | Bacteria | 3954 |
| 67 | Ga0070707_100320144 | 3300005468 | Bacteria | 1507 |
| 68 | Ga0070707_100457513 | 3300005468 | Bacteria | 1237 |
| 69 | Ga0070698_100002077 | 3300005471 | Bacteria | 22271 |
| 70 | Ga0070698_100004361 | 3300005471 | Bacteria | 15555 |
| 71 | Ga0070698_100004522 | 3300005471 | Bacteria | 15282 |
| 72 | Ga0070698_100016425 | 3300005471 | Bacteria | 7812 |
| 73 | Ga0070698_100048157 | 3300005471 | Bacteria | 4356 |
| 74 | Ga0070698_100069606 | 3300005471 | Bacteria | 3532 |
| 75 | Ga0070698_100285469 | 3300005471 | Bacteria | 1582 |
| 76 | Ga0070698_100307720 | 3300005471 | Unclassified | 1515 |
| 77 | Ga0070699_100124497 | 3300005518 | Unclassified | 2268 |
| 78 | Ga0070699_100139735 | 3300005518 | Bacteria | 2138 |
| 79 | Ga0070699_100204391 | 3300005518 | Bacteria | 1757 |
| 80 | Ga0070699_100271566 | 3300005518 | Bacteria | 1518 |
| 81 | Ga0070699_100279677 | 3300005518 | Bacteria | 1495 |
| 82 | Ga0070679_100321372 | 3300005530 | Bacteria | 1497 |
| 83 | Ga0070697_100110142 | 3300005536 | Bacteria | 2294 |
| 84 | Ga0070697_100376810 | 3300005536 | Bacteria | 1229 |
| 85 | Ga0070695_100004219 | 3300005545 | Bacteria | 8411 |
| 86 | Ga0070695_100085454 | 3300005545 | Bacteria | 2095 |
| 87 | Ga0070695_100095119 | 3300005545 | Bacteria | 1996 |
| 88 | Ga0070696_100054452 | 3300005546 | Bacteria | 2788 |
| 89 | Ga0070665_100139610 | 3300005548 | Bacteria | 2427 |
| 90 | Ga0070704_100010739 | 3300005549 | Bacteria | 5579 |
| 91 | Ga0070704_100563808 | 3300005549 | Bacteria | 997 |
| 92 | Ga0068855_100094845 | 3300005563 | Bacteria | 3440 |
| 93 | Ga0068857_100238397 | 3300005577 | Bacteria | 1665 |
| 94 | Ga0068856_100143363 | 3300005614 | Bacteria | 2396 |
| 95 | Ga0068856_100353780 | 3300005614 | Bacteria | 1487 |
| 96 | Ga0068859_100382357 | 3300005617 | Bacteria | 1503 |
| 97 | Ga0068859_100426304 | 3300005617 | Bacteria | 1423 |
| 98 | Ga0068864_100075266 | 3300005618 | Bacteria | 2947 |
| 99 | Ga0068864_100352230 | 3300005618 | Unclassified | 1389 |
| 100 | Ga0068861_100056669 | 3300005719 | Bacteria | 2992 |
| 101 | Ga0068870_10095914 | 3300005840 | Unclassified | 1667 |
| 102 | Ga0068863_100000110 | 3300005841 | Bacteria | 86415 |
| 103 | Ga0068858_100012942 | 3300005842 | Bacteria | 7868 |
| 104 | Ga0068858_100371771 | 3300005842 | Bacteria | 1371 |
| 105 | Ga0068860_100432464 | 3300005843 | Bacteria | 1306 |
| 106 | Ga0068862_100093248 | 3300005844 | Unclassified | 2626 |
| 107 | Ga0081540_1000946 | 3300005983 | Bacteria | 26162 |
| 108 | Ga0081540_1060734 | 3300005983 | Bacteria | 1806 |
| 109 | Ga0070717_10012201 | 3300006028 | Bacteria | 6552 |
| 110 | Ga0070717_10030864 | 3300006028 | Bacteria | 4307 |
| 111 | Ga0070717_10035901 | 3300006028 | Bacteria | 4017 |
| 112 | Ga0070717_10101699 | 3300006028 | Bacteria | 2441 |
| 113 | Ga0070717_10108265 | 3300006028 | Bacteria | 2367 |
| 114 | Ga0070717_10229557 | 3300006028 | Bacteria | 1634 |
| 115 | Ga0070717_10278333 | 3300006028 | Bacteria | 1483 |
| 116 | Ga0070717_10318931 | 3300006028 | Bacteria | 1384 |
| 117 | Ga0070717_10337095 | 3300006028 | Bacteria | 1346 |
| 118 | Ga0070717_10353220 | 3300006028 | Bacteria | 1315 |
| 119 | Ga0075365_10095106 | 3300006038 | Bacteria | 2034 |
| 120 | Ga0075368_10000712 | 3300006042 | Bacteria | 10157 |
| 121 | Ga0075363_100013423 | 3300006048 | Bacteria | 3971 |
| 122 | Ga0075364_10004972 | 3300006051 | Bacteria | 7707 |
| 123 | Ga0075364_10023118 | 3300006051 | Bacteria | 3933 |
| 124 | Ga0075364_10144337 | 3300006051 | Bacteria | 1602 |
| 125 | Ga0070715_10006152 | 3300006163 | Bacteria | 4063 |
| 126 | Ga0070715_10010274 | 3300006163 | Bacteria | 3332 |
| 127 | Ga0070715_10010576 | 3300006163 | Bacteria | 3293 |
| 128 | Ga0070715_10051413 | 3300006163 | Unclassified | 1773 |
| 129 | Ga0070715_10177573 | 3300006163 | Bacteria | 1065 |
| 130 | Ga0070716_100000129 | 3300006173 | Bacteria | 30072 |
| 131 | Ga0070716_100000802 | 3300006173 | Bacteria | 13502 |
| 132 | Ga0070716_100018387 | 3300006173 | Bacteria | 3640 |
| 133 | Ga0070716_100065415 | 3300006173 | Bacteria | 2117 |
| 134 | Ga0070712_100008716 | 3300006175 | Bacteria | 6388 |
| 135 | Ga0070712_100029529 | 3300006175 | Bacteria | 3676 |
| 136 | Ga0070712_100124319 | 3300006175 | Bacteria | 1946 |
| 137 | Ga0070712_100153931 | 3300006175 | Bacteria | 1768 |
| 138 | Ga0070712_100183719 | 3300006175 | Bacteria | 1631 |
| 139 | Ga0070712_100271902 | 3300006175 | Bacteria | 1362 |
| 140 | Ga0075362_10000030 | 3300006177 | Bacteria | 56135 |
| 141 | Ga0075362_10000514 | 3300006177 | Bacteria | 11306 |
| 142 | Ga0075367_10000680 | 3300006178 | Bacteria | 13033 |
| 143 | Ga0075369_10008612 | 3300006186 | Bacteria | 3933 |
| 144 | Ga0075366_10000025 | 3300006195 | Bacteria | 51813 |
| 145 | Ga0075366_10068517 | 3300006195 | Bacteria | 2111 |
| 146 | Ga0075370_10000025 | 3300006353 | Bacteria | 52081 |
| 147 | Ga0075370_10128111 | 3300006353 | Bacteria | 1480 |
| 148 | Ga0068871_100036040 | 3300006358 | Bacteria | 3936 |
| 149 | Ga0075428_100010326 | 3300006844 | Bacteria | 10363 |
| 150 | Ga0075428_100211095 | 3300006844 | Bacteria | 2098 |
| 151 | Ga0075430_100074554 | 3300006846 | Bacteria | 2845 |
| 152 | Ga0075430_100159350 | 3300006846 | Bacteria | 1879 |
| 153 | Ga0075430_100234868 | 3300006846 | Bacteria | 1520 |
| 154 | Ga0075431_100085715 | 3300006847 | Bacteria | 3251 |
| 155 | Ga0075431_100180878 | 3300006847 | Bacteria | 2164 |
| 156 | Ga0075433_10025150 | 3300006852 | Bacteria | 5033 |
| 157 | Ga0075433_10099815 | 3300006852 | Bacteria | 2570 |
| 158 | Ga0075433_10316196 | 3300006852 | Bacteria | 1382 |
| 159 | Ga0075434_100144378 | 3300006871 | Bacteria | 2400 |
| 160 | Ga0075434_100556351 | 3300006871 | Bacteria | 1167 |
| 161 | Ga0075429_100001215 | 3300006880 | Bacteria | 20912 |
| 162 | Ga0075429_100090802 | 3300006880 | Bacteria | 2664 |
| 163 | Ga0075429_100144822 | 3300006880 | Bacteria | 2080 |
| 164 | Ga0075429_100152388 | 3300006880 | Bacteria | 2024 |
| 165 | Ga0075429_100332825 | 3300006880 | Bacteria | 1329 |
| 166 | Ga0075429_100645662 | 3300006880 | Bacteria | 927 |
| 167 | Ga0075436_100038796 | 3300006914 | Bacteria | 3287 |
| 168 | Ga0075436_100090715 | 3300006914 | Bacteria | 2125 |
| 169 | Ga0075436_100098768 | 3300006914 | Bacteria | 2032 |
| 170 | Ga0097620_100382356 | 3300006931 | Bacteria | 1503 |
| 171 | Ga0075435_100028735 | 3300007076 | Bacteria | 4362 |
| 172 | Ga0075435_100089828 | 3300007076 | Bacteria | 2533 |
| 173 | Ga0111539_10072772 | 3300009094 | Bacteria | 4053 |
| 174 | Ga0111539_10320346 | 3300009094 | Bacteria | 1804 |
| 175 | Ga0105245_10026725 | 3300009098 | Bacteria | 5082 |
| 176 | Ga0105245_10114121 | 3300009098 | Bacteria | 2516 |
| 177 | Ga0105247_10026488 | 3300009101 | Bacteria | 3501 |
| 178 | Ga0114129_10001701 | 3300009147 | Bacteria | 30027 |
| 179 | Ga0114129_10005682 | 3300009147 | Bacteria | 17658 |
| 180 | Ga0114129_10012666 | 3300009147 | Bacteria | 12008 |
| 181 | Ga0114129_10029405 | 3300009147 | Bacteria | 7784 |
| 182 | Ga0114129_10061317 | 3300009147 | Bacteria | 5256 |
| 183 | Ga0114129_10296066 | 3300009147 | Bacteria | 2158 |
| 184 | Ga0105243_10004142 | 3300009148 | Bacteria | 11523 |
| 185 | Ga0105243_10138437 | 3300009148 | Unclassified | 2074 |
| 186 | Ga0105241_10017226 | 3300009174 | Bacteria | 5307 |
| 187 | Ga0105241_10209154 | 3300009174 | Bacteria | 1634 |
| 188 | Ga0105242_10203757 | 3300009176 | Bacteria | 1759 |
| 189 | Ga0105248_10034543 | 3300009177 | Bacteria | 5655 |
| 190 | Ga0105237_10215773 | 3300009545 | Bacteria | 1919 |
| 191 | Ga0105249_10888218 | 3300009553 | Bacteria | 958 |
| 192 | Ga0105246_10004394 | 3300011119 | Bacteria | 8581 |
| 193 | Ga0105246_10246914 | 3300011119 | Bacteria | 1414 |
| 194 | Ga0157369_10092704 | 3300013105 | Bacteria | 3224 |
| 195 | Ga0163162_10033505 | 3300013306 | Bacteria | 5106 |
| 196 | Ga0163163_10016251 | 3300014325 | Bacteria | 6910 |
| 197 | Ga0163163_10404361 | 3300014325 | Bacteria | 1424 |
| 198 | Ga0157380_10390300 | 3300014326 | Bacteria | 1317 |
| 199 | Ga0157379_10012910 | 3300014968 | Bacteria | 7308 |
| 200 | Ga0213876_10000316 | 3300021384 | Bacteria | 42531 |
| 201 | Ga0213875_10146492 | 3300021388 | Bacteria | 1106 |
| 202 | Ga0224572_1004304 | 3300024225 | Bacteria | 2465 |
| 203 | Ga0209257_1000156 | 3300025304 | Bacteria | 182335 |
| 204 | Ga0207692_10000827 | 3300025898 | Bacteria | 11092 |
| 205 | Ga0207692_10003582 | 3300025898 | Bacteria | 6077 |
| 206 | Ga0207692_10008078 | 3300025898 | Bacteria | 4342 |
| 207 | Ga0207692_10028221 | 3300025898 | Bacteria | 2652 |
| 208 | Ga0207710_10022307 | 3300025900 | Bacteria | 2717 |
| 209 | Ga0207685_10002508 | 3300025905 | Bacteria | 4226 |
| 210 | Ga0207699_10000746 | 3300025906 | Bacteria | 15540 |
| 211 | Ga0207699_10003094 | 3300025906 | Bacteria | 7905 |
| 212 | Ga0207699_10032523 | 3300025906 | Bacteria | 2939 |
| 213 | Ga0207643_10457964 | 3300025908 | Unclassified | 812 |
| 214 | Ga0207705_10031037 | 3300025909 | Bacteria | 3813 |
| 215 | Ga0207684_10000947 | 3300025910 | Bacteria | 32649 |
| 216 | Ga0207684_10004657 | 3300025910 | Bacteria | 12882 |
| 217 | Ga0207684_10024162 | 3300025910 | Bacteria | 5184 |
| 218 | Ga0207684_10028659 | 3300025910 | Bacteria | 4745 |
| 219 | Ga0207684_10058075 | 3300025910 | Bacteria | 3283 |
| 220 | Ga0207684_10139604 | 3300025910 | Bacteria | 2083 |
| 221 | Ga0207684_10188266 | 3300025910 | Bacteria | 1780 |
| 222 | Ga0207684_10210842 | 3300025910 | Bacteria | 1676 |
| 223 | Ga0207684_10610459 | 3300025910 | Bacteria | 931 |
| 224 | Ga0207684_10624282 | 3300025910 | Bacteria | 919 |
| 225 | Ga0207671_10134640 | 3300025914 | Bacteria | 1899 |
| 226 | Ga0207693_10001572 | 3300025915 | Bacteria | 20173 |
| 227 | Ga0207693_10005371 | 3300025915 | Bacteria | 10708 |
| 228 | Ga0207693_10006366 | 3300025915 | Bacteria | 9781 |
| 229 | Ga0207693_10106413 | 3300025915 | Bacteria | 2200 |
| 230 | Ga0207693_10133924 | 3300025915 | Bacteria | 1948 |
| 231 | Ga0207693_10380546 | 3300025915 | Bacteria | 1104 |
| 232 | Ga0207663_10002983 | 3300025916 | Bacteria | 8187 |
| 233 | Ga0207663_10009176 | 3300025916 | Bacteria | 5218 |
| 234 | Ga0207663_10032954 | 3300025916 | Bacteria | 3081 |
| 235 | Ga0207660_10392059 | 3300025917 | Bacteria | 1117 |
| 236 | Ga0207646_10000457 | 3300025922 | Bacteria | 54593 |
| 237 | Ga0207646_10003215 | 3300025922 | Bacteria | 18654 |
| 238 | Ga0207646_10006705 | 3300025922 | Bacteria | 11865 |
| 239 | Ga0207646_10173489 | 3300025922 | Bacteria | 1947 |
| 240 | Ga0207646_10265338 | 3300025922 | Bacteria | 1552 |
| 241 | Ga0207646_10361721 | 3300025922 | Unclassified | 1311 |
| 242 | Ga0207687_10098340 | 3300025927 | Bacteria | 2148 |
| 243 | Ga0207700_10001256 | 3300025928 | Bacteria | 14437 |
| 244 | Ga0207700_10002247 | 3300025928 | Bacteria | 11082 |
| 245 | Ga0207700_10002897 | 3300025928 | Bacteria | 9887 |
| 246 | Ga0207700_10126251 | 3300025928 | Bacteria | 2082 |
| 247 | Ga0207700_10136955 | 3300025928 | Bacteria | 2007 |
| 248 | Ga0207700_10508671 | 3300025928 | Bacteria | 1066 |
| 249 | Ga0207700_10518047 | 3300025928 | Bacteria | 1056 |
| 250 | Ga0207664_10000163 | 3300025929 | Bacteria | 53290 |
| 251 | Ga0207664_10001297 | 3300025929 | Bacteria | 16491 |
| 252 | Ga0207664_10003120 | 3300025929 | Bacteria | 11005 |
| 253 | Ga0207664_10004705 | 3300025929 | Bacteria | 9263 |
| 254 | Ga0207664_10008158 | 3300025929 | Bacteria | 7290 |
| 255 | Ga0207664_10026246 | 3300025929 | Bacteria | 4401 |
| 256 | Ga0207664_10141548 | 3300025929 | Bacteria | 2035 |
| 257 | Ga0207664_10164884 | 3300025929 | Bacteria | 1892 |
| 258 | Ga0207664_10178374 | 3300025929 | Bacteria | 1823 |
| 259 | Ga0207664_10343186 | 3300025929 | Bacteria | 1321 |
| 260 | Ga0207709_10264955 | 3300025935 | Bacteria | 1262 |
| 261 | Ga0207665_10000492 | 3300025939 | Bacteria | 26721 |
| 262 | Ga0207665_10001925 | 3300025939 | Bacteria | 13978 |
| 263 | Ga0207665_10093262 | 3300025939 | Bacteria | 2090 |
| 264 | Ga0207679_10461819 | 3300025945 | Bacteria | 1128 |
| 265 | Ga0207667_10248790 | 3300025949 | Bacteria | 1818 |
| 266 | Ga0207677_10071329 | 3300026023 | Bacteria | 2451 |
| 267 | Ga0207703_10031568 | 3300026035 | Bacteria | 4190 |
| 268 | Ga0207703_10075182 | 3300026035 | Bacteria | 2799 |
| 269 | Ga0207708_10058306 | 3300026075 | Unclassified | 2946 |
| 270 | Ga0207702_10040990 | 3300026078 | Bacteria | 3882 |
| 271 | Ga0207702_10189961 | 3300026078 | Bacteria | 1897 |
| 272 | Ga0207702_10299250 | 3300026078 | Bacteria | 1526 |
| 273 | Ga0207641_10364861 | 3300026088 | Bacteria | 1380 |
| 274 | Ga0207641_10692884 | 3300026088 | Bacteria | 1003 |
| 275 | Ga0207676_10280340 | 3300026095 | Unclassified | 1513 |
| 276 | Ga0207674_10188375 | 3300026116 | Bacteria | 2013 |
| 277 | Ga0207675_100451761 | 3300026118 | Bacteria | 1273 |
| 278 | Ga0207675_100708696 | 3300026118 | Unclassified | 1016 |
| 279 | Ga0207683_10342333 | 3300026121 | Bacteria | 1372 |
| 280 | Ga0209813_10000274 | 3300027866 | Bacteria | 14540 |
| 281 | Ga0268266_10073787 | 3300028379 | Bacteria | 2962 |
| 282 | Ga0268264_10181150 | 3300028381 | Bacteria | 1913 |
| 283 | Ga0265334_10000075 | 3300028573 | Bacteria | 72027 |
| 284 | Ga0265334_10000787 | 3300028573 | Bacteria | 15869 |
| 285 | Ga0265336_10027810 | 3300028666 | Bacteria | 1769 |
| 286 | Ga0307517_10125164 | 3300028786 | Bacteria | 1879 |
| 287 | Ga0307515_10112821 | 3300028794 | Bacteria | 3158 |
| 288 | Ga0265338_10001516 | 3300028800 | Bacteria | 37500 |
| 289 | Ga0265338_10003494 | 3300028800 | Bacteria | 22052 |
| 290 | Ga0265331_10087952 | 3300031250 | Bacteria | 1438 |
| 291 | Ga0307513_10338907 | 3300031456 | Bacteria | 1255 |
| 292 | Ga0307408_100084099 | 3300031548 | Bacteria | 2386 |
| 293 | Ga0307508_10000358 | 3300031616 | Bacteria | 55352 |
| 294 | Ga0307405_10050206 | 3300031731 | Bacteria | 2582 |
| 295 | Ga0307405_10056566 | 3300031731 | Bacteria | 2461 |
| 296 | Ga0307413_10004911 | 3300031824 | Bacteria | 5886 |
| 297 | Ga0307413_10120606 | 3300031824 | Bacteria | 1776 |
| 298 | Ga0307413_10384761 | 3300031824 | Bacteria | 1094 |
| 299 | Ga0307410_10056051 | 3300031852 | Bacteria | 2678 |
| 300 | Ga0307410_10071567 | 3300031852 | Bacteria | 2405 |
| 301 | Ga0307410_10261781 | 3300031852 | Bacteria | 1349 |
| 302 | Ga0307406_10109327 | 3300031901 | Bacteria | 1900 |
| 303 | Ga0307406_10208107 | 3300031901 | Bacteria | 1445 |
| 304 | Ga0307407_10106355 | 3300031903 | Bacteria | 1753 |
| 305 | Ga0307407_10348952 | 3300031903 | Bacteria | 1047 |
| 306 | Ga0307407_10377239 | 3300031903 | Bacteria | 1011 |
| 307 | Ga0307412_10104571 | 3300031911 | Bacteria | 2009 |
| 308 | Ga0307409_100030956 | 3300031995 | Bacteria | 3853 |
| 309 | Ga0307409_100202592 | 3300031995 | Bacteria | 1777 |
| 310 | Ga0307409_100435133 | 3300031995 | Bacteria | 1262 |
| 311 | Ga0307416_100023553 | 3300032002 | Bacteria | 4470 |
| 312 | Ga0307416_100543952 | 3300032002 | Bacteria | 1233 |
| 313 | Ga0307416_101033750 | 3300032002 | Bacteria | 925 |
| 314 | Ga0307411_10431405 | 3300032005 | Bacteria | 1097 |
| 315 | Ga0307415_100085229 | 3300032126 | Bacteria | 2269 |
| 316 | Ga0307415_100234530 | 3300032126 | Bacteria | 1480 |
| 317 | Ga0307415_100401219 | 3300032126 | Bacteria | 1171 |
| 318 | Ga0307510_10279443 | 3300033180 | Bacteria | 1141 |
| 319 | Ga0373958_0005096 | 3300034819 | Bacteria | 1979 |
| 320 | Ga0373938_0008365 | 3300034957 | Bacteria | 1847 |
| 321 | Ga0373926_0006191 | 3300035083 | Bacteria | 3968 |
| 322 | Ga0373929_0011384 | 3300035085 | Bacteria | 1676 |
| 323 | Ga0373934_0000009 | 3300035086 | Bacteria | 65270 |
| 324 | Ga0373934_0010206 | 3300035086 | Bacteria | 3525 |
| 325 | Ga0373934_0015450 | 3300035086 | Bacteria | 2896 |
| 326 | Ga0373934_0025343 | 3300035086 | Bacteria | 2296 |
| 327 | Ga0373934_0053680 | 3300035086 | Bacteria | 1599 |
| 328 | Ga0373934_0076733 | 3300035086 | Bacteria | 1340 |
| 329 | Ga0373934_0083107 | 3300035086 | Bacteria | 1287 |
| 330 | Ga0373940_0002002 | 3300035088 | Bacteria | 3858 |
| 331 | Ga0373944_0031421 | 3300035089 | Bacteria | 1598 |
| 332 | Ga0373923_0002178 | 3300035111 | Bacteria | 5943 |
| 333 | Ga0373923_0022362 | 3300035111 | Bacteria | 2479 |
| 334 | Ga0373923_0023144 | 3300035111 | Bacteria | 2442 |
| 335 | Ga0373923_0062924 | 3300035111 | Bacteria | 1579 |
| 336 | Ga0373932_0051754 | 3300035112 | Bacteria | 1221 |
| 337 | Ga0373932_0058424 | 3300035112 | Bacteria | 1165 |
| 338 | Ga0373936_0008408 | 3300035113 | Bacteria | 3885 |
| 339 | Ga0373936_0008636 | 3300035113 | Bacteria | 3837 |
| 340 | Ga0373936_0063099 | 3300035113 | Bacteria | 1516 |
| 341 | Ga0373945_0010474 | 3300035116 | Bacteria | 3052 |
| 342 | Ga0373945_0039771 | 3300035116 | Bacteria | 1696 |
| 343 | Ga0373953_0002138 | 3300035117 | Bacteria | 5913 |
| 344 | Ga0373953_0024748 | 3300035117 | Bacteria | 2285 |
| 345 | Ga0373953_0077069 | 3300035117 | Bacteria | 1382 |
| 346 | Ga0373953_0101999 | 3300035117 | Bacteria | 1208 |
| 347 | Ga0373954_0007063 | 3300035118 | Bacteria | 4899 |
| 348 | Ga0373954_0009990 | 3300035118 | Bacteria | 4180 |
| 349 | Ga0373954_0179113 | 3300035118 | Bacteria | 1039 |
| 350 | Ga0373956_0001552 | 3300035119 | Bacteria | 9480 |
| 351 | Ga0373956_0014066 | 3300035119 | Bacteria | 3337 |
| 352 | Ga0373956_0015851 | 3300035119 | Bacteria | 3161 |
| 353 | Ga0373956_0019659 | 3300035119 | Bacteria | 2866 |
| 354 | Ga0373956_0039690 | 3300035119 | Bacteria | 2087 |
| 355 | Ga0373956_0158113 | 3300035119 | Bacteria | 1067 |
| 356 | Ga0373957_0000912 | 3300035120 | Bacteria | 7724 |
| 357 | Ga0373957_0008199 | 3300035120 | Bacteria | 3374 |
| 358 | Ga0373957_0132443 | 3300035120 | Bacteria | 1015 |
| 359 | Ga0373943_0021543 | 3300035170 | Bacteria | 2977 |
| 360 | Ga0373943_0197823 | 3300035170 | Bacteria | 1111 |
| 361 | Ga0373946_0240218 | 3300035171 | Bacteria | 880 |
| 362 | Ga0373955_0000188 | 3300035172 | Bacteria | 25471 |
| 363 | Ga0373955_0025684 | 3300035172 | Bacteria | 3028 |
| 364 | Ga0373955_0052506 | 3300035172 | Bacteria | 2223 |
| 365 | Ga0373955_0085064 | 3300035172 | Bacteria | 1794 |
| 366 | Ga0373955_0202915 | 3300035172 | Bacteria | 1181 |
| 367 | Ga0373924_0003313 | 3300035410 | Bacteria | 5522 |
| 368 | Ga0373924_0035930 | 3300035410 | Bacteria | 2011 |
| 369 | Ga0373924_0040296 | 3300035410 | Bacteria | 1911 |
| 370 | Ga0373924_0041128 | 3300035410 | Bacteria | 1893 |
| 371 | Ga0373924_0097203 | 3300035410 | Bacteria | 1264 |
| 372 | Ga0373931_0052548 | 3300035691 | Bacteria | 2172 |
| 373 | Ga0373935_0043939 | 3300035692 | Bacteria | 2814 |
| 374 | Ga0373935_0052116 | 3300035692 | Bacteria | 2600 |
| 375 | Ga0373935_0055270 | 3300035692 | Bacteria | 2529 |
| 376 | Ga0373935_0150568 | 3300035692 | Bacteria | 1578 |
| 377 | Ga0373935_0193103 | 3300035692 | Bacteria | 1403 |
| 378 | Ga0373927_0218468 | 3300035695 | Bacteria | 1252 |
| 379 | Ga0373933_0000140 | 3300035724 | Bacteria | 46689 |
| 380 | Ga0373933_0039199 | 3300035724 | Bacteria | 2786 |
| 381 | Ga0373933_0042996 | 3300035724 | Bacteria | 2671 |
| 382 | Ga0373933_0108862 | 3300035724 | Bacteria | 1726 |
| 383 | Ga0373933_0131296 | 3300035724 | Bacteria | 1575 |
| 384 | Ga0373947_0000009 | 3300035725 | Bacteria | 172751 |
| 385 | Ga0373947_0156208 | 3300035725 | Bacteria | 1472 |
| 386 | Ga0373947_0201066 | 3300035725 | Bacteria | 1303 |
| 387 | Ga0373937_0000093 | 3300036401 | Bacteria | 82615 |
| 388 | Ga0373937_0004159 | 3300036401 | Bacteria | 12270 |
| 389 | Ga0373937_0043299 | 3300036401 | Bacteria | 4108 |
| 390 | Ga0373937_0091404 | 3300036401 | Bacteria | 2820 |
| 391 | Ga0373937_0182035 | 3300036401 | Bacteria | 1973 |
| 392 | Ga0373937_0194606 | 3300036401 | Bacteria | 1905 |
| 393 | Ga0373937_0322833 | 3300036401 | Bacteria | 1461 |
| 394 | Ga0373937_0604050 | 3300036401 | Bacteria | 1041 |
| 395 | Ga0372808_008950 | 3300036459 | Bacteria | 1393 |
| 396 | Ga0373925_0001098 | 3300037068 | Bacteria | 24229 |
| 397 | Ga0373925_0003506 | 3300037068 | Bacteria | 12126 |
| 398 | Ga0373925_0010763 | 3300037068 | Bacteria | 6632 |
| 399 | Ga0373925_0011451 | 3300037068 | Bacteria | 6421 |
| 400 | Ga0373925_0071914 | 3300037068 | Bacteria | 2616 |
| 401 | Ga0373925_0142844 | 3300037068 | Bacteria | 1874 |
| 402 | Ga0373925_0173405 | 3300037068 | Bacteria | 1703 |
| 403 | Ga0436364_0481895 | 3300037853 | Bacteria | 2311 |
| 404 | Ga0436364_0855612 | 3300037853 | Bacteria | 1547 |
| 405 | Ga0395901_0383747 | 3300038443 | Bacteria | 1446 |
| 406 | Ga0436365_0585577 | 3300039437 | Bacteria | 67545 |
| 407 | Ga0436361_0260762 | 3300039447 | Bacteria | 1483 |
| 408 | Ga0436363_0988497 | 3300039450 | Bacteria | 1162 |
| 409 | Ga0451577_0096131 | 3300042876 | Unclassified | 2645 |
| 410 | Ga0451577_0132538 | 3300042876 | Bacteria | 2236 |
| 411 | Ga0451577_0310863 | 3300042876 | Unclassified | 1428 |
| 412 | Ga0466972_0175280 | 3300044658 | Bacteria | 1006 |
| 413 | Ga0466966_0034316 | 3300044684 | Bacteria | 3281 |
| 414 | Ga0466966_0163938 | 3300044684 | Bacteria | 1353 |
| 415 | Ga0466961_0077007 | 3300044693 | Bacteria | 2113 |
| 416 | Ga0466961_0258063 | 3300044693 | Bacteria | 1069 |
| 417 | Ga0466963_0251467 | 3300044694 | Bacteria | 1240 |
| 418 | Ga0466963_0464968 | 3300044694 | Bacteria | 893 |
| 419 | Ga0466963_0503481 | 3300044694 | Bacteria | 855 |
| 420 | Ga0453684_0031838 | 3300044712 | Bacteria | 7397 |
| 421 | Ga0453684_0052129 | 3300044712 | Bacteria | 5354 |
| 422 | Ga0453684_0055845 | 3300044712 | Bacteria | 5130 |
| 423 | Ga0453684_0076790 | 3300044712 | Bacteria | 4192 |
| 424 | Ga0453684_0194303 | 3300044712 | Bacteria | 2371 |
| 425 | Ga0453684_0372028 | 3300044712 | Bacteria | 1606 |
| 426 | Ga0466959_0078805 | 3300045049 | Bacteria | 2376 |
| 427 | Ga0466959_0248647 | 3300045049 | Bacteria | 1227 |
| 428 | Ga0451576_0008853 | 3300045051 | Bacteria | 11757 |
| 429 | Ga0451576_0300131 | 3300045051 | Bacteria | 1680 |
| 430 | Ga0451576_0476176 | 3300045051 | Bacteria | 1311 |
| 431 | Ga0466958_0136773 | 3300045836 | Bacteria | 1541 |
| 432 | Ga0466958_0200491 | 3300045836 | Bacteria | 1270 |
| 433 | Ga0466958_0236727 | 3300045836 | Bacteria | 1166 |
| 434 | Ga0466958_0323600 | 3300045836 | Bacteria | 991 |
| 435 | Ga0466967_0120318 | 3300045976 | Bacteria | 2425 |
| 436 | Ga0466967_0262617 | 3300045976 | Bacteria | 1652 |
| 437 | Ga0466967_0358318 | 3300045976 | Bacteria | 1413 |
| 438 | Ga0495592_0000084 | 3300046454 | Bacteria | 82600 |
| 439 | Ga0495592_0032700 | 3300046454 | Bacteria | 3922 |
| 440 | Ga0495592_0065523 | 3300046454 | Bacteria | 2659 |
| 441 | Ga0495592_0134315 | 3300046454 | Bacteria | 1727 |
| 442 | Ga0495603_0022615 | 3300046455 | Bacteria | 3805 |
| 443 | Ga0495629_0008681 | 3300046459 | Bacteria | 7482 |
| 444 | Ga0495629_0056387 | 3300046459 | Bacteria | 2747 |
| 445 | Ga0495629_0169546 | 3300046459 | Bacteria | 1515 |
| 446 | Ga0495641_0019840 | 3300046461 | Bacteria | 3427 |
| 447 | Ga0495651_0000052 | 3300046462 | Bacteria | 85283 |
| 448 | Ga0495651_0002985 | 3300046462 | Bacteria | 13059 |
| 449 | Ga0495651_0009613 | 3300046462 | Bacteria | 7429 |
| 450 | Ga0495651_0069765 | 3300046462 | Bacteria | 2675 |
| 451 | Ga0495651_0153402 | 3300046462 | Bacteria | 1657 |
| 452 | Ga0495653_0031988 | 3300046463 | Bacteria | 4180 |
| 453 | Ga0495653_0040655 | 3300046463 | Bacteria | 3633 |
| 454 | Ga0495653_0084555 | 3300046463 | Bacteria | 2336 |
| 455 | Ga0495653_0094925 | 3300046463 | Bacteria | 2172 |
| 456 | Ga0495580_0042917 | 3300046472 | Bacteria | 3219 |
| 457 | Ga0495580_0115412 | 3300046472 | Bacteria | 1865 |
| 458 | Ga0495582_0002347 | 3300046473 | Bacteria | 10589 |
| 459 | Ga0495582_0004368 | 3300046473 | Bacteria | 7952 |
| 460 | Ga0495582_0153139 | 3300046473 | Bacteria | 1309 |
| 461 | Ga0495639_0071477 | 3300046475 | Bacteria | 1603 |
| 462 | Ga0495639_0124375 | 3300046475 | Bacteria | 1232 |
| 463 | Ga0495662_0026104 | 3300046476 | Bacteria | 2821 |
| 464 | Ga0495662_0047358 | 3300046476 | Bacteria | 2075 |
| 465 | Ga0495662_0162244 | 3300046476 | Bacteria | 1101 |
| 466 | Ga0495664_0028727 | 3300046477 | Bacteria | 3248 |
| 467 | Ga0495664_0040109 | 3300046477 | Bacteria | 2768 |
| 468 | Ga0495664_0077575 | 3300046477 | Bacteria | 1989 |
| 469 | Ga0495664_0138114 | 3300046477 | Bacteria | 1477 |
| 470 | Ga0495664_0152127 | 3300046477 | Bacteria | 1403 |
| 471 | Ga0495664_0171877 | 3300046477 | Bacteria | 1314 |
| 472 | Ga0495608_0000064 | 3300046511 | Bacteria | 82607 |
| 473 | Ga0495608_0000906 | 3300046511 | Bacteria | 20783 |
| 474 | Ga0495608_0012241 | 3300046511 | Bacteria | 5959 |
| 475 | Ga0495608_0018068 | 3300046511 | Bacteria | 4871 |
| 476 | Ga0495608_0062452 | 3300046511 | Bacteria | 2447 |
| 477 | Ga0495608_0181184 | 3300046511 | Bacteria | 1332 |
| 478 | Ga0495618_0020431 | 3300046514 | Bacteria | 4076 |
| 479 | Ga0495618_0055141 | 3300046514 | Bacteria | 2516 |
| 480 | Ga0495618_0133304 | 3300046514 | Bacteria | 1589 |
| 481 | Ga0495618_0147957 | 3300046514 | Bacteria | 1501 |
| 482 | Ga0495628_0013670 | 3300046516 | Bacteria | 6821 |
| 483 | Ga0495628_0032912 | 3300046516 | Bacteria | 4180 |
| 484 | Ga0495628_0044788 | 3300046516 | Bacteria | 3518 |
| 485 | Ga0495628_0052636 | 3300046516 | Bacteria | 3215 |
| 486 | Ga0495628_0091149 | 3300046516 | Bacteria | 2359 |
| 487 | Ga0495628_0101433 | 3300046516 | Bacteria | 2221 |
| 488 | Ga0495628_0112756 | 3300046516 | Bacteria | 2090 |
| 489 | Ga0495628_0195970 | 3300046516 | Bacteria | 1524 |
| 490 | Ga0495628_0355365 | 3300046516 | Bacteria | 1076 |
| 491 | Ga0495628_0363369 | 3300046516 | Bacteria | 1062 |
| 492 | Ga0495630_0021607 | 3300046517 | Bacteria | 4751 |
| 493 | Ga0495630_0046026 | 3300046517 | Bacteria | 3261 |
| 494 | Ga0495630_0053346 | 3300046517 | Bacteria | 3027 |
| 495 | Ga0495630_0186279 | 3300046517 | Bacteria | 1583 |
| 496 | Ga0495630_0312802 | 3300046517 | Bacteria | 1200 |
| 497 | Ga0495666_0017824 | 3300046526 | Bacteria | 3537 |
| 498 | Ga0495666_0094943 | 3300046526 | Bacteria | 1406 |
| 499 | Ga0495652_0003833 | 3300046529 | Bacteria | 14678 |
| 500 | Ga0495652_0007884 | 3300046529 | Bacteria | 9777 |
| 501 | Ga0495652_0027693 | 3300046529 | Bacteria | 4992 |
| 502 | Ga0495652_0039307 | 3300046529 | Bacteria | 4091 |
| 503 | Ga0495652_0061661 | 3300046529 | Bacteria | 3164 |
| 504 | Ga0495652_0135798 | 3300046529 | Bacteria | 1941 |
| 505 | Ga0495652_0140638 | 3300046529 | Bacteria | 1898 |
| 506 | Ga0495652_0192626 | 3300046529 | Bacteria | 1554 |
| 507 | Ga0495652_0265283 | 3300046529 | Unclassified | 1265 |
| 508 | Ga0495665_0003704 | 3300046531 | Bacteria | 8287 |
| 509 | Ga0495665_0080084 | 3300046531 | Bacteria | 1718 |
| 510 | Ga0495640_0009671 | 3300046533 | Bacteria | 7496 |
| 511 | Ga0495640_0024738 | 3300046533 | Bacteria | 4363 |
| 512 | Ga0495640_0034087 | 3300046533 | Bacteria | 3614 |
| 513 | Ga0495586_0006732 | 3300046535 | Bacteria | 6138 |
| 514 | Ga0495586_0016774 | 3300046535 | Bacteria | 3897 |
| 515 | Ga0495586_0030341 | 3300046535 | Bacteria | 2893 |
| 516 | Ga0495587_0000221 | 3300046536 | Bacteria | 42238 |
| 517 | Ga0495587_0010605 | 3300046536 | Bacteria | 5853 |
| 518 | Ga0495587_0012380 | 3300046536 | Bacteria | 5371 |
| 519 | Ga0495587_0017914 | 3300046536 | Bacteria | 4392 |
| 520 | Ga0495587_0175206 | 3300046536 | Bacteria | 1217 |
| 521 | Ga0495645_0029199 | 3300046543 | Bacteria | 4009 |
| 522 | Ga0495645_0055037 | 3300046543 | Bacteria | 2889 |
| 523 | Ga0495645_0240650 | 3300046543 | Bacteria | 1208 |
| 524 | Ga0495645_0380932 | 3300046543 | Bacteria | 902 |
| 525 | Ga0495633_0036205 | 3300046558 | Bacteria | 2365 |
| 526 | Ga0495667_0000156 | 3300046559 | Bacteria | 46657 |
| 527 | Ga0495667_0003041 | 3300046559 | Bacteria | 11251 |
| 528 | Ga0495667_0044147 | 3300046559 | Bacteria | 2952 |
| 529 | Ga0495667_0054818 | 3300046559 | Bacteria | 2622 |
| 530 | Ga0495667_0076706 | 3300046559 | Bacteria | 2174 |
| 531 | Ga0495667_0139027 | 3300046559 | Bacteria | 1565 |
| 532 | Ga0495667_0279366 | 3300046559 | Bacteria | 1060 |
| 533 | Ga0495634_0017932 | 3300046642 | Bacteria | 5045 |
| 534 | Ga0495634_0019524 | 3300046642 | Bacteria | 4814 |
| 535 | Ga0495634_0228563 | 3300046642 | Bacteria | 1145 |
| 536 | Ga0495611_0037042 | 3300046648 | Bacteria | 2167 |
| 537 | Ga0495625_0045826 | 3300046660 | Bacteria | 3159 |
| 538 | Ga0495625_0105630 | 3300046660 | Bacteria | 1929 |
| 539 | Ga0495635_0011746 | 3300046663 | Bacteria | 6141 |
| 540 | Ga0495635_0021778 | 3300046663 | Bacteria | 4467 |
| 541 | Ga0495657_0000383 | 3300046675 | Bacteria | 41345 |
| 542 | Ga0495657_0007636 | 3300046675 | Bacteria | 8330 |
| 543 | Ga0495657_0019396 | 3300046675 | Bacteria | 4905 |
| 544 | Ga0495657_0025432 | 3300046675 | Bacteria | 4203 |
| 545 | Ga0495657_0027950 | 3300046675 | Bacteria | 3971 |
| 546 | Ga0495599_0000224 | 3300046678 | Bacteria | 36160 |
| 547 | Ga0495599_0003852 | 3300046678 | Bacteria | 8821 |
| 548 | Ga0495599_0017522 | 3300046678 | Bacteria | 4451 |
| 549 | Ga0495599_0034691 | 3300046678 | Bacteria | 3169 |
| 550 | Ga0495599_0177536 | 3300046678 | Bacteria | 1313 |
| 551 | Ga0495623_0000136 | 3300046679 | Bacteria | 45077 |
| 552 | Ga0495623_0015960 | 3300046679 | Bacteria | 4853 |
| 553 | Ga0495623_0041650 | 3300046679 | Bacteria | 2928 |
| 554 | Ga0495623_0084959 | 3300046679 | Bacteria | 1952 |
| 555 | Ga0495623_0130806 | 3300046679 | Bacteria | 1503 |
| 556 | Ga0495646_0003996 | 3300046680 | Bacteria | 9236 |
| 557 | Ga0495646_0019941 | 3300046680 | Bacteria | 4239 |
| 558 | Ga0495646_0026182 | 3300046680 | Bacteria | 3664 |
| 559 | Ga0495646_0046104 | 3300046680 | Bacteria | 2659 |
| 560 | Ga0495646_0162440 | 3300046680 | Bacteria | 1235 |
| 561 | Ga0495647_0015084 | 3300046681 | Bacteria | 2702 |
| 562 | Ga0495658_0027610 | 3300046683 | Bacteria | 3056 |
| 563 | Ga0495658_0085467 | 3300046683 | Bacteria | 1859 |
| 564 | Ga0495658_0231791 | 3300046683 | Bacteria | 1158 |
| 565 | Ga0495613_0032260 | 3300046689 | Bacteria | 3890 |
| 566 | Ga0495624_0017806 | 3300046690 | Bacteria | 4761 |
| 567 | Ga0495624_0033950 | 3300046690 | Bacteria | 3303 |
| 568 | Ga0495670_0001701 | 3300046691 | Bacteria | 10813 |
| 569 | Ga0495600_0001287 | 3300046809 | Bacteria | 13858 |
| 570 | Ga0495600_0012275 | 3300046809 | Bacteria | 5352 |
| 571 | Ga0495600_0030156 | 3300046809 | Bacteria | 3512 |
| 572 | Ga0495600_0082397 | 3300046809 | Bacteria | 2099 |
| 573 | Ga0495581_0005395 | 3300047315 | Bacteria | 7396 |
| 574 | Ga0495581_0017226 | 3300047315 | Bacteria | 4198 |
| 575 | Ga0495581_0147098 | 3300047315 | Bacteria | 1375 |
| 576 | Ga0495604_0000082 | 3300047317 | Bacteria | 82615 |
| 577 | Ga0495604_0006860 | 3300047317 | Bacteria | 9026 |
| 578 | Ga0495604_0016534 | 3300047317 | Bacteria | 5897 |
| 579 | Ga0495604_0040321 | 3300047317 | Bacteria | 3667 |
| 580 | Ga0495604_0041771 | 3300047317 | Bacteria | 3595 |
| 581 | Ga0495604_0156466 | 3300047317 | Bacteria | 1614 |
| 582 | Ga0495604_0189381 | 3300047317 | Bacteria | 1434 |
| 583 | Ga0495674_0002113 | 3300047319 | Bacteria | 19509 |
| 584 | Ga0495674_0015419 | 3300047319 | Bacteria | 7143 |
| 585 | Ga0495674_0017431 | 3300047319 | Bacteria | 6681 |
| 586 | Ga0495674_0086910 | 3300047319 | Bacteria | 2676 |
| 587 | Ga0495674_0127737 | 3300047319 | Bacteria | 2143 |
| 588 | Ga0495680_0003817 | 3300047322 | Bacteria | 14626 |
| 589 | Ga0495680_0013176 | 3300047322 | Bacteria | 7225 |
| 590 | Ga0495680_0023802 | 3300047322 | Bacteria | 5088 |
| 591 | Ga0495680_0075754 | 3300047322 | Bacteria | 2552 |
| 592 | Ga0495680_0082212 | 3300047322 | Bacteria | 2430 |
| 593 | Ga0495675_0000412 | 3300047444 | Bacteria | 29285 |
| 594 | Ga0495675_0020217 | 3300047444 | Bacteria | 4233 |
| 595 | Ga0495675_0037125 | 3300047444 | Bacteria | 3103 |
| 596 | Ga0495684_0009561 | 3300047471 | Bacteria | 7474 |
| 597 | Ga0495684_0039179 | 3300047471 | Bacteria | 3633 |
| 598 | Ga0495684_0065152 | 3300047471 | Bacteria | 2769 |
| 599 | Ga0495684_0084864 | 3300047471 | Bacteria | 2401 |
| 600 | Ga0495684_0115073 | 3300047471 | Bacteria | 2028 |
| 601 | Ga0495684_0226530 | 3300047471 | Bacteria | 1368 |
| 602 | Ga0495684_0392843 | 3300047471 | Bacteria | 976 |
| 603 | Ga0495684_0491729 | 3300047471 | Bacteria | 845 |
| 604 | Ga0495593_0006417 | 3300047673 | Bacteria | 6898 |
| 605 | Ga0495593_0063331 | 3300047673 | Bacteria | 1931 |
| 606 | Ga0495602_0000313 | 3300048088 | Bacteria | 44865 |
| 607 | Ga0495602_0033635 | 3300048088 | Bacteria | 4806 |
| 608 | Ga0495602_0060885 | 3300048088 | Bacteria | 3286 |
| 609 | Ga0495602_0092313 | 3300048088 | Bacteria | 2508 |
| 610 | Ga0495602_0132169 | 3300048088 | Bacteria | 1988 |
| 611 | Ga0495602_0162873 | 3300048088 | Bacteria | 1739 |
| 612 | Ga0495602_0179515 | 3300048088 | Bacteria | 1634 |
| 613 | Ga0495614_0022530 | 3300048089 | Bacteria | 2718 |
| 614 | Ga0496101_0041381 | 3300048904 | Bacteria | 3285 |
| 615 | Ga0496101_0361671 | 3300048904 | Bacteria | 1141 |
| 616 | Ga0496102_0070337 | 3300048905 | Bacteria | 3213 |
| 617 | Ga0496102_0121043 | 3300048905 | Bacteria | 2444 |
| 618 | Ga0496104_0006232 | 3300048907 | Bacteria | 10479 |
| 619 | Ga0496104_0038505 | 3300048907 | Bacteria | 4474 |
| 620 | Ga0496105_0058690 | 3300048908 | Bacteria | 3175 |
| 621 | Ga0496105_0060226 | 3300048908 | Bacteria | 3132 |
| 622 | Ga0496107_0490122 | 3300048910 | Unclassified | 912 |
| 623 | Ga0496108_0022674 | 3300048911 | Bacteria | 5164 |
| 624 | Ga0496109_0019006 | 3300048912 | Bacteria | 6052 |
| 625 | Ga0496109_0028541 | 3300048912 | Bacteria | 4991 |
| 626 | Ga0496110_0037690 | 3300048913 | Bacteria | 4203 |
| 627 | Ga0496110_0047600 | 3300048913 | Bacteria | 3756 |
| 628 | Ga0496110_0159342 | 3300048913 | Bacteria | 2045 |
| 629 | Ga0496112_0013857 | 3300048915 | Bacteria | 7457 |
| 630 | Ga0496112_0094830 | 3300048915 | Bacteria | 2955 |
| 631 | Ga0496112_0486739 | 3300048915 | Bacteria | 1170 |
| 632 | Ga0496114_0067779 | 3300048917 | Bacteria | 2994 |
| 633 | Ga0496115_0019933 | 3300048918 | Bacteria | 5168 |
| 634 | Ga0496115_0021631 | 3300048918 | Bacteria | 4971 |
| 635 | Ga0496115_0270040 | 3300048918 | Bacteria | 1397 |
| 636 | Ga0496126_0048759 | 3300048929 | Bacteria | 3869 |
| 637 | Ga0501031_0002739 | 3300049568 | Bacteria | 11233 |
| 638 | Ga0501032_0001062 | 3300049569 | Bacteria | 21976 |
| 639 | Ga0501032_0150291 | 3300049569 | Bacteria | 1532 |
| 640 | Ga0501033_0013416 | 3300049570 | Bacteria | 6241 |
| 641 | Ga0501033_0096445 | 3300049570 | Bacteria | 2161 |
| 642 | Ga0501033_0142928 | 3300049570 | Bacteria | 1730 |
| 643 | Ga0501034_0008441 | 3300049571 | Bacteria | 10881 |
| 644 | Ga0501036_0002819 | 3300049572 | Bacteria | 13778 |
| 645 | Ga0501036_0005101 | 3300049572 | Bacteria | 10625 |
| 646 | Ga0501036_0256867 | 3300049572 | Bacteria | 1464 |
| 647 | Ga0501037_0003576 | 3300049573 | Bacteria | 11275 |
| 648 | Ga0501037_0005498 | 3300049573 | Bacteria | 9237 |
| 649 | Ga0501038_0006037 | 3300049574 | Bacteria | 11214 |
| 650 | Ga0501038_0015893 | 3300049574 | Bacteria | 6838 |
| 651 | Ga0501038_0194791 | 3300049574 | Bacteria | 1629 |
| 652 | Ga0501039_0032563 | 3300049575 | Bacteria | 4020 |
| 653 | Ga0501039_0548223 | 3300049575 | Bacteria | 907 |
| 654 | Ga0501040_0020832 | 3300049576 | Bacteria | 4372 |
| 655 | Ga0501040_0041932 | 3300049576 | Bacteria | 3117 |
| 656 | Ga0501041_0080710 | 3300049577 | Bacteria | 2003 |
| 657 | Ga0501042_0003645 | 3300049578 | Bacteria | 9709 |
| 658 | Ga0501042_0013874 | 3300049578 | Bacteria | 5489 |
| 659 | Ga0501042_0077476 | 3300049578 | Bacteria | 2381 |
| 660 | Ga0501043_0004612 | 3300049579 | Bacteria | 11180 |
| 661 | Ga0501043_0021002 | 3300049579 | Bacteria | 5119 |
| 662 | Ga0501043_0437928 | 3300049579 | Bacteria | 984 |
| 663 | Ga0501046_0001763 | 3300049580 | Bacteria | 20682 |
| 664 | Ga0501047_0000535 | 3300049581 | Bacteria | 41145 |
| 665 | Ga0501047_0008610 | 3300049581 | Bacteria | 9636 |
| 666 | Ga0501047_0114513 | 3300049581 | Bacteria | 2579 |
| 667 | Ga0501047_0480040 | 3300049581 | Bacteria | 1071 |
| 668 | Ga0501048_0001513 | 3300049582 | Bacteria | 17602 |
| 669 | Ga0501048_0004016 | 3300049582 | Bacteria | 11182 |
| 670 | Ga0501048_0235927 | 3300049582 | Bacteria | 1298 |
| 671 | Ga0501068_0064549 | 3300049584 | Bacteria | 2228 |
| 672 | Ga0501069_0044581 | 3300049585 | Bacteria | 2455 |
| 673 | Ga0501070_0004990 | 3300049586 | Bacteria | 11327 |
| 674 | Ga0501071_0079117 | 3300049587 | Bacteria | 2403 |
| 675 | Ga0501072_0075783 | 3300049588 | Bacteria | 2661 |
| 676 | Ga0501073_0014722 | 3300049589 | Bacteria | 5682 |
| 677 | Ga0501073_0034461 | 3300049589 | Bacteria | 3603 |
| 678 | Ga0501074_0003504 | 3300049590 | Bacteria | 11138 |
| 679 | Ga0501074_0014423 | 3300049590 | Bacteria | 5750 |
| 680 | Ga0501074_0331129 | 3300049590 | Bacteria | 1081 |
| 681 | Ga0501075_0005306 | 3300049591 | Bacteria | 8812 |
| 682 | Ga0501076_0153726 | 3300049592 | Bacteria | 1872 |
| 683 | Ga0501076_0174475 | 3300049592 | Bacteria | 1752 |
| 684 | Ga0501079_0021237 | 3300049741 | Bacteria | 4965 |
| 685 | Ga0501079_0188689 | 3300049741 | Bacteria | 1609 |
| 686 | Ga0501080_0018406 | 3300049742 | Bacteria | 6466 |
| 687 | Ga0501080_0070273 | 3300049742 | Bacteria | 3256 |
| 688 | Ga0501081_0037435 | 3300049743 | Bacteria | 3310 |
| 689 | Ga0501083_0010229 | 3300049744 | Bacteria | 6611 |
| 690 | Ga0501035_0001696 | 3300049822 | Bacteria | 22254 |
| 691 | Ga0501035_0065893 | 3300049822 | Bacteria | 3215 |
| 692 | Ga0501035_0304391 | 3300049822 | Bacteria | 1342 |
| 693 | Ga0501044_0000246 | 3300049823 | Bacteria | 68756 |
| 694 | Ga0501044_0008525 | 3300049823 | Bacteria | 11234 |
| 695 | Ga0501044_0023676 | 3300049823 | Bacteria | 6530 |
| 696 | Ga0501044_0038474 | 3300049823 | Bacteria | 4995 |
| 697 | Ga0501045_0072910 | 3300049824 | Bacteria | 2528 |
| 698 | Ga0501045_0131074 | 3300049824 | Bacteria | 1864 |
| 699 | nmdc:mga03683_1643_c1 | 3300050489 | Bacteria | 6717 |
| 700 | nmdc:mga03683_23_c1 | 3300050489 | Bacteria | 80877 |
| 701 | nmdc:mga03n38_63773_c1 | 3300050490 | Bacteria | 1685 |
| 702 | nmdc:mga00v17_119063_c1 | 3300050491 | Bacteria | 1680 |
| 703 | nmdc:mga00v17_135958_c1 | 3300050491 | Bacteria | 1574 |
| 704 | nmdc:mga0yw44_103553_c1 | 3300050492 | Bacteria | 1816 |
| 705 | nmdc:mga0k408_19330_c1 | 3300050493 | Bacteria | 3806 |
| 706 | nmdc:mga0k408_19_c1 | 3300050493 | Bacteria | 112120 |
| 707 | nmdc:mga06z11_525_c1 | 3300050494 | Bacteria | 14156 |
| 708 | nmdc:mga04h51_803_c1 | 3300050495 | Bacteria | 7295 |
| 709 | nmdc:mga07m45_17205_c1 | 3300050496 | Bacteria | 3879 |
| 710 | nmdc:mga07m45_31_c1 | 3300050496 | Bacteria | 81959 |
| 711 | nmdc:mga07m45_53_c1 | 3300050496 | Bacteria | 50852 |
| 712 | nmdc:mga05p37_1250906_c1 | 3300050507 | Bacteria | 762 |
| 713 | nmdc:mga05p37_2131_c2 | 3300050507 | Bacteria | 19312 |
| 714 | nmdc:mga05p37_340590_c1 | 3300050507 | Bacteria | 1768 |
| 715 | nmdc:mga05p37_9902_c1 | 3300050507 | Bacteria | 11311 |
| 716 | nmdc:mga09592_1164_c1 | 3300050508 | Bacteria | 21001 |
| 717 | nmdc:mga09592_22087_c1 | 3300050508 | Bacteria | 5250 |
| 718 | nmdc:mga09592_88922_c1 | 3300050508 | Bacteria | 2638 |
| 719 | nmdc:mga0qj67_339773_c1 | 3300050509 | Bacteria | 1214 |
| 720 | nmdc:mga0qj67_77451_c1 | 3300050509 | Bacteria | 2660 |
| 721 | nmdc:mga06r32_57566_c1 | 3300050510 | Bacteria | 3733 |
| 722 | nmdc:mga08y16_330235_c1 | 3300050511 | Bacteria | 1569 |
| 723 | nmdc:mga08y16_82502_c1 | 3300050511 | Bacteria | 3351 |
| 724 | nmdc:mga0n895_218029_c1 | 3300050512 | Bacteria | 1937 |
| 725 | nmdc:mga0n895_354635_c1 | 3300050512 | Bacteria | 1486 |
| 726 | nmdc:mga0n895_396216_c1 | 3300050512 | Bacteria | 1396 |
| 727 | nmdc:mga0n895_46083_c1 | 3300050512 | Bacteria | 4258 |
| 728 | nmdc:mga0rr50_123575_c1 | 3300050513 | Bacteria | 2063 |
| 729 | nmdc:mga0rr50_44834_c1 | 3300050513 | Bacteria | 3246 |
| 730 | nmdc:mga08x19_192841_c1 | 3300050514 | Bacteria | 1394 |
| 731 | nmdc:mga08x19_333806_c1 | 3300050514 | Bacteria | 1057 |
| 732 | nmdc:mga0a205_104981_c1 | 3300050515 | Bacteria | 2724 |
| 733 | nmdc:mga0a205_280090_c1 | 3300050515 | Bacteria | 1543 |
| 734 | nmdc:mga0a205_309113_c1 | 3300050515 | Bacteria | 1453 |
| 735 | nmdc:mga0sz30_1097_c1 | 3300050516 | Bacteria | 9730 |
| 736 | Ga0495601_0001684 | 3300053077 | Bacteria | 12197 |
| 737 | Ga0495601_0054831 | 3300053077 | Bacteria | 2522 |
| 738 | Ga0495601_0091011 | 3300053077 | Bacteria | 1964 |
| 739 | Ga0495601_0165528 | 3300053077 | Bacteria | 1445 |
| 740 | Ga0495601_0212974 | 3300053077 | Bacteria | 1262 |
| 741 | Ga0495612_0047634 | 3300053078 | Bacteria | 1756 |
| 742 | Ga0495595_0000925 | 3300053084 | Bacteria | 11324 |
| 743 | Ga0495595_0001051 | 3300053084 | Bacteria | 10652 |
| 744 | Ga0495595_0106049 | 3300053084 | Bacteria | 1359 |
| 745 | Ga0495619_0007502 | 3300053085 | Bacteria | 6907 |
| 746 | Ga0495619_0059121 | 3300053085 | Bacteria | 2546 |
| 747 | Ga0495619_0131735 | 3300053085 | Bacteria | 1718 |
| 748 | Ga0495619_0163017 | 3300053085 | Bacteria | 1540 |
| 749 | Ga0495619_0231888 | 3300053085 | Unclassified | 1279 |
| 750 | Ga0495619_0243699 | 3300053085 | Bacteria | 1245 |
| 751 | Ga0500607_064281 | 3300053121 | Bacteria | 1910 |
| 752 | Ga0500559_0039347 | 3300053136 | Bacteria | 2056 |
| 753 | Ga0500590_065762 | 3300053148 | Bacteria | 1812 |
| 754 | Ga0500622_0000294 | 3300053156 | Bacteria | 51192 |
| 755 | Ga0500637_0019520 | 3300053178 | Bacteria | 3656 |
| 756 | Ga0500645_001871 | 3300053730 | Bacteria | 10063 |
| 757 | Ga0500645_026308 | 3300053730 | Bacteria | 1770 |
| 758 | Ga0501084_0063397 | 3300054114 | Bacteria | 3094 |
| 759 | Ga0501084_0199999 | 3300054114 | Bacteria | 1686 |
| 760 | Ga0501084_0259744 | 3300054114 | Bacteria | 1466 |
| 761 | Ga0501084_0313447 | 3300054114 | Bacteria | 1325 |
| 762 | Ga0501082_0091980 | 3300060353 | Bacteria | 2620 |
| 763 | Ga0501082_0128814 | 3300060353 | Bacteria | 2195 |
| 764 | Ga0501082_0292876 | 3300060353 | Bacteria | 1417 |
| 765 | Ga0466962_0011392 | 3300061719 | Bacteria | 4282 |
| 766 | 2676489930 | 2675903060 | Bacteria | 10051191 |
| 767 | 2857486237 | 2857481737 | Bacteria | 4761446 |
| 768 | 2884694760 | 2884693830 | Bacteria | 11273186 |
| 769 | 2891401259 | 2891395885 | Bacteria | 9251614 |
| 770 | 2895436379 | 2895427314 | Bacteria | 13147766 |
| 771 | 2895447192 | 2895442618 | Bacteria | 11027144 |
| 772 | 3003004346 | 3002998708 | Bacteria | 11715108 |
| 773 | 8053952300 | 8053945823 | Bacteria | 8962862 |
| 774 | 8055175973 | 8055172936 | Bacteria | 9305943 |
| 775 | Ga0079104_1010022 | |||
| 776 | SwRhRL2b_contig_580954 | |||
| 777 | MRS1b_contig_2119021 | |||
| 778 | rootL2_10257678 | |||
| 779 | Ga0065704_10070372 | |||
| 780 | Ga0065715_10258604 | |||
| 781 | Ga0065707_10000474 | |||
| 782 | Ga0065707_10001944 | |||
| 783 | Ga0065707_10039849 | |||
| 784 | Ga0065707_10100554 | |||
| 785 | Ga0070658_10000394 | |||
| 786 | Ga0070683_100017502 | |||
| 787 | Ga0070683_100188918 | |||
| 788 | Ga0070683_100215039 | |||
| 789 | Ga0070703_10063611 | |||
| 790 | Ga0070709_10000473 | |||
| 791 | Ga0070709_10146325 | |||
| 792 | Ga0070714_100000688 | |||
| 793 | Ga0070714_100010843 | |||
| 794 | Ga0070714_100017227 | |||
| 795 | Ga0070714_100020820 | |||
| 796 | Ga0070714_100066392 | |||
| 797 | Ga0070714_100110607 | |||
| 798 | Ga0070714_100124417 | |||
| 799 | Ga0070714_100143347 | |||
| 800 | Ga0070714_100207599 | |||
| 801 | Ga0070714_100281209 | |||
| 802 | Ga0070713_100000648 | |||
| 803 | Ga0070713_100035457 | |||
| 804 | Ga0070713_100054007 | |||
| 805 | Ga0070713_100104746 | |||
| 806 | Ga0070713_100322210 | |||
| 807 | Ga0070713_100358938 | |||
| 808 | Ga0070713_100388600 | |||
| 809 | Ga0070713_100389948 | |||
| 810 | Ga0070710_10001154 | |||
| 811 | Ga0070710_10001779 | |||
| 812 | Ga0070710_10037902 | |||
| 813 | Ga0070710_10085405 | |||
| 814 | Ga0070710_10110065 | |||
| 815 | Ga0070710_10537356 | |||
| 816 | Ga0070711_100006427 | |||
| 817 | Ga0070711_100019082 | |||
| 818 | Ga0070711_100029016 | |||
| 819 | Ga0070711_100340650 | |||
| 820 | Ga0070705_100102762 | |||
| 821 | Ga0070700_100271087 | |||
| 822 | Ga0070694_100430937 | |||
| 823 | Ga0070708_100002326 | |||
| 824 | Ga0070708_100012830 | |||
| 825 | Ga0070708_100381198 | |||
| 826 | Ga0070708_100460030 | |||
| 827 | Ga0070678_100124274 | |||
| 828 | Ga0070706_100000498 | |||
| 829 | Ga0070706_100016333 | |||
| 830 | Ga0070706_100038070 | |||
| 831 | Ga0070706_100046112 | |||
| 832 | Ga0070706_100053723 | |||
| 833 | Ga0070706_100086671 | |||
| 834 | Ga0070706_100089395 | |||
| 835 | Ga0070706_100137121 | |||
| 836 | Ga0070707_100001191 | |||
| 837 | Ga0070707_100019926 | |||
| 838 | Ga0070707_100040521 | |||
| 839 | Ga0070707_100046079 | |||
| 840 | Ga0070707_100051340 | |||
| 841 | Ga0070707_100320144 | |||
| 842 | Ga0070707_100457513 | |||
| 843 | Ga0070698_100002077 | |||
| 844 | Ga0070698_100004361 | |||
| 845 | Ga0070698_100004522 | |||
| 846 | Ga0070698_100016425 | |||
| 847 | Ga0070698_100048157 | |||
| 848 | Ga0070698_100069606 | |||
| 849 | Ga0070698_100285469 | |||
| 850 | Ga0070698_100307720 | |||
| 851 | Ga0070699_100124497 | |||
| 852 | Ga0070699_100139735 | |||
| 853 | Ga0070699_100204391 | |||
| 854 | Ga0070699_100271566 | |||
| 855 | Ga0070699_100279677 | |||
| 856 | Ga0070679_100321372 | |||
| 857 | Ga0070697_100110142 | |||
| 858 | Ga0070697_100376810 | |||
| 859 | Ga0070695_100004219 | |||
| 860 | Ga0070695_100085454 | |||
| 861 | Ga0070695_100095119 | |||
| 862 | Ga0070696_100054452 | |||
| 863 | Ga0070665_100139610 | |||
| 864 | Ga0070704_100010739 | |||
| 865 | Ga0070704_100563808 | |||
| 866 | Ga0068855_100094845 | |||
| 867 | Ga0068857_100238397 | |||
| 868 | Ga0068856_100143363 | |||
| 869 | Ga0068856_100353780 | |||
| 870 | Ga0068859_100382357 | |||
| 871 | Ga0068859_100426304 | |||
| 872 | Ga0068864_100075266 | |||
| 873 | Ga0068864_100352230 | |||
| 874 | Ga0068861_100056669 | |||
| 875 | Ga0068870_10095914 | |||
| 876 | Ga0068863_100000110 | |||
| 877 | Ga0068858_100012942 | |||
| 878 | Ga0068858_100371771 | |||
| 879 | Ga0068860_100432464 | |||
| 880 | Ga0068862_100093248 | |||
| 881 | Ga0081540_1000946 | |||
| 882 | Ga0081540_1060734 | |||
| 883 | Ga0070717_10012201 | |||
| 884 | Ga0070717_10030864 | |||
| 885 | Ga0070717_10035901 | |||
| 886 | Ga0070717_10101699 | |||
| 887 | Ga0070717_10108265 | |||
| 888 | Ga0070717_10229557 | |||
| 889 | Ga0070717_10278333 | |||
| 890 | Ga0070717_10318931 | |||
| 891 | Ga0070717_10337095 | |||
| 892 | Ga0070717_10353220 | |||
| 893 | Ga0075365_10095106 | |||
| 894 | Ga0075368_10000712 | |||
| 895 | Ga0075363_100013423 | |||
| 896 | Ga0075364_10004972 | |||
| 897 | Ga0075364_10023118 | |||
| 898 | Ga0075364_10144337 | |||
| 899 | Ga0070715_10006152 | |||
| 900 | Ga0070715_10010274 | |||
| 901 | Ga0070715_10010576 | |||
| 902 | Ga0070715_10051413 | |||
| 903 | Ga0070715_10177573 | |||
| 904 | Ga0070716_100000129 | |||
| 905 | Ga0070716_100000802 | |||
| 906 | Ga0070716_100018387 | |||
| 907 | Ga0070716_100065415 | |||
| 908 | Ga0070712_100008716 | |||
| 909 | Ga0070712_100029529 | |||
| 910 | Ga0070712_100124319 | |||
| 911 | Ga0070712_100153931 | |||
| 912 | Ga0070712_100183719 | |||
| 913 | Ga0070712_100271902 | |||
| 914 | Ga0075362_10000030 | |||
| 915 | Ga0075362_10000514 | |||
| 916 | Ga0075367_10000680 | |||
| 917 | Ga0075369_10008612 | |||
| 918 | Ga0075366_10000025 | |||
| 919 | Ga0075366_10068517 | |||
| 920 | Ga0075370_10000025 | |||
| 921 | Ga0075370_10128111 | |||
| 922 | Ga0068871_100036040 | |||
| 923 | Ga0075428_100010326 | |||
| 924 | Ga0075428_100211095 | |||
| 925 | Ga0075430_100074554 | |||
| 926 | Ga0075430_100159350 | |||
| 927 | Ga0075430_100234868 | |||
| 928 | Ga0075431_100085715 | |||
| 929 | Ga0075431_100180878 | |||
| 930 | Ga0075433_10025150 | |||
| 931 | Ga0075433_10099815 | |||
| 932 | Ga0075433_10316196 | |||
| 933 | Ga0075434_100144378 | |||
| 934 | Ga0075434_100556351 | |||
| 935 | Ga0075429_100001215 | |||
| 936 | Ga0075429_100090802 | |||
| 937 | Ga0075429_100144822 | |||
| 938 | Ga0075429_100152388 | |||
| 939 | Ga0075429_100332825 | |||
| 940 | Ga0075429_100645662 | |||
| 941 | Ga0075436_100038796 | |||
| 942 | Ga0075436_100090715 | |||
| 943 | Ga0075436_100098768 | |||
| 944 | Ga0097620_100382356 | |||
| 945 | Ga0075435_100028735 | |||
| 946 | Ga0075435_100089828 | |||
| 947 | Ga0111539_10072772 | |||
| 948 | Ga0111539_10320346 | |||
| 949 | Ga0105245_10026725 | |||
| 950 | Ga0105245_10114121 | |||
| 951 | Ga0105247_10026488 | |||
| 952 | Ga0114129_10001701 | |||
| 953 | Ga0114129_10005682 | |||
| 954 | Ga0114129_10012666 | |||
| 955 | Ga0114129_10029405 | |||
| 956 | Ga0114129_10061317 | |||
| 957 | Ga0114129_10296066 | |||
| 958 | Ga0105243_10004142 | |||
| 959 | Ga0105243_10138437 | |||
| 960 | Ga0105241_10017226 | |||
| 961 | Ga0105241_10209154 | |||
| 962 | Ga0105242_10203757 | |||
| 963 | Ga0105248_10034543 | |||
| 964 | Ga0105237_10215773 | |||
| 965 | Ga0105249_10888218 | |||
| 966 | Ga0105246_10004394 | |||
| 967 | Ga0105246_10246914 | |||
| 968 | Ga0157369_10092704 | |||
| 969 | Ga0163162_10033505 | |||
| 970 | Ga0163163_10016251 | |||
| 971 | Ga0163163_10404361 | |||
| 972 | Ga0157380_10390300 | |||
| 973 | Ga0157379_10012910 | |||
| 974 | Ga0213876_10000316 | |||
| 975 | Ga0213875_10146492 | |||
| 976 | Ga0224572_1004304 | |||
| 977 | Ga0209257_1000156 | |||
| 978 | Ga0207692_10000827 | |||
| 979 | Ga0207692_10003582 | |||
| 980 | Ga0207692_10008078 | |||
| 981 | Ga0207692_10028221 | |||
| 982 | Ga0207710_10022307 | |||
| 983 | Ga0207685_10002508 | |||
| 984 | Ga0207699_10000746 | |||
| 985 | Ga0207699_10003094 | |||
| 986 | Ga0207699_10032523 | |||
| 987 | Ga0207643_10457964 | |||
| 988 | Ga0207705_10031037 | |||
| 989 | Ga0207684_10000947 | |||
| 990 | Ga0207684_10004657 | |||
| 991 | Ga0207684_10024162 | |||
| 992 | Ga0207684_10028659 | |||
| 993 | Ga0207684_10058075 | |||
| 994 | Ga0207684_10139604 | |||
| 995 | Ga0207684_10188266 | |||
| 996 | Ga0207684_10210842 | |||
| 997 | Ga0207684_10610459 | |||
| 998 | Ga0207684_10624282 | |||
| 999 | Ga0207671_10134640 | |||
| 1000 | Ga0207693_10001572 | |||
| 1001 | Ga0207693_10005371 | |||
| 1002 | Ga0207693_10006366 | |||
| 1003 | Ga0207693_10106413 | |||
| 1004 | Ga0207693_10133924 | |||
| 1005 | Ga0207693_10380546 | |||
| 1006 | Ga0207663_10002983 | |||
| 1007 | Ga0207663_10009176 | |||
| 1008 | Ga0207663_10032954 | |||
| 1009 | Ga0207660_10392059 | |||
| 1010 | Ga0207646_10000457 | |||
| 1011 | Ga0207646_10003215 | |||
| 1012 | Ga0207646_10006705 | |||
| 1013 | Ga0207646_10173489 | |||
| 1014 | Ga0207646_10265338 | |||
| 1015 | Ga0207646_10361721 | |||
| 1016 | Ga0207687_10098340 | |||
| 1017 | Ga0207700_10001256 | |||
| 1018 | Ga0207700_10002247 | |||
| 1019 | Ga0207700_10002897 | |||
| 1020 | Ga0207700_10126251 | |||
| 1021 | Ga0207700_10136955 | |||
| 1022 | Ga0207700_10508671 | |||
| 1023 | Ga0207700_10518047 | |||
| 1024 | Ga0207664_10000163 | |||
| 1025 | Ga0207664_10001297 | |||
| 1026 | Ga0207664_10003120 | |||
| 1027 | Ga0207664_10004705 | |||
| 1028 | Ga0207664_10008158 | |||
| 1029 | Ga0207664_10026246 | |||
| 1030 | Ga0207664_10141548 | |||
| 1031 | Ga0207664_10164884 | |||
| 1032 | Ga0207664_10178374 | |||
| 1033 | Ga0207664_10343186 | |||
| 1034 | Ga0207709_10264955 | |||
| 1035 | Ga0207665_10000492 | |||
| 1036 | Ga0207665_10001925 | |||
| 1037 | Ga0207665_10093262 | |||
| 1038 | Ga0207679_10461819 | |||
| 1039 | Ga0207667_10248790 | |||
| 1040 | Ga0207677_10071329 | |||
| 1041 | Ga0207703_10031568 | |||
| 1042 | Ga0207703_10075182 | |||
| 1043 | Ga0207708_10058306 | |||
| 1044 | Ga0207702_10040990 | |||
| 1045 | Ga0207702_10189961 | |||
| 1046 | Ga0207702_10299250 | |||
| 1047 | Ga0207641_10364861 | |||
| 1048 | Ga0207641_10692884 | |||
| 1049 | Ga0207676_10280340 | |||
| 1050 | Ga0207674_10188375 | |||
| 1051 | Ga0207675_100451761 | |||
| 1052 | Ga0207675_100708696 | |||
| 1053 | Ga0207683_10342333 | |||
| 1054 | Ga0209813_10000274 | |||
| 1055 | Ga0268266_10073787 | |||
| 1056 | Ga0268264_10181150 | |||
| 1057 | Ga0265334_10000075 | |||
| 1058 | Ga0265334_10000787 | |||
| 1059 | Ga0265336_10027810 | |||
| 1060 | Ga0307517_10125164 | |||
| 1061 | Ga0307515_10112821 | |||
| 1062 | Ga0265338_10001516 | |||
| 1063 | Ga0265338_10003494 | |||
| 1064 | Ga0265331_10087952 | |||
| 1065 | Ga0307513_10338907 | |||
| 1066 | Ga0307408_100084099 | |||
| 1067 | Ga0307508_10000358 | |||
| 1068 | Ga0307405_10050206 | |||
| 1069 | Ga0307405_10056566 | |||
| 1070 | Ga0307413_10004911 | |||
| 1071 | Ga0307413_10120606 | |||
| 1072 | Ga0307413_10384761 | |||
| 1073 | Ga0307410_10056051 | |||
| 1074 | Ga0307410_10071567 | |||
| 1075 | Ga0307410_10261781 | |||
| 1076 | Ga0307406_10109327 | |||
| 1077 | Ga0307406_10208107 | |||
| 1078 | Ga0307407_10106355 | |||
| 1079 | Ga0307407_10348952 | |||
| 1080 | Ga0307407_10377239 | |||
| 1081 | Ga0307412_10104571 | |||
| 1082 | Ga0307409_100030956 | |||
| 1083 | Ga0307409_100202592 | |||
| 1084 | Ga0307409_100435133 | |||
| 1085 | Ga0307416_100023553 | |||
| 1086 | Ga0307416_100543952 | |||
| 1087 | Ga0307416_101033750 | |||
| 1088 | Ga0307411_10431405 | |||
| 1089 | Ga0307415_100085229 | |||
| 1090 | Ga0307415_100234530 | |||
| 1091 | Ga0307415_100401219 | |||
| 1092 | Ga0307510_10279443 | |||
| 1093 | Ga0373958_0005096 | |||
| 1094 | Ga0373938_0008365 | |||
| 1095 | Ga0373926_0006191 | |||
| 1096 | Ga0373929_0011384 | |||
| 1097 | Ga0373934_0000009 | |||
| 1098 | Ga0373934_0010206 | |||
| 1099 | Ga0373934_0015450 | |||
| 1100 | Ga0373934_0025343 | |||
| 1101 | Ga0373934_0053680 | |||
| 1102 | Ga0373934_0076733 | |||
| 1103 | Ga0373934_0083107 | |||
| 1104 | Ga0373940_0002002 | |||
| 1105 | Ga0373944_0031421 | |||
| 1106 | Ga0373923_0002178 | |||
| 1107 | Ga0373923_0022362 | |||
| 1108 | Ga0373923_0023144 | |||
| 1109 | Ga0373923_0062924 | |||
| 1110 | Ga0373932_0051754 | |||
| 1111 | Ga0373932_0058424 | |||
| 1112 | Ga0373936_0008408 | |||
| 1113 | Ga0373936_0008636 | |||
| 1114 | Ga0373936_0063099 | |||
| 1115 | Ga0373945_0010474 | |||
| 1116 | Ga0373945_0039771 | |||
| 1117 | Ga0373953_0002138 | |||
| 1118 | Ga0373953_0024748 | |||
| 1119 | Ga0373953_0077069 | |||
| 1120 | Ga0373953_0101999 | |||
| 1121 | Ga0373954_0007063 | |||
| 1122 | Ga0373954_0009990 | |||
| 1123 | Ga0373954_0179113 | |||
| 1124 | Ga0373956_0001552 | |||
| 1125 | Ga0373956_0014066 | |||
| 1126 | Ga0373956_0015851 | |||
| 1127 | Ga0373956_0019659 | |||
| 1128 | Ga0373956_0039690 | |||
| 1129 | Ga0373956_0158113 | |||
| 1130 | Ga0373957_0000912 | |||
| 1131 | Ga0373957_0008199 | |||
| 1132 | Ga0373957_0132443 | |||
| 1133 | Ga0373943_0021543 | |||
| 1134 | Ga0373943_0197823 | |||
| 1135 | Ga0373946_0240218 | |||
| 1136 | Ga0373955_0000188 | |||
| 1137 | Ga0373955_0025684 | |||
| 1138 | Ga0373955_0052506 | |||
| 1139 | Ga0373955_0085064 | |||
| 1140 | Ga0373955_0202915 | |||
| 1141 | Ga0373924_0003313 | |||
| 1142 | Ga0373924_0035930 | |||
| 1143 | Ga0373924_0040296 | |||
| 1144 | Ga0373924_0041128 | |||
| 1145 | Ga0373924_0097203 | |||
| 1146 | Ga0373931_0052548 | |||
| 1147 | Ga0373935_0043939 | |||
| 1148 | Ga0373935_0052116 | |||
| 1149 | Ga0373935_0055270 | |||
| 1150 | Ga0373935_0150568 | |||
| 1151 | Ga0373935_0193103 | |||
| 1152 | Ga0373927_0218468 | |||
| 1153 | Ga0373933_0000140 | |||
| 1154 | Ga0373933_0039199 | |||
| 1155 | Ga0373933_0042996 | |||
| 1156 | Ga0373933_0108862 | |||
| 1157 | Ga0373933_0131296 | |||
| 1158 | Ga0373947_0000009 | |||
| 1159 | Ga0373947_0156208 | |||
| 1160 | Ga0373947_0201066 | |||
| 1161 | Ga0373937_0000093 | |||
| 1162 | Ga0373937_0004159 | |||
| 1163 | Ga0373937_0043299 | |||
| 1164 | Ga0373937_0091404 | |||
| 1165 | Ga0373937_0182035 | |||
| 1166 | Ga0373937_0194606 | |||
| 1167 | Ga0373937_0322833 | |||
| 1168 | Ga0373937_0604050 | |||
| 1169 | Ga0372808_008950 | |||
| 1170 | Ga0373925_0001098 | |||
| 1171 | Ga0373925_0003506 | |||
| 1172 | Ga0373925_0010763 | |||
| 1173 | Ga0373925_0011451 | |||
| 1174 | Ga0373925_0071914 | |||
| 1175 | Ga0373925_0142844 | |||
| 1176 | Ga0373925_0173405 | |||
| 1177 | Ga0436364_0481895 | |||
| 1178 | Ga0436364_0855612 | |||
| 1179 | Ga0395901_0383747 | |||
| 1180 | Ga0436365_0585577 | |||
| 1181 | Ga0436361_0260762 | |||
| 1182 | Ga0436363_0988497 | |||
| 1183 | Ga0451577_0096131 | |||
| 1184 | Ga0451577_0132538 | |||
| 1185 | Ga0451577_0310863 | |||
| 1186 | Ga0466972_0175280 | |||
| 1187 | Ga0466966_0034316 | |||
| 1188 | Ga0466966_0163938 | |||
| 1189 | Ga0466961_0077007 | |||
| 1190 | Ga0466961_0258063 | |||
| 1191 | Ga0466963_0251467 | |||
| 1192 | Ga0466963_0464968 | |||
| 1193 | Ga0466963_0503481 | |||
| 1194 | Ga0453684_0031838 | |||
| 1195 | Ga0453684_0052129 | |||
| 1196 | Ga0453684_0055845 | |||
| 1197 | Ga0453684_0076790 | |||
| 1198 | Ga0453684_0194303 | |||
| 1199 | Ga0453684_0372028 | |||
| 1200 | Ga0466959_0078805 | |||
| 1201 | Ga0466959_0248647 | |||
| 1202 | Ga0451576_0008853 | |||
| 1203 | Ga0451576_0300131 | |||
| 1204 | Ga0451576_0476176 | |||
| 1205 | Ga0466958_0136773 | |||
| 1206 | Ga0466958_0200491 | |||
| 1207 | Ga0466958_0236727 | |||
| 1208 | Ga0466958_0323600 | |||
| 1209 | Ga0466967_0120318 | |||
| 1210 | Ga0466967_0262617 | |||
| 1211 | Ga0466967_0358318 | |||
| 1212 | Ga0495592_0000084 | |||
| 1213 | Ga0495592_0032700 | |||
| 1214 | Ga0495592_0065523 | |||
| 1215 | Ga0495592_0134315 | |||
| 1216 | Ga0495603_0022615 | |||
| 1217 | Ga0495629_0008681 | |||
| 1218 | Ga0495629_0056387 | |||
| 1219 | Ga0495629_0169546 | |||
| 1220 | Ga0495641_0019840 | |||
| 1221 | Ga0495651_0000052 | |||
| 1222 | Ga0495651_0002985 | |||
| 1223 | Ga0495651_0009613 | |||
| 1224 | Ga0495651_0069765 | |||
| 1225 | Ga0495651_0153402 | |||
| 1226 | Ga0495653_0031988 | |||
| 1227 | Ga0495653_0040655 | |||
| 1228 | Ga0495653_0084555 | |||
| 1229 | Ga0495653_0094925 | |||
| 1230 | Ga0495580_0042917 | |||
| 1231 | Ga0495580_0115412 | |||
| 1232 | Ga0495582_0002347 | |||
| 1233 | Ga0495582_0004368 | |||
| 1234 | Ga0495582_0153139 | |||
| 1235 | Ga0495639_0071477 | |||
| 1236 | Ga0495639_0124375 | |||
| 1237 | Ga0495662_0026104 | |||
| 1238 | Ga0495662_0047358 | |||
| 1239 | Ga0495662_0162244 | |||
| 1240 | Ga0495664_0028727 | |||
| 1241 | Ga0495664_0040109 | |||
| 1242 | Ga0495664_0077575 | |||
| 1243 | Ga0495664_0138114 | |||
| 1244 | Ga0495664_0152127 | |||
| 1245 | Ga0495664_0171877 | |||
| 1246 | Ga0495608_0000064 | |||
| 1247 | Ga0495608_0000906 | |||
| 1248 | Ga0495608_0012241 | |||
| 1249 | Ga0495608_0018068 | |||
| 1250 | Ga0495608_0062452 | |||
| 1251 | Ga0495608_0181184 | |||
| 1252 | Ga0495618_0020431 | |||
| 1253 | Ga0495618_0055141 | |||
| 1254 | Ga0495618_0133304 | |||
| 1255 | Ga0495618_0147957 | |||
| 1256 | Ga0495628_0013670 | |||
| 1257 | Ga0495628_0032912 | |||
| 1258 | Ga0495628_0044788 | |||
| 1259 | Ga0495628_0052636 | |||
| 1260 | Ga0495628_0091149 | |||
| 1261 | Ga0495628_0101433 | |||
| 1262 | Ga0495628_0112756 | |||
| 1263 | Ga0495628_0195970 | |||
| 1264 | Ga0495628_0355365 | |||
| 1265 | Ga0495628_0363369 | |||
| 1266 | Ga0495630_0021607 | |||
| 1267 | Ga0495630_0046026 | |||
| 1268 | Ga0495630_0053346 | |||
| 1269 | Ga0495630_0186279 | |||
| 1270 | Ga0495630_0312802 | |||
| 1271 | Ga0495666_0017824 | |||
| 1272 | Ga0495666_0094943 | |||
| 1273 | Ga0495652_0003833 | |||
| 1274 | Ga0495652_0007884 | |||
| 1275 | Ga0495652_0027693 | |||
| 1276 | Ga0495652_0039307 | |||
| 1277 | Ga0495652_0061661 | |||
| 1278 | Ga0495652_0135798 | |||
| 1279 | Ga0495652_0140638 | |||
| 1280 | Ga0495652_0192626 | |||
| 1281 | Ga0495652_0265283 | |||
| 1282 | Ga0495665_0003704 | |||
| 1283 | Ga0495665_0080084 | |||
| 1284 | Ga0495640_0009671 | |||
| 1285 | Ga0495640_0024738 | |||
| 1286 | Ga0495640_0034087 | |||
| 1287 | Ga0495586_0006732 | |||
| 1288 | Ga0495586_0016774 | |||
| 1289 | Ga0495586_0030341 | |||
| 1290 | Ga0495587_0000221 | |||
| 1291 | Ga0495587_0010605 | |||
| 1292 | Ga0495587_0012380 | |||
| 1293 | Ga0495587_0017914 | |||
| 1294 | Ga0495587_0175206 | |||
| 1295 | Ga0495645_0029199 | |||
| 1296 | Ga0495645_0055037 | |||
| 1297 | Ga0495645_0240650 | |||
| 1298 | Ga0495645_0380932 | |||
| 1299 | Ga0495633_0036205 | |||
| 1300 | Ga0495667_0000156 | |||
| 1301 | Ga0495667_0003041 | |||
| 1302 | Ga0495667_0044147 | |||
| 1303 | Ga0495667_0054818 | |||
| 1304 | Ga0495667_0076706 | |||
| 1305 | Ga0495667_0139027 | |||
| 1306 | Ga0495667_0279366 | |||
| 1307 | Ga0495634_0017932 | |||
| 1308 | Ga0495634_0019524 | |||
| 1309 | Ga0495634_0228563 | |||
| 1310 | Ga0495611_0037042 | |||
| 1311 | Ga0495625_0045826 | |||
| 1312 | Ga0495625_0105630 | |||
| 1313 | Ga0495635_0011746 | |||
| 1314 | Ga0495635_0021778 | |||
| 1315 | Ga0495657_0000383 | |||
| 1316 | Ga0495657_0007636 | |||
| 1317 | Ga0495657_0019396 | |||
| 1318 | Ga0495657_0025432 | |||
| 1319 | Ga0495657_0027950 | |||
| 1320 | Ga0495599_0000224 | |||
| 1321 | Ga0495599_0003852 | |||
| 1322 | Ga0495599_0017522 | |||
| 1323 | Ga0495599_0034691 | |||
| 1324 | Ga0495599_0177536 | |||
| 1325 | Ga0495623_0000136 | |||
| 1326 | Ga0495623_0015960 | |||
| 1327 | Ga0495623_0041650 | |||
| 1328 | Ga0495623_0084959 | |||
| 1329 | Ga0495623_0130806 | |||
| 1330 | Ga0495646_0003996 | |||
| 1331 | Ga0495646_0019941 | |||
| 1332 | Ga0495646_0026182 | |||
| 1333 | Ga0495646_0046104 | |||
| 1334 | Ga0495646_0162440 | |||
| 1335 | Ga0495647_0015084 | |||
| 1336 | Ga0495658_0027610 | |||
| 1337 | Ga0495658_0085467 | |||
| 1338 | Ga0495658_0231791 | |||
| 1339 | Ga0495613_0032260 | |||
| 1340 | Ga0495624_0017806 | |||
| 1341 | Ga0495624_0033950 | |||
| 1342 | Ga0495670_0001701 | |||
| 1343 | Ga0495600_0001287 | |||
| 1344 | Ga0495600_0012275 | |||
| 1345 | Ga0495600_0030156 | |||
| 1346 | Ga0495600_0082397 | |||
| 1347 | Ga0495581_0005395 | |||
| 1348 | Ga0495581_0017226 | |||
| 1349 | Ga0495581_0147098 | |||
| 1350 | Ga0495604_0000082 | |||
| 1351 | Ga0495604_0006860 | |||
| 1352 | Ga0495604_0016534 | |||
| 1353 | Ga0495604_0040321 | |||
| 1354 | Ga0495604_0041771 | |||
| 1355 | Ga0495604_0156466 | |||
| 1356 | Ga0495604_0189381 | |||
| 1357 | Ga0495674_0002113 | |||
| 1358 | Ga0495674_0015419 | |||
| 1359 | Ga0495674_0017431 | |||
| 1360 | Ga0495674_0086910 | |||
| 1361 | Ga0495674_0127737 | |||
| 1362 | Ga0495680_0003817 | |||
| 1363 | Ga0495680_0013176 | |||
| 1364 | Ga0495680_0023802 | |||
| 1365 | Ga0495680_0075754 | |||
| 1366 | Ga0495680_0082212 | |||
| 1367 | Ga0495675_0000412 | |||
| 1368 | Ga0495675_0020217 | |||
| 1369 | Ga0495675_0037125 | |||
| 1370 | Ga0495684_0009561 | |||
| 1371 | Ga0495684_0039179 | |||
| 1372 | Ga0495684_0065152 | |||
| 1373 | Ga0495684_0084864 | |||
| 1374 | Ga0495684_0115073 | |||
| 1375 | Ga0495684_0226530 | |||
| 1376 | Ga0495684_0392843 | |||
| 1377 | Ga0495684_0491729 | |||
| 1378 | Ga0495593_0006417 | |||
| 1379 | Ga0495593_0063331 | |||
| 1380 | Ga0495602_0000313 | |||
| 1381 | Ga0495602_0033635 | |||
| 1382 | Ga0495602_0060885 | |||
| 1383 | Ga0495602_0092313 | |||
| 1384 | Ga0495602_0132169 | |||
| 1385 | Ga0495602_0162873 | |||
| 1386 | Ga0495602_0179515 | |||
| 1387 | Ga0495614_0022530 | |||
| 1388 | Ga0496101_0041381 | |||
| 1389 | Ga0496101_0361671 | |||
| 1390 | Ga0496102_0070337 | |||
| 1391 | Ga0496102_0121043 | |||
| 1392 | Ga0496104_0006232 | |||
| 1393 | Ga0496104_0038505 | |||
| 1394 | Ga0496105_0058690 | |||
| 1395 | Ga0496105_0060226 | |||
| 1396 | Ga0496107_0490122 | |||
| 1397 | Ga0496108_0022674 | |||
| 1398 | Ga0496109_0019006 | |||
| 1399 | Ga0496109_0028541 | |||
| 1400 | Ga0496110_0037690 | |||
| 1401 | Ga0496110_0047600 | |||
| 1402 | Ga0496110_0159342 | |||
| 1403 | Ga0496112_0013857 | |||
| 1404 | Ga0496112_0094830 | |||
| 1405 | Ga0496112_0486739 | |||
| 1406 | Ga0496114_0067779 | |||
| 1407 | Ga0496115_0019933 | |||
| 1408 | Ga0496115_0021631 | |||
| 1409 | Ga0496115_0270040 | |||
| 1410 | Ga0496126_0048759 | |||
| 1411 | Ga0501031_0002739 | |||
| 1412 | Ga0501032_0001062 | |||
| 1413 | Ga0501032_0150291 | |||
| 1414 | Ga0501033_0013416 | |||
| 1415 | Ga0501033_0096445 | |||
| 1416 | Ga0501033_0142928 | |||
| 1417 | Ga0501034_0008441 | |||
| 1418 | Ga0501036_0002819 | |||
| 1419 | Ga0501036_0005101 | |||
| 1420 | Ga0501036_0256867 | |||
| 1421 | Ga0501037_0003576 | |||
| 1422 | Ga0501037_0005498 | |||
| 1423 | Ga0501038_0006037 | |||
| 1424 | Ga0501038_0015893 | |||
| 1425 | Ga0501038_0194791 | |||
| 1426 | Ga0501039_0032563 | |||
| 1427 | Ga0501039_0548223 | |||
| 1428 | Ga0501040_0020832 | |||
| 1429 | Ga0501040_0041932 | |||
| 1430 | Ga0501041_0080710 | |||
| 1431 | Ga0501042_0003645 | |||
| 1432 | Ga0501042_0013874 | |||
| 1433 | Ga0501042_0077476 | |||
| 1434 | Ga0501043_0004612 | |||
| 1435 | Ga0501043_0021002 | |||
| 1436 | Ga0501043_0437928 | |||
| 1437 | Ga0501046_0001763 | |||
| 1438 | Ga0501047_0000535 | |||
| 1439 | Ga0501047_0008610 | |||
| 1440 | Ga0501047_0114513 | |||
| 1441 | Ga0501047_0480040 | |||
| 1442 | Ga0501048_0001513 | |||
| 1443 | Ga0501048_0004016 | |||
| 1444 | Ga0501048_0235927 | |||
| 1445 | Ga0501068_0064549 | |||
| 1446 | Ga0501069_0044581 | |||
| 1447 | Ga0501070_0004990 | |||
| 1448 | Ga0501071_0079117 | |||
| 1449 | Ga0501072_0075783 | |||
| 1450 | Ga0501073_0014722 | |||
| 1451 | Ga0501073_0034461 | |||
| 1452 | Ga0501074_0003504 | |||
| 1453 | Ga0501074_0014423 | |||
| 1454 | Ga0501074_0331129 | |||
| 1455 | Ga0501075_0005306 | |||
| 1456 | Ga0501076_0153726 | |||
| 1457 | Ga0501076_0174475 | |||
| 1458 | Ga0501079_0021237 | |||
| 1459 | Ga0501079_0188689 | |||
| 1460 | Ga0501080_0018406 | |||
| 1461 | Ga0501080_0070273 | |||
| 1462 | Ga0501081_0037435 | |||
| 1463 | Ga0501083_0010229 | |||
| 1464 | Ga0501035_0001696 | |||
| 1465 | Ga0501035_0065893 | |||
| 1466 | Ga0501035_0304391 | |||
| 1467 | Ga0501044_0000246 | |||
| 1468 | Ga0501044_0008525 | |||
| 1469 | Ga0501044_0023676 | |||
| 1470 | Ga0501044_0038474 | |||
| 1471 | Ga0501045_0072910 | |||
| 1472 | Ga0501045_0131074 | |||
| 1473 | nmdc:mga03683_1643_c1 | |||
| 1474 | nmdc:mga03683_23_c1 | |||
| 1475 | nmdc:mga03n38_63773_c1 | |||
| 1476 | nmdc:mga00v17_119063_c1 | |||
| 1477 | nmdc:mga00v17_135958_c1 | |||
| 1478 | nmdc:mga0yw44_103553_c1 | |||
| 1479 | nmdc:mga0k408_19330_c1 | |||
| 1480 | nmdc:mga0k408_19_c1 | |||
| 1481 | nmdc:mga06z11_525_c1 | |||
| 1482 | nmdc:mga04h51_803_c1 | |||
| 1483 | nmdc:mga07m45_17205_c1 | |||
| 1484 | nmdc:mga07m45_31_c1 | |||
| 1485 | nmdc:mga07m45_53_c1 | |||
| 1486 | nmdc:mga05p37_1250906_c1 | |||
| 1487 | nmdc:mga05p37_2131_c2 | |||
| 1488 | nmdc:mga05p37_340590_c1 | |||
| 1489 | nmdc:mga05p37_9902_c1 | |||
| 1490 | nmdc:mga09592_1164_c1 | |||
| 1491 | nmdc:mga09592_22087_c1 | |||
| 1492 | nmdc:mga09592_88922_c1 | |||
| 1493 | nmdc:mga0qj67_339773_c1 | |||
| 1494 | nmdc:mga0qj67_77451_c1 | |||
| 1495 | nmdc:mga06r32_57566_c1 | |||
| 1496 | nmdc:mga08y16_330235_c1 | |||
| 1497 | nmdc:mga08y16_82502_c1 | |||
| 1498 | nmdc:mga0n895_218029_c1 | |||
| 1499 | nmdc:mga0n895_354635_c1 | |||
| 1500 | nmdc:mga0n895_396216_c1 | |||
| 1501 | nmdc:mga0n895_46083_c1 | |||
| 1502 | nmdc:mga0rr50_123575_c1 | |||
| 1503 | nmdc:mga0rr50_44834_c1 | |||
| 1504 | nmdc:mga08x19_192841_c1 | |||
| 1505 | nmdc:mga08x19_333806_c1 | |||
| 1506 | nmdc:mga0a205_104981_c1 | |||
| 1507 | nmdc:mga0a205_280090_c1 | |||
| 1508 | nmdc:mga0a205_309113_c1 | |||
| 1509 | nmdc:mga0sz30_1097_c1 | |||
| 1510 | Ga0495601_0001684 | |||
| 1511 | Ga0495601_0054831 | |||
| 1512 | Ga0495601_0091011 | |||
| 1513 | Ga0495601_0165528 | |||
| 1514 | Ga0495601_0212974 | |||
| 1515 | Ga0495612_0047634 | |||
| 1516 | Ga0495595_0000925 | |||
| 1517 | Ga0495595_0001051 | |||
| 1518 | Ga0495595_0106049 | |||
| 1519 | Ga0495619_0007502 | |||
| 1520 | Ga0495619_0059121 | |||
| 1521 | Ga0495619_0131735 | |||
| 1522 | Ga0495619_0163017 | |||
| 1523 | Ga0495619_0231888 | |||
| 1524 | Ga0495619_0243699 | |||
| 1525 | Ga0500607_064281 | |||
| 1526 | Ga0500559_0039347 | |||
| 1527 | Ga0500590_065762 | |||
| 1528 | Ga0500622_0000294 | |||
| 1529 | Ga0500637_0019520 | |||
| 1530 | Ga0500645_001871 | |||
| 1531 | Ga0500645_026308 | |||
| 1532 | Ga0501084_0063397 | |||
| 1533 | Ga0501084_0199999 | |||
| 1534 | Ga0501084_0259744 | |||
| 1535 | Ga0501084_0313447 | |||
| 1536 | Ga0501082_0091980 | |||
| 1537 | Ga0501082_0128814 | |||
| 1538 | Ga0501082_0292876 | |||
| 1539 | Ga0466962_0011392 | |||
| 1540 | 2676489930 | |||
| 1541 | 2857486237 | |||
| 1542 | 2884694760 | |||
| 1543 | 2891401259 | |||
| 1544 | 2895436379 | |||
| 1545 | 2895447192 | |||
| 1546 | 3003004346 | |||
| 1547 | 8053952300 | |||
| 1548 | 8055175973 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pea-assembly2.cif.gz_D | crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' | 0.9561 | 4 | 256 |
| 3pea-assembly2.cif.gz_F | crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' | 0.9552 | 4 | 256 |
| 4jjt-assembly1.cif.gz_C-2 | the crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv | 0.9515 | 4 | 234 |
| 3p85-assembly1.cif.gz_A | crystal structure enoyl-coa hydratase from mycobacterium avium | 0.9496 | 4 | 234 |
| 3qyr-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase echa16_2 mycobacterium paratuberculosis atcc baa-968 / k-10 | 0.9496 | 4 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54BX7_16_236_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9744 | 3 | 195 | 3.90.226.10 |
| af_Q7ZZ04_32_233_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9681 | 1 | 199 | 3.90.226.10 |
| 4fzwB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9676 | 3 | 199 | 3.90.226.10 |
| 2qq3L01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.96 | 1 | 199 | 3.90.226.10 |
| 3rsiB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; | 0.9595 | 95 | 196 | 3.90.226.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T9Y1X1-F1-model_v4 | Enoyl-CoA hydratase | 0.9812 | 3 | 212 |
GO:0005739
GO:0006635 GO:0016836 |
| AF-A0A6L2PSF6-F1-model_v4 | Enoyl-CoA hydratase | 0.9772 | 3 | 212 |
GO:0005739
GO:0006635 GO:0016836 |
| AF-A0A671EIJ6-F1-model_v4 | Enoyl-CoA hydratase, mitochondrial (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) | 0.9766 | 2 | 213 |
GO:0005739
GO:0006635 GO:0043956 |
| AF-A0A5E4DHQ8-F1-model_v4 | Enoyl-CoA hydratase, mitochondrial (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) | 0.9766 | 4 | 212 |
GO:0005739
GO:0006635 GO:0016836 |
| AF-A0A7J7UW85-F1-model_v4 | Enoyl-CoA hydratase, mitochondrial (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) | 0.9763 | 2 | 215 |
GO:0005739
GO:0006635 GO:0016836 |