F480225

General Info

Members Datasets Scaffolds Average Seq Length
774 308 1548 255

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1010022|Ga0079104_10100223
Length 299
Sequence MENGQPLARPKPAGKAAANESQIEWRLDSAAATSHFPEQQNGEEXXMSEEVLVSVADGVLEVTINRPEARNAMSKAVAEGISAAMDRLEAENDLRCAILTGAGGTFCSGMDLKGFLAGEMPIVPGRGFGGLTDWTPKKPVIAAVDGFALAGGMELALACDMIVAHTDAKFGIPEAKRGLVAGGGGVVHLPRLLPRQLAMELALTGDPITARRAYELGLVNRVTDGPAIEAARALARTIAENGPLAVAASKAIIRDSWLWDVAELNAKQGPYIAAVFMSEDAREGATAFAQKRKPEWKGK

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
300 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
301 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
302 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
303 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
304 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
305 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
306 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
307 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
308 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.13
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0.13
Rhizoplane 2.84
Rhizosphere 89.53
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1010022 3300006946 Bacteria 3157
2 SwRhRL2b_contig_580954 2162886007 Bacteria 12792
3 MRS1b_contig_2119021 2162886011 Unclassified 1248
4 rootL2_10257678 3300003322 Bacteria 1801
5 Ga0065704_10070372 3300005289 Bacteria 28821
6 Ga0065715_10258604 3300005293 Bacteria 1145
7 Ga0065707_10000474 3300005295 Bacteria 37237
8 Ga0065707_10001944 3300005295 Bacteria 9205
9 Ga0065707_10039849 3300005295 Unclassified 944
10 Ga0065707_10100554 3300005295 Bacteria 2922
11 Ga0070658_10000394 3300005327 Bacteria 37936
12 Ga0070683_100017502 3300005329 Bacteria 6335
13 Ga0070683_100188918 3300005329 Bacteria 1956
14 Ga0070683_100215039 3300005329 Bacteria 1826
15 Ga0070703_10063611 3300005406 Unclassified 1213
16 Ga0070709_10000473 3300005434 Bacteria 23818
17 Ga0070709_10146325 3300005434 Bacteria 1628
18 Ga0070714_100000688 3300005435 Bacteria 23874
19 Ga0070714_100010843 3300005435 Bacteria 7219
20 Ga0070714_100017227 3300005435 Bacteria 5850
21 Ga0070714_100020820 3300005435 Bacteria 5360
22 Ga0070714_100066392 3300005435 Bacteria 3109
23 Ga0070714_100110607 3300005435 Bacteria 2432
24 Ga0070714_100124417 3300005435 Unclassified 2297
25 Ga0070714_100143347 3300005435 Bacteria 2147
26 Ga0070714_100207599 3300005435 Bacteria 1794
27 Ga0070714_100281209 3300005435 Bacteria 1546
28 Ga0070713_100000648 3300005436 Bacteria 22247
29 Ga0070713_100035457 3300005436 Bacteria 4016
30 Ga0070713_100054007 3300005436 Bacteria 3331
31 Ga0070713_100104746 3300005436 Bacteria 2456
32 Ga0070713_100322210 3300005436 Bacteria 1428
33 Ga0070713_100358938 3300005436 Bacteria 1353
34 Ga0070713_100388600 3300005436 Bacteria 1301
35 Ga0070713_100389948 3300005436 Bacteria 1299
36 Ga0070710_10001154 3300005437 Bacteria 12504
37 Ga0070710_10001779 3300005437 Bacteria 10194
38 Ga0070710_10037902 3300005437 Bacteria 2645
39 Ga0070710_10085405 3300005437 Bacteria 1851
40 Ga0070710_10110065 3300005437 Bacteria 1653
41 Ga0070710_10537356 3300005437 Bacteria 805
42 Ga0070711_100006427 3300005439 Bacteria 7089
43 Ga0070711_100019082 3300005439 Bacteria 4392
44 Ga0070711_100029016 3300005439 Bacteria 3646
45 Ga0070711_100340650 3300005439 Bacteria 1203
46 Ga0070705_100102762 3300005440 Bacteria 1808
47 Ga0070700_100271087 3300005441 Unclassified 1226
48 Ga0070694_100430937 3300005444 Bacteria 1038
49 Ga0070708_100002326 3300005445 Bacteria 14705
50 Ga0070708_100012830 3300005445 Bacteria 6844
51 Ga0070708_100381198 3300005445 Bacteria 1329
52 Ga0070708_100460030 3300005445 Bacteria 1200
53 Ga0070678_100124274 3300005456 Bacteria 2040
54 Ga0070706_100000498 3300005467 Bacteria 46152
55 Ga0070706_100016333 3300005467 Bacteria 6858
56 Ga0070706_100038070 3300005467 Bacteria 4441
57 Ga0070706_100046112 3300005467 Bacteria 4023
58 Ga0070706_100053723 3300005467 Bacteria 3718
59 Ga0070706_100086671 3300005467 Bacteria 2901
60 Ga0070706_100089395 3300005467 Bacteria 2856
61 Ga0070706_100137121 3300005467 Bacteria 2283
62 Ga0070707_100001191 3300005468 Bacteria 25607
63 Ga0070707_100019926 3300005468 Bacteria 6322
64 Ga0070707_100040521 3300005468 Bacteria 4456
65 Ga0070707_100046079 3300005468 Bacteria 4172
66 Ga0070707_100051340 3300005468 Bacteria 3954
67 Ga0070707_100320144 3300005468 Bacteria 1507
68 Ga0070707_100457513 3300005468 Bacteria 1237
69 Ga0070698_100002077 3300005471 Bacteria 22271
70 Ga0070698_100004361 3300005471 Bacteria 15555
71 Ga0070698_100004522 3300005471 Bacteria 15282
72 Ga0070698_100016425 3300005471 Bacteria 7812
73 Ga0070698_100048157 3300005471 Bacteria 4356
74 Ga0070698_100069606 3300005471 Bacteria 3532
75 Ga0070698_100285469 3300005471 Bacteria 1582
76 Ga0070698_100307720 3300005471 Unclassified 1515
77 Ga0070699_100124497 3300005518 Unclassified 2268
78 Ga0070699_100139735 3300005518 Bacteria 2138
79 Ga0070699_100204391 3300005518 Bacteria 1757
80 Ga0070699_100271566 3300005518 Bacteria 1518
81 Ga0070699_100279677 3300005518 Bacteria 1495
82 Ga0070679_100321372 3300005530 Bacteria 1497
83 Ga0070697_100110142 3300005536 Bacteria 2294
84 Ga0070697_100376810 3300005536 Bacteria 1229
85 Ga0070695_100004219 3300005545 Bacteria 8411
86 Ga0070695_100085454 3300005545 Bacteria 2095
87 Ga0070695_100095119 3300005545 Bacteria 1996
88 Ga0070696_100054452 3300005546 Bacteria 2788
89 Ga0070665_100139610 3300005548 Bacteria 2427
90 Ga0070704_100010739 3300005549 Bacteria 5579
91 Ga0070704_100563808 3300005549 Bacteria 997
92 Ga0068855_100094845 3300005563 Bacteria 3440
93 Ga0068857_100238397 3300005577 Bacteria 1665
94 Ga0068856_100143363 3300005614 Bacteria 2396
95 Ga0068856_100353780 3300005614 Bacteria 1487
96 Ga0068859_100382357 3300005617 Bacteria 1503
97 Ga0068859_100426304 3300005617 Bacteria 1423
98 Ga0068864_100075266 3300005618 Bacteria 2947
99 Ga0068864_100352230 3300005618 Unclassified 1389
100 Ga0068861_100056669 3300005719 Bacteria 2992
101 Ga0068870_10095914 3300005840 Unclassified 1667
102 Ga0068863_100000110 3300005841 Bacteria 86415
103 Ga0068858_100012942 3300005842 Bacteria 7868
104 Ga0068858_100371771 3300005842 Bacteria 1371
105 Ga0068860_100432464 3300005843 Bacteria 1306
106 Ga0068862_100093248 3300005844 Unclassified 2626
107 Ga0081540_1000946 3300005983 Bacteria 26162
108 Ga0081540_1060734 3300005983 Bacteria 1806
109 Ga0070717_10012201 3300006028 Bacteria 6552
110 Ga0070717_10030864 3300006028 Bacteria 4307
111 Ga0070717_10035901 3300006028 Bacteria 4017
112 Ga0070717_10101699 3300006028 Bacteria 2441
113 Ga0070717_10108265 3300006028 Bacteria 2367
114 Ga0070717_10229557 3300006028 Bacteria 1634
115 Ga0070717_10278333 3300006028 Bacteria 1483
116 Ga0070717_10318931 3300006028 Bacteria 1384
117 Ga0070717_10337095 3300006028 Bacteria 1346
118 Ga0070717_10353220 3300006028 Bacteria 1315
119 Ga0075365_10095106 3300006038 Bacteria 2034
120 Ga0075368_10000712 3300006042 Bacteria 10157
121 Ga0075363_100013423 3300006048 Bacteria 3971
122 Ga0075364_10004972 3300006051 Bacteria 7707
123 Ga0075364_10023118 3300006051 Bacteria 3933
124 Ga0075364_10144337 3300006051 Bacteria 1602
125 Ga0070715_10006152 3300006163 Bacteria 4063
126 Ga0070715_10010274 3300006163 Bacteria 3332
127 Ga0070715_10010576 3300006163 Bacteria 3293
128 Ga0070715_10051413 3300006163 Unclassified 1773
129 Ga0070715_10177573 3300006163 Bacteria 1065
130 Ga0070716_100000129 3300006173 Bacteria 30072
131 Ga0070716_100000802 3300006173 Bacteria 13502
132 Ga0070716_100018387 3300006173 Bacteria 3640
133 Ga0070716_100065415 3300006173 Bacteria 2117
134 Ga0070712_100008716 3300006175 Bacteria 6388
135 Ga0070712_100029529 3300006175 Bacteria 3676
136 Ga0070712_100124319 3300006175 Bacteria 1946
137 Ga0070712_100153931 3300006175 Bacteria 1768
138 Ga0070712_100183719 3300006175 Bacteria 1631
139 Ga0070712_100271902 3300006175 Bacteria 1362
140 Ga0075362_10000030 3300006177 Bacteria 56135
141 Ga0075362_10000514 3300006177 Bacteria 11306
142 Ga0075367_10000680 3300006178 Bacteria 13033
143 Ga0075369_10008612 3300006186 Bacteria 3933
144 Ga0075366_10000025 3300006195 Bacteria 51813
145 Ga0075366_10068517 3300006195 Bacteria 2111
146 Ga0075370_10000025 3300006353 Bacteria 52081
147 Ga0075370_10128111 3300006353 Bacteria 1480
148 Ga0068871_100036040 3300006358 Bacteria 3936
149 Ga0075428_100010326 3300006844 Bacteria 10363
150 Ga0075428_100211095 3300006844 Bacteria 2098
151 Ga0075430_100074554 3300006846 Bacteria 2845
152 Ga0075430_100159350 3300006846 Bacteria 1879
153 Ga0075430_100234868 3300006846 Bacteria 1520
154 Ga0075431_100085715 3300006847 Bacteria 3251
155 Ga0075431_100180878 3300006847 Bacteria 2164
156 Ga0075433_10025150 3300006852 Bacteria 5033
157 Ga0075433_10099815 3300006852 Bacteria 2570
158 Ga0075433_10316196 3300006852 Bacteria 1382
159 Ga0075434_100144378 3300006871 Bacteria 2400
160 Ga0075434_100556351 3300006871 Bacteria 1167
161 Ga0075429_100001215 3300006880 Bacteria 20912
162 Ga0075429_100090802 3300006880 Bacteria 2664
163 Ga0075429_100144822 3300006880 Bacteria 2080
164 Ga0075429_100152388 3300006880 Bacteria 2024
165 Ga0075429_100332825 3300006880 Bacteria 1329
166 Ga0075429_100645662 3300006880 Bacteria 927
167 Ga0075436_100038796 3300006914 Bacteria 3287
168 Ga0075436_100090715 3300006914 Bacteria 2125
169 Ga0075436_100098768 3300006914 Bacteria 2032
170 Ga0097620_100382356 3300006931 Bacteria 1503
171 Ga0075435_100028735 3300007076 Bacteria 4362
172 Ga0075435_100089828 3300007076 Bacteria 2533
173 Ga0111539_10072772 3300009094 Bacteria 4053
174 Ga0111539_10320346 3300009094 Bacteria 1804
175 Ga0105245_10026725 3300009098 Bacteria 5082
176 Ga0105245_10114121 3300009098 Bacteria 2516
177 Ga0105247_10026488 3300009101 Bacteria 3501
178 Ga0114129_10001701 3300009147 Bacteria 30027
179 Ga0114129_10005682 3300009147 Bacteria 17658
180 Ga0114129_10012666 3300009147 Bacteria 12008
181 Ga0114129_10029405 3300009147 Bacteria 7784
182 Ga0114129_10061317 3300009147 Bacteria 5256
183 Ga0114129_10296066 3300009147 Bacteria 2158
184 Ga0105243_10004142 3300009148 Bacteria 11523
185 Ga0105243_10138437 3300009148 Unclassified 2074
186 Ga0105241_10017226 3300009174 Bacteria 5307
187 Ga0105241_10209154 3300009174 Bacteria 1634
188 Ga0105242_10203757 3300009176 Bacteria 1759
189 Ga0105248_10034543 3300009177 Bacteria 5655
190 Ga0105237_10215773 3300009545 Bacteria 1919
191 Ga0105249_10888218 3300009553 Bacteria 958
192 Ga0105246_10004394 3300011119 Bacteria 8581
193 Ga0105246_10246914 3300011119 Bacteria 1414
194 Ga0157369_10092704 3300013105 Bacteria 3224
195 Ga0163162_10033505 3300013306 Bacteria 5106
196 Ga0163163_10016251 3300014325 Bacteria 6910
197 Ga0163163_10404361 3300014325 Bacteria 1424
198 Ga0157380_10390300 3300014326 Bacteria 1317
199 Ga0157379_10012910 3300014968 Bacteria 7308
200 Ga0213876_10000316 3300021384 Bacteria 42531
201 Ga0213875_10146492 3300021388 Bacteria 1106
202 Ga0224572_1004304 3300024225 Bacteria 2465
203 Ga0209257_1000156 3300025304 Bacteria 182335
204 Ga0207692_10000827 3300025898 Bacteria 11092
205 Ga0207692_10003582 3300025898 Bacteria 6077
206 Ga0207692_10008078 3300025898 Bacteria 4342
207 Ga0207692_10028221 3300025898 Bacteria 2652
208 Ga0207710_10022307 3300025900 Bacteria 2717
209 Ga0207685_10002508 3300025905 Bacteria 4226
210 Ga0207699_10000746 3300025906 Bacteria 15540
211 Ga0207699_10003094 3300025906 Bacteria 7905
212 Ga0207699_10032523 3300025906 Bacteria 2939
213 Ga0207643_10457964 3300025908 Unclassified 812
214 Ga0207705_10031037 3300025909 Bacteria 3813
215 Ga0207684_10000947 3300025910 Bacteria 32649
216 Ga0207684_10004657 3300025910 Bacteria 12882
217 Ga0207684_10024162 3300025910 Bacteria 5184
218 Ga0207684_10028659 3300025910 Bacteria 4745
219 Ga0207684_10058075 3300025910 Bacteria 3283
220 Ga0207684_10139604 3300025910 Bacteria 2083
221 Ga0207684_10188266 3300025910 Bacteria 1780
222 Ga0207684_10210842 3300025910 Bacteria 1676
223 Ga0207684_10610459 3300025910 Bacteria 931
224 Ga0207684_10624282 3300025910 Bacteria 919
225 Ga0207671_10134640 3300025914 Bacteria 1899
226 Ga0207693_10001572 3300025915 Bacteria 20173
227 Ga0207693_10005371 3300025915 Bacteria 10708
228 Ga0207693_10006366 3300025915 Bacteria 9781
229 Ga0207693_10106413 3300025915 Bacteria 2200
230 Ga0207693_10133924 3300025915 Bacteria 1948
231 Ga0207693_10380546 3300025915 Bacteria 1104
232 Ga0207663_10002983 3300025916 Bacteria 8187
233 Ga0207663_10009176 3300025916 Bacteria 5218
234 Ga0207663_10032954 3300025916 Bacteria 3081
235 Ga0207660_10392059 3300025917 Bacteria 1117
236 Ga0207646_10000457 3300025922 Bacteria 54593
237 Ga0207646_10003215 3300025922 Bacteria 18654
238 Ga0207646_10006705 3300025922 Bacteria 11865
239 Ga0207646_10173489 3300025922 Bacteria 1947
240 Ga0207646_10265338 3300025922 Bacteria 1552
241 Ga0207646_10361721 3300025922 Unclassified 1311
242 Ga0207687_10098340 3300025927 Bacteria 2148
243 Ga0207700_10001256 3300025928 Bacteria 14437
244 Ga0207700_10002247 3300025928 Bacteria 11082
245 Ga0207700_10002897 3300025928 Bacteria 9887
246 Ga0207700_10126251 3300025928 Bacteria 2082
247 Ga0207700_10136955 3300025928 Bacteria 2007
248 Ga0207700_10508671 3300025928 Bacteria 1066
249 Ga0207700_10518047 3300025928 Bacteria 1056
250 Ga0207664_10000163 3300025929 Bacteria 53290
251 Ga0207664_10001297 3300025929 Bacteria 16491
252 Ga0207664_10003120 3300025929 Bacteria 11005
253 Ga0207664_10004705 3300025929 Bacteria 9263
254 Ga0207664_10008158 3300025929 Bacteria 7290
255 Ga0207664_10026246 3300025929 Bacteria 4401
256 Ga0207664_10141548 3300025929 Bacteria 2035
257 Ga0207664_10164884 3300025929 Bacteria 1892
258 Ga0207664_10178374 3300025929 Bacteria 1823
259 Ga0207664_10343186 3300025929 Bacteria 1321
260 Ga0207709_10264955 3300025935 Bacteria 1262
261 Ga0207665_10000492 3300025939 Bacteria 26721
262 Ga0207665_10001925 3300025939 Bacteria 13978
263 Ga0207665_10093262 3300025939 Bacteria 2090
264 Ga0207679_10461819 3300025945 Bacteria 1128
265 Ga0207667_10248790 3300025949 Bacteria 1818
266 Ga0207677_10071329 3300026023 Bacteria 2451
267 Ga0207703_10031568 3300026035 Bacteria 4190
268 Ga0207703_10075182 3300026035 Bacteria 2799
269 Ga0207708_10058306 3300026075 Unclassified 2946
270 Ga0207702_10040990 3300026078 Bacteria 3882
271 Ga0207702_10189961 3300026078 Bacteria 1897
272 Ga0207702_10299250 3300026078 Bacteria 1526
273 Ga0207641_10364861 3300026088 Bacteria 1380
274 Ga0207641_10692884 3300026088 Bacteria 1003
275 Ga0207676_10280340 3300026095 Unclassified 1513
276 Ga0207674_10188375 3300026116 Bacteria 2013
277 Ga0207675_100451761 3300026118 Bacteria 1273
278 Ga0207675_100708696 3300026118 Unclassified 1016
279 Ga0207683_10342333 3300026121 Bacteria 1372
280 Ga0209813_10000274 3300027866 Bacteria 14540
281 Ga0268266_10073787 3300028379 Bacteria 2962
282 Ga0268264_10181150 3300028381 Bacteria 1913
283 Ga0265334_10000075 3300028573 Bacteria 72027
284 Ga0265334_10000787 3300028573 Bacteria 15869
285 Ga0265336_10027810 3300028666 Bacteria 1769
286 Ga0307517_10125164 3300028786 Bacteria 1879
287 Ga0307515_10112821 3300028794 Bacteria 3158
288 Ga0265338_10001516 3300028800 Bacteria 37500
289 Ga0265338_10003494 3300028800 Bacteria 22052
290 Ga0265331_10087952 3300031250 Bacteria 1438
291 Ga0307513_10338907 3300031456 Bacteria 1255
292 Ga0307408_100084099 3300031548 Bacteria 2386
293 Ga0307508_10000358 3300031616 Bacteria 55352
294 Ga0307405_10050206 3300031731 Bacteria 2582
295 Ga0307405_10056566 3300031731 Bacteria 2461
296 Ga0307413_10004911 3300031824 Bacteria 5886
297 Ga0307413_10120606 3300031824 Bacteria 1776
298 Ga0307413_10384761 3300031824 Bacteria 1094
299 Ga0307410_10056051 3300031852 Bacteria 2678
300 Ga0307410_10071567 3300031852 Bacteria 2405
301 Ga0307410_10261781 3300031852 Bacteria 1349
302 Ga0307406_10109327 3300031901 Bacteria 1900
303 Ga0307406_10208107 3300031901 Bacteria 1445
304 Ga0307407_10106355 3300031903 Bacteria 1753
305 Ga0307407_10348952 3300031903 Bacteria 1047
306 Ga0307407_10377239 3300031903 Bacteria 1011
307 Ga0307412_10104571 3300031911 Bacteria 2009
308 Ga0307409_100030956 3300031995 Bacteria 3853
309 Ga0307409_100202592 3300031995 Bacteria 1777
310 Ga0307409_100435133 3300031995 Bacteria 1262
311 Ga0307416_100023553 3300032002 Bacteria 4470
312 Ga0307416_100543952 3300032002 Bacteria 1233
313 Ga0307416_101033750 3300032002 Bacteria 925
314 Ga0307411_10431405 3300032005 Bacteria 1097
315 Ga0307415_100085229 3300032126 Bacteria 2269
316 Ga0307415_100234530 3300032126 Bacteria 1480
317 Ga0307415_100401219 3300032126 Bacteria 1171
318 Ga0307510_10279443 3300033180 Bacteria 1141
319 Ga0373958_0005096 3300034819 Bacteria 1979
320 Ga0373938_0008365 3300034957 Bacteria 1847
321 Ga0373926_0006191 3300035083 Bacteria 3968
322 Ga0373929_0011384 3300035085 Bacteria 1676
323 Ga0373934_0000009 3300035086 Bacteria 65270
324 Ga0373934_0010206 3300035086 Bacteria 3525
325 Ga0373934_0015450 3300035086 Bacteria 2896
326 Ga0373934_0025343 3300035086 Bacteria 2296
327 Ga0373934_0053680 3300035086 Bacteria 1599
328 Ga0373934_0076733 3300035086 Bacteria 1340
329 Ga0373934_0083107 3300035086 Bacteria 1287
330 Ga0373940_0002002 3300035088 Bacteria 3858
331 Ga0373944_0031421 3300035089 Bacteria 1598
332 Ga0373923_0002178 3300035111 Bacteria 5943
333 Ga0373923_0022362 3300035111 Bacteria 2479
334 Ga0373923_0023144 3300035111 Bacteria 2442
335 Ga0373923_0062924 3300035111 Bacteria 1579
336 Ga0373932_0051754 3300035112 Bacteria 1221
337 Ga0373932_0058424 3300035112 Bacteria 1165
338 Ga0373936_0008408 3300035113 Bacteria 3885
339 Ga0373936_0008636 3300035113 Bacteria 3837
340 Ga0373936_0063099 3300035113 Bacteria 1516
341 Ga0373945_0010474 3300035116 Bacteria 3052
342 Ga0373945_0039771 3300035116 Bacteria 1696
343 Ga0373953_0002138 3300035117 Bacteria 5913
344 Ga0373953_0024748 3300035117 Bacteria 2285
345 Ga0373953_0077069 3300035117 Bacteria 1382
346 Ga0373953_0101999 3300035117 Bacteria 1208
347 Ga0373954_0007063 3300035118 Bacteria 4899
348 Ga0373954_0009990 3300035118 Bacteria 4180
349 Ga0373954_0179113 3300035118 Bacteria 1039
350 Ga0373956_0001552 3300035119 Bacteria 9480
351 Ga0373956_0014066 3300035119 Bacteria 3337
352 Ga0373956_0015851 3300035119 Bacteria 3161
353 Ga0373956_0019659 3300035119 Bacteria 2866
354 Ga0373956_0039690 3300035119 Bacteria 2087
355 Ga0373956_0158113 3300035119 Bacteria 1067
356 Ga0373957_0000912 3300035120 Bacteria 7724
357 Ga0373957_0008199 3300035120 Bacteria 3374
358 Ga0373957_0132443 3300035120 Bacteria 1015
359 Ga0373943_0021543 3300035170 Bacteria 2977
360 Ga0373943_0197823 3300035170 Bacteria 1111
361 Ga0373946_0240218 3300035171 Bacteria 880
362 Ga0373955_0000188 3300035172 Bacteria 25471
363 Ga0373955_0025684 3300035172 Bacteria 3028
364 Ga0373955_0052506 3300035172 Bacteria 2223
365 Ga0373955_0085064 3300035172 Bacteria 1794
366 Ga0373955_0202915 3300035172 Bacteria 1181
367 Ga0373924_0003313 3300035410 Bacteria 5522
368 Ga0373924_0035930 3300035410 Bacteria 2011
369 Ga0373924_0040296 3300035410 Bacteria 1911
370 Ga0373924_0041128 3300035410 Bacteria 1893
371 Ga0373924_0097203 3300035410 Bacteria 1264
372 Ga0373931_0052548 3300035691 Bacteria 2172
373 Ga0373935_0043939 3300035692 Bacteria 2814
374 Ga0373935_0052116 3300035692 Bacteria 2600
375 Ga0373935_0055270 3300035692 Bacteria 2529
376 Ga0373935_0150568 3300035692 Bacteria 1578
377 Ga0373935_0193103 3300035692 Bacteria 1403
378 Ga0373927_0218468 3300035695 Bacteria 1252
379 Ga0373933_0000140 3300035724 Bacteria 46689
380 Ga0373933_0039199 3300035724 Bacteria 2786
381 Ga0373933_0042996 3300035724 Bacteria 2671
382 Ga0373933_0108862 3300035724 Bacteria 1726
383 Ga0373933_0131296 3300035724 Bacteria 1575
384 Ga0373947_0000009 3300035725 Bacteria 172751
385 Ga0373947_0156208 3300035725 Bacteria 1472
386 Ga0373947_0201066 3300035725 Bacteria 1303
387 Ga0373937_0000093 3300036401 Bacteria 82615
388 Ga0373937_0004159 3300036401 Bacteria 12270
389 Ga0373937_0043299 3300036401 Bacteria 4108
390 Ga0373937_0091404 3300036401 Bacteria 2820
391 Ga0373937_0182035 3300036401 Bacteria 1973
392 Ga0373937_0194606 3300036401 Bacteria 1905
393 Ga0373937_0322833 3300036401 Bacteria 1461
394 Ga0373937_0604050 3300036401 Bacteria 1041
395 Ga0372808_008950 3300036459 Bacteria 1393
396 Ga0373925_0001098 3300037068 Bacteria 24229
397 Ga0373925_0003506 3300037068 Bacteria 12126
398 Ga0373925_0010763 3300037068 Bacteria 6632
399 Ga0373925_0011451 3300037068 Bacteria 6421
400 Ga0373925_0071914 3300037068 Bacteria 2616
401 Ga0373925_0142844 3300037068 Bacteria 1874
402 Ga0373925_0173405 3300037068 Bacteria 1703
403 Ga0436364_0481895 3300037853 Bacteria 2311
404 Ga0436364_0855612 3300037853 Bacteria 1547
405 Ga0395901_0383747 3300038443 Bacteria 1446
406 Ga0436365_0585577 3300039437 Bacteria 67545
407 Ga0436361_0260762 3300039447 Bacteria 1483
408 Ga0436363_0988497 3300039450 Bacteria 1162
409 Ga0451577_0096131 3300042876 Unclassified 2645
410 Ga0451577_0132538 3300042876 Bacteria 2236
411 Ga0451577_0310863 3300042876 Unclassified 1428
412 Ga0466972_0175280 3300044658 Bacteria 1006
413 Ga0466966_0034316 3300044684 Bacteria 3281
414 Ga0466966_0163938 3300044684 Bacteria 1353
415 Ga0466961_0077007 3300044693 Bacteria 2113
416 Ga0466961_0258063 3300044693 Bacteria 1069
417 Ga0466963_0251467 3300044694 Bacteria 1240
418 Ga0466963_0464968 3300044694 Bacteria 893
419 Ga0466963_0503481 3300044694 Bacteria 855
420 Ga0453684_0031838 3300044712 Bacteria 7397
421 Ga0453684_0052129 3300044712 Bacteria 5354
422 Ga0453684_0055845 3300044712 Bacteria 5130
423 Ga0453684_0076790 3300044712 Bacteria 4192
424 Ga0453684_0194303 3300044712 Bacteria 2371
425 Ga0453684_0372028 3300044712 Bacteria 1606
426 Ga0466959_0078805 3300045049 Bacteria 2376
427 Ga0466959_0248647 3300045049 Bacteria 1227
428 Ga0451576_0008853 3300045051 Bacteria 11757
429 Ga0451576_0300131 3300045051 Bacteria 1680
430 Ga0451576_0476176 3300045051 Bacteria 1311
431 Ga0466958_0136773 3300045836 Bacteria 1541
432 Ga0466958_0200491 3300045836 Bacteria 1270
433 Ga0466958_0236727 3300045836 Bacteria 1166
434 Ga0466958_0323600 3300045836 Bacteria 991
435 Ga0466967_0120318 3300045976 Bacteria 2425
436 Ga0466967_0262617 3300045976 Bacteria 1652
437 Ga0466967_0358318 3300045976 Bacteria 1413
438 Ga0495592_0000084 3300046454 Bacteria 82600
439 Ga0495592_0032700 3300046454 Bacteria 3922
440 Ga0495592_0065523 3300046454 Bacteria 2659
441 Ga0495592_0134315 3300046454 Bacteria 1727
442 Ga0495603_0022615 3300046455 Bacteria 3805
443 Ga0495629_0008681 3300046459 Bacteria 7482
444 Ga0495629_0056387 3300046459 Bacteria 2747
445 Ga0495629_0169546 3300046459 Bacteria 1515
446 Ga0495641_0019840 3300046461 Bacteria 3427
447 Ga0495651_0000052 3300046462 Bacteria 85283
448 Ga0495651_0002985 3300046462 Bacteria 13059
449 Ga0495651_0009613 3300046462 Bacteria 7429
450 Ga0495651_0069765 3300046462 Bacteria 2675
451 Ga0495651_0153402 3300046462 Bacteria 1657
452 Ga0495653_0031988 3300046463 Bacteria 4180
453 Ga0495653_0040655 3300046463 Bacteria 3633
454 Ga0495653_0084555 3300046463 Bacteria 2336
455 Ga0495653_0094925 3300046463 Bacteria 2172
456 Ga0495580_0042917 3300046472 Bacteria 3219
457 Ga0495580_0115412 3300046472 Bacteria 1865
458 Ga0495582_0002347 3300046473 Bacteria 10589
459 Ga0495582_0004368 3300046473 Bacteria 7952
460 Ga0495582_0153139 3300046473 Bacteria 1309
461 Ga0495639_0071477 3300046475 Bacteria 1603
462 Ga0495639_0124375 3300046475 Bacteria 1232
463 Ga0495662_0026104 3300046476 Bacteria 2821
464 Ga0495662_0047358 3300046476 Bacteria 2075
465 Ga0495662_0162244 3300046476 Bacteria 1101
466 Ga0495664_0028727 3300046477 Bacteria 3248
467 Ga0495664_0040109 3300046477 Bacteria 2768
468 Ga0495664_0077575 3300046477 Bacteria 1989
469 Ga0495664_0138114 3300046477 Bacteria 1477
470 Ga0495664_0152127 3300046477 Bacteria 1403
471 Ga0495664_0171877 3300046477 Bacteria 1314
472 Ga0495608_0000064 3300046511 Bacteria 82607
473 Ga0495608_0000906 3300046511 Bacteria 20783
474 Ga0495608_0012241 3300046511 Bacteria 5959
475 Ga0495608_0018068 3300046511 Bacteria 4871
476 Ga0495608_0062452 3300046511 Bacteria 2447
477 Ga0495608_0181184 3300046511 Bacteria 1332
478 Ga0495618_0020431 3300046514 Bacteria 4076
479 Ga0495618_0055141 3300046514 Bacteria 2516
480 Ga0495618_0133304 3300046514 Bacteria 1589
481 Ga0495618_0147957 3300046514 Bacteria 1501
482 Ga0495628_0013670 3300046516 Bacteria 6821
483 Ga0495628_0032912 3300046516 Bacteria 4180
484 Ga0495628_0044788 3300046516 Bacteria 3518
485 Ga0495628_0052636 3300046516 Bacteria 3215
486 Ga0495628_0091149 3300046516 Bacteria 2359
487 Ga0495628_0101433 3300046516 Bacteria 2221
488 Ga0495628_0112756 3300046516 Bacteria 2090
489 Ga0495628_0195970 3300046516 Bacteria 1524
490 Ga0495628_0355365 3300046516 Bacteria 1076
491 Ga0495628_0363369 3300046516 Bacteria 1062
492 Ga0495630_0021607 3300046517 Bacteria 4751
493 Ga0495630_0046026 3300046517 Bacteria 3261
494 Ga0495630_0053346 3300046517 Bacteria 3027
495 Ga0495630_0186279 3300046517 Bacteria 1583
496 Ga0495630_0312802 3300046517 Bacteria 1200
497 Ga0495666_0017824 3300046526 Bacteria 3537
498 Ga0495666_0094943 3300046526 Bacteria 1406
499 Ga0495652_0003833 3300046529 Bacteria 14678
500 Ga0495652_0007884 3300046529 Bacteria 9777
501 Ga0495652_0027693 3300046529 Bacteria 4992
502 Ga0495652_0039307 3300046529 Bacteria 4091
503 Ga0495652_0061661 3300046529 Bacteria 3164
504 Ga0495652_0135798 3300046529 Bacteria 1941
505 Ga0495652_0140638 3300046529 Bacteria 1898
506 Ga0495652_0192626 3300046529 Bacteria 1554
507 Ga0495652_0265283 3300046529 Unclassified 1265
508 Ga0495665_0003704 3300046531 Bacteria 8287
509 Ga0495665_0080084 3300046531 Bacteria 1718
510 Ga0495640_0009671 3300046533 Bacteria 7496
511 Ga0495640_0024738 3300046533 Bacteria 4363
512 Ga0495640_0034087 3300046533 Bacteria 3614
513 Ga0495586_0006732 3300046535 Bacteria 6138
514 Ga0495586_0016774 3300046535 Bacteria 3897
515 Ga0495586_0030341 3300046535 Bacteria 2893
516 Ga0495587_0000221 3300046536 Bacteria 42238
517 Ga0495587_0010605 3300046536 Bacteria 5853
518 Ga0495587_0012380 3300046536 Bacteria 5371
519 Ga0495587_0017914 3300046536 Bacteria 4392
520 Ga0495587_0175206 3300046536 Bacteria 1217
521 Ga0495645_0029199 3300046543 Bacteria 4009
522 Ga0495645_0055037 3300046543 Bacteria 2889
523 Ga0495645_0240650 3300046543 Bacteria 1208
524 Ga0495645_0380932 3300046543 Bacteria 902
525 Ga0495633_0036205 3300046558 Bacteria 2365
526 Ga0495667_0000156 3300046559 Bacteria 46657
527 Ga0495667_0003041 3300046559 Bacteria 11251
528 Ga0495667_0044147 3300046559 Bacteria 2952
529 Ga0495667_0054818 3300046559 Bacteria 2622
530 Ga0495667_0076706 3300046559 Bacteria 2174
531 Ga0495667_0139027 3300046559 Bacteria 1565
532 Ga0495667_0279366 3300046559 Bacteria 1060
533 Ga0495634_0017932 3300046642 Bacteria 5045
534 Ga0495634_0019524 3300046642 Bacteria 4814
535 Ga0495634_0228563 3300046642 Bacteria 1145
536 Ga0495611_0037042 3300046648 Bacteria 2167
537 Ga0495625_0045826 3300046660 Bacteria 3159
538 Ga0495625_0105630 3300046660 Bacteria 1929
539 Ga0495635_0011746 3300046663 Bacteria 6141
540 Ga0495635_0021778 3300046663 Bacteria 4467
541 Ga0495657_0000383 3300046675 Bacteria 41345
542 Ga0495657_0007636 3300046675 Bacteria 8330
543 Ga0495657_0019396 3300046675 Bacteria 4905
544 Ga0495657_0025432 3300046675 Bacteria 4203
545 Ga0495657_0027950 3300046675 Bacteria 3971
546 Ga0495599_0000224 3300046678 Bacteria 36160
547 Ga0495599_0003852 3300046678 Bacteria 8821
548 Ga0495599_0017522 3300046678 Bacteria 4451
549 Ga0495599_0034691 3300046678 Bacteria 3169
550 Ga0495599_0177536 3300046678 Bacteria 1313
551 Ga0495623_0000136 3300046679 Bacteria 45077
552 Ga0495623_0015960 3300046679 Bacteria 4853
553 Ga0495623_0041650 3300046679 Bacteria 2928
554 Ga0495623_0084959 3300046679 Bacteria 1952
555 Ga0495623_0130806 3300046679 Bacteria 1503
556 Ga0495646_0003996 3300046680 Bacteria 9236
557 Ga0495646_0019941 3300046680 Bacteria 4239
558 Ga0495646_0026182 3300046680 Bacteria 3664
559 Ga0495646_0046104 3300046680 Bacteria 2659
560 Ga0495646_0162440 3300046680 Bacteria 1235
561 Ga0495647_0015084 3300046681 Bacteria 2702
562 Ga0495658_0027610 3300046683 Bacteria 3056
563 Ga0495658_0085467 3300046683 Bacteria 1859
564 Ga0495658_0231791 3300046683 Bacteria 1158
565 Ga0495613_0032260 3300046689 Bacteria 3890
566 Ga0495624_0017806 3300046690 Bacteria 4761
567 Ga0495624_0033950 3300046690 Bacteria 3303
568 Ga0495670_0001701 3300046691 Bacteria 10813
569 Ga0495600_0001287 3300046809 Bacteria 13858
570 Ga0495600_0012275 3300046809 Bacteria 5352
571 Ga0495600_0030156 3300046809 Bacteria 3512
572 Ga0495600_0082397 3300046809 Bacteria 2099
573 Ga0495581_0005395 3300047315 Bacteria 7396
574 Ga0495581_0017226 3300047315 Bacteria 4198
575 Ga0495581_0147098 3300047315 Bacteria 1375
576 Ga0495604_0000082 3300047317 Bacteria 82615
577 Ga0495604_0006860 3300047317 Bacteria 9026
578 Ga0495604_0016534 3300047317 Bacteria 5897
579 Ga0495604_0040321 3300047317 Bacteria 3667
580 Ga0495604_0041771 3300047317 Bacteria 3595
581 Ga0495604_0156466 3300047317 Bacteria 1614
582 Ga0495604_0189381 3300047317 Bacteria 1434
583 Ga0495674_0002113 3300047319 Bacteria 19509
584 Ga0495674_0015419 3300047319 Bacteria 7143
585 Ga0495674_0017431 3300047319 Bacteria 6681
586 Ga0495674_0086910 3300047319 Bacteria 2676
587 Ga0495674_0127737 3300047319 Bacteria 2143
588 Ga0495680_0003817 3300047322 Bacteria 14626
589 Ga0495680_0013176 3300047322 Bacteria 7225
590 Ga0495680_0023802 3300047322 Bacteria 5088
591 Ga0495680_0075754 3300047322 Bacteria 2552
592 Ga0495680_0082212 3300047322 Bacteria 2430
593 Ga0495675_0000412 3300047444 Bacteria 29285
594 Ga0495675_0020217 3300047444 Bacteria 4233
595 Ga0495675_0037125 3300047444 Bacteria 3103
596 Ga0495684_0009561 3300047471 Bacteria 7474
597 Ga0495684_0039179 3300047471 Bacteria 3633
598 Ga0495684_0065152 3300047471 Bacteria 2769
599 Ga0495684_0084864 3300047471 Bacteria 2401
600 Ga0495684_0115073 3300047471 Bacteria 2028
601 Ga0495684_0226530 3300047471 Bacteria 1368
602 Ga0495684_0392843 3300047471 Bacteria 976
603 Ga0495684_0491729 3300047471 Bacteria 845
604 Ga0495593_0006417 3300047673 Bacteria 6898
605 Ga0495593_0063331 3300047673 Bacteria 1931
606 Ga0495602_0000313 3300048088 Bacteria 44865
607 Ga0495602_0033635 3300048088 Bacteria 4806
608 Ga0495602_0060885 3300048088 Bacteria 3286
609 Ga0495602_0092313 3300048088 Bacteria 2508
610 Ga0495602_0132169 3300048088 Bacteria 1988
611 Ga0495602_0162873 3300048088 Bacteria 1739
612 Ga0495602_0179515 3300048088 Bacteria 1634
613 Ga0495614_0022530 3300048089 Bacteria 2718
614 Ga0496101_0041381 3300048904 Bacteria 3285
615 Ga0496101_0361671 3300048904 Bacteria 1141
616 Ga0496102_0070337 3300048905 Bacteria 3213
617 Ga0496102_0121043 3300048905 Bacteria 2444
618 Ga0496104_0006232 3300048907 Bacteria 10479
619 Ga0496104_0038505 3300048907 Bacteria 4474
620 Ga0496105_0058690 3300048908 Bacteria 3175
621 Ga0496105_0060226 3300048908 Bacteria 3132
622 Ga0496107_0490122 3300048910 Unclassified 912
623 Ga0496108_0022674 3300048911 Bacteria 5164
624 Ga0496109_0019006 3300048912 Bacteria 6052
625 Ga0496109_0028541 3300048912 Bacteria 4991
626 Ga0496110_0037690 3300048913 Bacteria 4203
627 Ga0496110_0047600 3300048913 Bacteria 3756
628 Ga0496110_0159342 3300048913 Bacteria 2045
629 Ga0496112_0013857 3300048915 Bacteria 7457
630 Ga0496112_0094830 3300048915 Bacteria 2955
631 Ga0496112_0486739 3300048915 Bacteria 1170
632 Ga0496114_0067779 3300048917 Bacteria 2994
633 Ga0496115_0019933 3300048918 Bacteria 5168
634 Ga0496115_0021631 3300048918 Bacteria 4971
635 Ga0496115_0270040 3300048918 Bacteria 1397
636 Ga0496126_0048759 3300048929 Bacteria 3869
637 Ga0501031_0002739 3300049568 Bacteria 11233
638 Ga0501032_0001062 3300049569 Bacteria 21976
639 Ga0501032_0150291 3300049569 Bacteria 1532
640 Ga0501033_0013416 3300049570 Bacteria 6241
641 Ga0501033_0096445 3300049570 Bacteria 2161
642 Ga0501033_0142928 3300049570 Bacteria 1730
643 Ga0501034_0008441 3300049571 Bacteria 10881
644 Ga0501036_0002819 3300049572 Bacteria 13778
645 Ga0501036_0005101 3300049572 Bacteria 10625
646 Ga0501036_0256867 3300049572 Bacteria 1464
647 Ga0501037_0003576 3300049573 Bacteria 11275
648 Ga0501037_0005498 3300049573 Bacteria 9237
649 Ga0501038_0006037 3300049574 Bacteria 11214
650 Ga0501038_0015893 3300049574 Bacteria 6838
651 Ga0501038_0194791 3300049574 Bacteria 1629
652 Ga0501039_0032563 3300049575 Bacteria 4020
653 Ga0501039_0548223 3300049575 Bacteria 907
654 Ga0501040_0020832 3300049576 Bacteria 4372
655 Ga0501040_0041932 3300049576 Bacteria 3117
656 Ga0501041_0080710 3300049577 Bacteria 2003
657 Ga0501042_0003645 3300049578 Bacteria 9709
658 Ga0501042_0013874 3300049578 Bacteria 5489
659 Ga0501042_0077476 3300049578 Bacteria 2381
660 Ga0501043_0004612 3300049579 Bacteria 11180
661 Ga0501043_0021002 3300049579 Bacteria 5119
662 Ga0501043_0437928 3300049579 Bacteria 984
663 Ga0501046_0001763 3300049580 Bacteria 20682
664 Ga0501047_0000535 3300049581 Bacteria 41145
665 Ga0501047_0008610 3300049581 Bacteria 9636
666 Ga0501047_0114513 3300049581 Bacteria 2579
667 Ga0501047_0480040 3300049581 Bacteria 1071
668 Ga0501048_0001513 3300049582 Bacteria 17602
669 Ga0501048_0004016 3300049582 Bacteria 11182
670 Ga0501048_0235927 3300049582 Bacteria 1298
671 Ga0501068_0064549 3300049584 Bacteria 2228
672 Ga0501069_0044581 3300049585 Bacteria 2455
673 Ga0501070_0004990 3300049586 Bacteria 11327
674 Ga0501071_0079117 3300049587 Bacteria 2403
675 Ga0501072_0075783 3300049588 Bacteria 2661
676 Ga0501073_0014722 3300049589 Bacteria 5682
677 Ga0501073_0034461 3300049589 Bacteria 3603
678 Ga0501074_0003504 3300049590 Bacteria 11138
679 Ga0501074_0014423 3300049590 Bacteria 5750
680 Ga0501074_0331129 3300049590 Bacteria 1081
681 Ga0501075_0005306 3300049591 Bacteria 8812
682 Ga0501076_0153726 3300049592 Bacteria 1872
683 Ga0501076_0174475 3300049592 Bacteria 1752
684 Ga0501079_0021237 3300049741 Bacteria 4965
685 Ga0501079_0188689 3300049741 Bacteria 1609
686 Ga0501080_0018406 3300049742 Bacteria 6466
687 Ga0501080_0070273 3300049742 Bacteria 3256
688 Ga0501081_0037435 3300049743 Bacteria 3310
689 Ga0501083_0010229 3300049744 Bacteria 6611
690 Ga0501035_0001696 3300049822 Bacteria 22254
691 Ga0501035_0065893 3300049822 Bacteria 3215
692 Ga0501035_0304391 3300049822 Bacteria 1342
693 Ga0501044_0000246 3300049823 Bacteria 68756
694 Ga0501044_0008525 3300049823 Bacteria 11234
695 Ga0501044_0023676 3300049823 Bacteria 6530
696 Ga0501044_0038474 3300049823 Bacteria 4995
697 Ga0501045_0072910 3300049824 Bacteria 2528
698 Ga0501045_0131074 3300049824 Bacteria 1864
699 nmdc:mga03683_1643_c1 3300050489 Bacteria 6717
700 nmdc:mga03683_23_c1 3300050489 Bacteria 80877
701 nmdc:mga03n38_63773_c1 3300050490 Bacteria 1685
702 nmdc:mga00v17_119063_c1 3300050491 Bacteria 1680
703 nmdc:mga00v17_135958_c1 3300050491 Bacteria 1574
704 nmdc:mga0yw44_103553_c1 3300050492 Bacteria 1816
705 nmdc:mga0k408_19330_c1 3300050493 Bacteria 3806
706 nmdc:mga0k408_19_c1 3300050493 Bacteria 112120
707 nmdc:mga06z11_525_c1 3300050494 Bacteria 14156
708 nmdc:mga04h51_803_c1 3300050495 Bacteria 7295
709 nmdc:mga07m45_17205_c1 3300050496 Bacteria 3879
710 nmdc:mga07m45_31_c1 3300050496 Bacteria 81959
711 nmdc:mga07m45_53_c1 3300050496 Bacteria 50852
712 nmdc:mga05p37_1250906_c1 3300050507 Bacteria 762
713 nmdc:mga05p37_2131_c2 3300050507 Bacteria 19312
714 nmdc:mga05p37_340590_c1 3300050507 Bacteria 1768
715 nmdc:mga05p37_9902_c1 3300050507 Bacteria 11311
716 nmdc:mga09592_1164_c1 3300050508 Bacteria 21001
717 nmdc:mga09592_22087_c1 3300050508 Bacteria 5250
718 nmdc:mga09592_88922_c1 3300050508 Bacteria 2638
719 nmdc:mga0qj67_339773_c1 3300050509 Bacteria 1214
720 nmdc:mga0qj67_77451_c1 3300050509 Bacteria 2660
721 nmdc:mga06r32_57566_c1 3300050510 Bacteria 3733
722 nmdc:mga08y16_330235_c1 3300050511 Bacteria 1569
723 nmdc:mga08y16_82502_c1 3300050511 Bacteria 3351
724 nmdc:mga0n895_218029_c1 3300050512 Bacteria 1937
725 nmdc:mga0n895_354635_c1 3300050512 Bacteria 1486
726 nmdc:mga0n895_396216_c1 3300050512 Bacteria 1396
727 nmdc:mga0n895_46083_c1 3300050512 Bacteria 4258
728 nmdc:mga0rr50_123575_c1 3300050513 Bacteria 2063
729 nmdc:mga0rr50_44834_c1 3300050513 Bacteria 3246
730 nmdc:mga08x19_192841_c1 3300050514 Bacteria 1394
731 nmdc:mga08x19_333806_c1 3300050514 Bacteria 1057
732 nmdc:mga0a205_104981_c1 3300050515 Bacteria 2724
733 nmdc:mga0a205_280090_c1 3300050515 Bacteria 1543
734 nmdc:mga0a205_309113_c1 3300050515 Bacteria 1453
735 nmdc:mga0sz30_1097_c1 3300050516 Bacteria 9730
736 Ga0495601_0001684 3300053077 Bacteria 12197
737 Ga0495601_0054831 3300053077 Bacteria 2522
738 Ga0495601_0091011 3300053077 Bacteria 1964
739 Ga0495601_0165528 3300053077 Bacteria 1445
740 Ga0495601_0212974 3300053077 Bacteria 1262
741 Ga0495612_0047634 3300053078 Bacteria 1756
742 Ga0495595_0000925 3300053084 Bacteria 11324
743 Ga0495595_0001051 3300053084 Bacteria 10652
744 Ga0495595_0106049 3300053084 Bacteria 1359
745 Ga0495619_0007502 3300053085 Bacteria 6907
746 Ga0495619_0059121 3300053085 Bacteria 2546
747 Ga0495619_0131735 3300053085 Bacteria 1718
748 Ga0495619_0163017 3300053085 Bacteria 1540
749 Ga0495619_0231888 3300053085 Unclassified 1279
750 Ga0495619_0243699 3300053085 Bacteria 1245
751 Ga0500607_064281 3300053121 Bacteria 1910
752 Ga0500559_0039347 3300053136 Bacteria 2056
753 Ga0500590_065762 3300053148 Bacteria 1812
754 Ga0500622_0000294 3300053156 Bacteria 51192
755 Ga0500637_0019520 3300053178 Bacteria 3656
756 Ga0500645_001871 3300053730 Bacteria 10063
757 Ga0500645_026308 3300053730 Bacteria 1770
758 Ga0501084_0063397 3300054114 Bacteria 3094
759 Ga0501084_0199999 3300054114 Bacteria 1686
760 Ga0501084_0259744 3300054114 Bacteria 1466
761 Ga0501084_0313447 3300054114 Bacteria 1325
762 Ga0501082_0091980 3300060353 Bacteria 2620
763 Ga0501082_0128814 3300060353 Bacteria 2195
764 Ga0501082_0292876 3300060353 Bacteria 1417
765 Ga0466962_0011392 3300061719 Bacteria 4282
766 2676489930 2675903060 Bacteria 10051191
767 2857486237 2857481737 Bacteria 4761446
768 2884694760 2884693830 Bacteria 11273186
769 2891401259 2891395885 Bacteria 9251614
770 2895436379 2895427314 Bacteria 13147766
771 2895447192 2895442618 Bacteria 11027144
772 3003004346 3002998708 Bacteria 11715108
773 8053952300 8053945823 Bacteria 8962862
774 8055175973 8055172936 Bacteria 9305943
775 Ga0079104_1010022
776 SwRhRL2b_contig_580954
777 MRS1b_contig_2119021
778 rootL2_10257678
779 Ga0065704_10070372
780 Ga0065715_10258604
781 Ga0065707_10000474
782 Ga0065707_10001944
783 Ga0065707_10039849
784 Ga0065707_10100554
785 Ga0070658_10000394
786 Ga0070683_100017502
787 Ga0070683_100188918
788 Ga0070683_100215039
789 Ga0070703_10063611
790 Ga0070709_10000473
791 Ga0070709_10146325
792 Ga0070714_100000688
793 Ga0070714_100010843
794 Ga0070714_100017227
795 Ga0070714_100020820
796 Ga0070714_100066392
797 Ga0070714_100110607
798 Ga0070714_100124417
799 Ga0070714_100143347
800 Ga0070714_100207599
801 Ga0070714_100281209
802 Ga0070713_100000648
803 Ga0070713_100035457
804 Ga0070713_100054007
805 Ga0070713_100104746
806 Ga0070713_100322210
807 Ga0070713_100358938
808 Ga0070713_100388600
809 Ga0070713_100389948
810 Ga0070710_10001154
811 Ga0070710_10001779
812 Ga0070710_10037902
813 Ga0070710_10085405
814 Ga0070710_10110065
815 Ga0070710_10537356
816 Ga0070711_100006427
817 Ga0070711_100019082
818 Ga0070711_100029016
819 Ga0070711_100340650
820 Ga0070705_100102762
821 Ga0070700_100271087
822 Ga0070694_100430937
823 Ga0070708_100002326
824 Ga0070708_100012830
825 Ga0070708_100381198
826 Ga0070708_100460030
827 Ga0070678_100124274
828 Ga0070706_100000498
829 Ga0070706_100016333
830 Ga0070706_100038070
831 Ga0070706_100046112
832 Ga0070706_100053723
833 Ga0070706_100086671
834 Ga0070706_100089395
835 Ga0070706_100137121
836 Ga0070707_100001191
837 Ga0070707_100019926
838 Ga0070707_100040521
839 Ga0070707_100046079
840 Ga0070707_100051340
841 Ga0070707_100320144
842 Ga0070707_100457513
843 Ga0070698_100002077
844 Ga0070698_100004361
845 Ga0070698_100004522
846 Ga0070698_100016425
847 Ga0070698_100048157
848 Ga0070698_100069606
849 Ga0070698_100285469
850 Ga0070698_100307720
851 Ga0070699_100124497
852 Ga0070699_100139735
853 Ga0070699_100204391
854 Ga0070699_100271566
855 Ga0070699_100279677
856 Ga0070679_100321372
857 Ga0070697_100110142
858 Ga0070697_100376810
859 Ga0070695_100004219
860 Ga0070695_100085454
861 Ga0070695_100095119
862 Ga0070696_100054452
863 Ga0070665_100139610
864 Ga0070704_100010739
865 Ga0070704_100563808
866 Ga0068855_100094845
867 Ga0068857_100238397
868 Ga0068856_100143363
869 Ga0068856_100353780
870 Ga0068859_100382357
871 Ga0068859_100426304
872 Ga0068864_100075266
873 Ga0068864_100352230
874 Ga0068861_100056669
875 Ga0068870_10095914
876 Ga0068863_100000110
877 Ga0068858_100012942
878 Ga0068858_100371771
879 Ga0068860_100432464
880 Ga0068862_100093248
881 Ga0081540_1000946
882 Ga0081540_1060734
883 Ga0070717_10012201
884 Ga0070717_10030864
885 Ga0070717_10035901
886 Ga0070717_10101699
887 Ga0070717_10108265
888 Ga0070717_10229557
889 Ga0070717_10278333
890 Ga0070717_10318931
891 Ga0070717_10337095
892 Ga0070717_10353220
893 Ga0075365_10095106
894 Ga0075368_10000712
895 Ga0075363_100013423
896 Ga0075364_10004972
897 Ga0075364_10023118
898 Ga0075364_10144337
899 Ga0070715_10006152
900 Ga0070715_10010274
901 Ga0070715_10010576
902 Ga0070715_10051413
903 Ga0070715_10177573
904 Ga0070716_100000129
905 Ga0070716_100000802
906 Ga0070716_100018387
907 Ga0070716_100065415
908 Ga0070712_100008716
909 Ga0070712_100029529
910 Ga0070712_100124319
911 Ga0070712_100153931
912 Ga0070712_100183719
913 Ga0070712_100271902
914 Ga0075362_10000030
915 Ga0075362_10000514
916 Ga0075367_10000680
917 Ga0075369_10008612
918 Ga0075366_10000025
919 Ga0075366_10068517
920 Ga0075370_10000025
921 Ga0075370_10128111
922 Ga0068871_100036040
923 Ga0075428_100010326
924 Ga0075428_100211095
925 Ga0075430_100074554
926 Ga0075430_100159350
927 Ga0075430_100234868
928 Ga0075431_100085715
929 Ga0075431_100180878
930 Ga0075433_10025150
931 Ga0075433_10099815
932 Ga0075433_10316196
933 Ga0075434_100144378
934 Ga0075434_100556351
935 Ga0075429_100001215
936 Ga0075429_100090802
937 Ga0075429_100144822
938 Ga0075429_100152388
939 Ga0075429_100332825
940 Ga0075429_100645662
941 Ga0075436_100038796
942 Ga0075436_100090715
943 Ga0075436_100098768
944 Ga0097620_100382356
945 Ga0075435_100028735
946 Ga0075435_100089828
947 Ga0111539_10072772
948 Ga0111539_10320346
949 Ga0105245_10026725
950 Ga0105245_10114121
951 Ga0105247_10026488
952 Ga0114129_10001701
953 Ga0114129_10005682
954 Ga0114129_10012666
955 Ga0114129_10029405
956 Ga0114129_10061317
957 Ga0114129_10296066
958 Ga0105243_10004142
959 Ga0105243_10138437
960 Ga0105241_10017226
961 Ga0105241_10209154
962 Ga0105242_10203757
963 Ga0105248_10034543
964 Ga0105237_10215773
965 Ga0105249_10888218
966 Ga0105246_10004394
967 Ga0105246_10246914
968 Ga0157369_10092704
969 Ga0163162_10033505
970 Ga0163163_10016251
971 Ga0163163_10404361
972 Ga0157380_10390300
973 Ga0157379_10012910
974 Ga0213876_10000316
975 Ga0213875_10146492
976 Ga0224572_1004304
977 Ga0209257_1000156
978 Ga0207692_10000827
979 Ga0207692_10003582
980 Ga0207692_10008078
981 Ga0207692_10028221
982 Ga0207710_10022307
983 Ga0207685_10002508
984 Ga0207699_10000746
985 Ga0207699_10003094
986 Ga0207699_10032523
987 Ga0207643_10457964
988 Ga0207705_10031037
989 Ga0207684_10000947
990 Ga0207684_10004657
991 Ga0207684_10024162
992 Ga0207684_10028659
993 Ga0207684_10058075
994 Ga0207684_10139604
995 Ga0207684_10188266
996 Ga0207684_10210842
997 Ga0207684_10610459
998 Ga0207684_10624282
999 Ga0207671_10134640
1000 Ga0207693_10001572
1001 Ga0207693_10005371
1002 Ga0207693_10006366
1003 Ga0207693_10106413
1004 Ga0207693_10133924
1005 Ga0207693_10380546
1006 Ga0207663_10002983
1007 Ga0207663_10009176
1008 Ga0207663_10032954
1009 Ga0207660_10392059
1010 Ga0207646_10000457
1011 Ga0207646_10003215
1012 Ga0207646_10006705
1013 Ga0207646_10173489
1014 Ga0207646_10265338
1015 Ga0207646_10361721
1016 Ga0207687_10098340
1017 Ga0207700_10001256
1018 Ga0207700_10002247
1019 Ga0207700_10002897
1020 Ga0207700_10126251
1021 Ga0207700_10136955
1022 Ga0207700_10508671
1023 Ga0207700_10518047
1024 Ga0207664_10000163
1025 Ga0207664_10001297
1026 Ga0207664_10003120
1027 Ga0207664_10004705
1028 Ga0207664_10008158
1029 Ga0207664_10026246
1030 Ga0207664_10141548
1031 Ga0207664_10164884
1032 Ga0207664_10178374
1033 Ga0207664_10343186
1034 Ga0207709_10264955
1035 Ga0207665_10000492
1036 Ga0207665_10001925
1037 Ga0207665_10093262
1038 Ga0207679_10461819
1039 Ga0207667_10248790
1040 Ga0207677_10071329
1041 Ga0207703_10031568
1042 Ga0207703_10075182
1043 Ga0207708_10058306
1044 Ga0207702_10040990
1045 Ga0207702_10189961
1046 Ga0207702_10299250
1047 Ga0207641_10364861
1048 Ga0207641_10692884
1049 Ga0207676_10280340
1050 Ga0207674_10188375
1051 Ga0207675_100451761
1052 Ga0207675_100708696
1053 Ga0207683_10342333
1054 Ga0209813_10000274
1055 Ga0268266_10073787
1056 Ga0268264_10181150
1057 Ga0265334_10000075
1058 Ga0265334_10000787
1059 Ga0265336_10027810
1060 Ga0307517_10125164
1061 Ga0307515_10112821
1062 Ga0265338_10001516
1063 Ga0265338_10003494
1064 Ga0265331_10087952
1065 Ga0307513_10338907
1066 Ga0307408_100084099
1067 Ga0307508_10000358
1068 Ga0307405_10050206
1069 Ga0307405_10056566
1070 Ga0307413_10004911
1071 Ga0307413_10120606
1072 Ga0307413_10384761
1073 Ga0307410_10056051
1074 Ga0307410_10071567
1075 Ga0307410_10261781
1076 Ga0307406_10109327
1077 Ga0307406_10208107
1078 Ga0307407_10106355
1079 Ga0307407_10348952
1080 Ga0307407_10377239
1081 Ga0307412_10104571
1082 Ga0307409_100030956
1083 Ga0307409_100202592
1084 Ga0307409_100435133
1085 Ga0307416_100023553
1086 Ga0307416_100543952
1087 Ga0307416_101033750
1088 Ga0307411_10431405
1089 Ga0307415_100085229
1090 Ga0307415_100234530
1091 Ga0307415_100401219
1092 Ga0307510_10279443
1093 Ga0373958_0005096
1094 Ga0373938_0008365
1095 Ga0373926_0006191
1096 Ga0373929_0011384
1097 Ga0373934_0000009
1098 Ga0373934_0010206
1099 Ga0373934_0015450
1100 Ga0373934_0025343
1101 Ga0373934_0053680
1102 Ga0373934_0076733
1103 Ga0373934_0083107
1104 Ga0373940_0002002
1105 Ga0373944_0031421
1106 Ga0373923_0002178
1107 Ga0373923_0022362
1108 Ga0373923_0023144
1109 Ga0373923_0062924
1110 Ga0373932_0051754
1111 Ga0373932_0058424
1112 Ga0373936_0008408
1113 Ga0373936_0008636
1114 Ga0373936_0063099
1115 Ga0373945_0010474
1116 Ga0373945_0039771
1117 Ga0373953_0002138
1118 Ga0373953_0024748
1119 Ga0373953_0077069
1120 Ga0373953_0101999
1121 Ga0373954_0007063
1122 Ga0373954_0009990
1123 Ga0373954_0179113
1124 Ga0373956_0001552
1125 Ga0373956_0014066
1126 Ga0373956_0015851
1127 Ga0373956_0019659
1128 Ga0373956_0039690
1129 Ga0373956_0158113
1130 Ga0373957_0000912
1131 Ga0373957_0008199
1132 Ga0373957_0132443
1133 Ga0373943_0021543
1134 Ga0373943_0197823
1135 Ga0373946_0240218
1136 Ga0373955_0000188
1137 Ga0373955_0025684
1138 Ga0373955_0052506
1139 Ga0373955_0085064
1140 Ga0373955_0202915
1141 Ga0373924_0003313
1142 Ga0373924_0035930
1143 Ga0373924_0040296
1144 Ga0373924_0041128
1145 Ga0373924_0097203
1146 Ga0373931_0052548
1147 Ga0373935_0043939
1148 Ga0373935_0052116
1149 Ga0373935_0055270
1150 Ga0373935_0150568
1151 Ga0373935_0193103
1152 Ga0373927_0218468
1153 Ga0373933_0000140
1154 Ga0373933_0039199
1155 Ga0373933_0042996
1156 Ga0373933_0108862
1157 Ga0373933_0131296
1158 Ga0373947_0000009
1159 Ga0373947_0156208
1160 Ga0373947_0201066
1161 Ga0373937_0000093
1162 Ga0373937_0004159
1163 Ga0373937_0043299
1164 Ga0373937_0091404
1165 Ga0373937_0182035
1166 Ga0373937_0194606
1167 Ga0373937_0322833
1168 Ga0373937_0604050
1169 Ga0372808_008950
1170 Ga0373925_0001098
1171 Ga0373925_0003506
1172 Ga0373925_0010763
1173 Ga0373925_0011451
1174 Ga0373925_0071914
1175 Ga0373925_0142844
1176 Ga0373925_0173405
1177 Ga0436364_0481895
1178 Ga0436364_0855612
1179 Ga0395901_0383747
1180 Ga0436365_0585577
1181 Ga0436361_0260762
1182 Ga0436363_0988497
1183 Ga0451577_0096131
1184 Ga0451577_0132538
1185 Ga0451577_0310863
1186 Ga0466972_0175280
1187 Ga0466966_0034316
1188 Ga0466966_0163938
1189 Ga0466961_0077007
1190 Ga0466961_0258063
1191 Ga0466963_0251467
1192 Ga0466963_0464968
1193 Ga0466963_0503481
1194 Ga0453684_0031838
1195 Ga0453684_0052129
1196 Ga0453684_0055845
1197 Ga0453684_0076790
1198 Ga0453684_0194303
1199 Ga0453684_0372028
1200 Ga0466959_0078805
1201 Ga0466959_0248647
1202 Ga0451576_0008853
1203 Ga0451576_0300131
1204 Ga0451576_0476176
1205 Ga0466958_0136773
1206 Ga0466958_0200491
1207 Ga0466958_0236727
1208 Ga0466958_0323600
1209 Ga0466967_0120318
1210 Ga0466967_0262617
1211 Ga0466967_0358318
1212 Ga0495592_0000084
1213 Ga0495592_0032700
1214 Ga0495592_0065523
1215 Ga0495592_0134315
1216 Ga0495603_0022615
1217 Ga0495629_0008681
1218 Ga0495629_0056387
1219 Ga0495629_0169546
1220 Ga0495641_0019840
1221 Ga0495651_0000052
1222 Ga0495651_0002985
1223 Ga0495651_0009613
1224 Ga0495651_0069765
1225 Ga0495651_0153402
1226 Ga0495653_0031988
1227 Ga0495653_0040655
1228 Ga0495653_0084555
1229 Ga0495653_0094925
1230 Ga0495580_0042917
1231 Ga0495580_0115412
1232 Ga0495582_0002347
1233 Ga0495582_0004368
1234 Ga0495582_0153139
1235 Ga0495639_0071477
1236 Ga0495639_0124375
1237 Ga0495662_0026104
1238 Ga0495662_0047358
1239 Ga0495662_0162244
1240 Ga0495664_0028727
1241 Ga0495664_0040109
1242 Ga0495664_0077575
1243 Ga0495664_0138114
1244 Ga0495664_0152127
1245 Ga0495664_0171877
1246 Ga0495608_0000064
1247 Ga0495608_0000906
1248 Ga0495608_0012241
1249 Ga0495608_0018068
1250 Ga0495608_0062452
1251 Ga0495608_0181184
1252 Ga0495618_0020431
1253 Ga0495618_0055141
1254 Ga0495618_0133304
1255 Ga0495618_0147957
1256 Ga0495628_0013670
1257 Ga0495628_0032912
1258 Ga0495628_0044788
1259 Ga0495628_0052636
1260 Ga0495628_0091149
1261 Ga0495628_0101433
1262 Ga0495628_0112756
1263 Ga0495628_0195970
1264 Ga0495628_0355365
1265 Ga0495628_0363369
1266 Ga0495630_0021607
1267 Ga0495630_0046026
1268 Ga0495630_0053346
1269 Ga0495630_0186279
1270 Ga0495630_0312802
1271 Ga0495666_0017824
1272 Ga0495666_0094943
1273 Ga0495652_0003833
1274 Ga0495652_0007884
1275 Ga0495652_0027693
1276 Ga0495652_0039307
1277 Ga0495652_0061661
1278 Ga0495652_0135798
1279 Ga0495652_0140638
1280 Ga0495652_0192626
1281 Ga0495652_0265283
1282 Ga0495665_0003704
1283 Ga0495665_0080084
1284 Ga0495640_0009671
1285 Ga0495640_0024738
1286 Ga0495640_0034087
1287 Ga0495586_0006732
1288 Ga0495586_0016774
1289 Ga0495586_0030341
1290 Ga0495587_0000221
1291 Ga0495587_0010605
1292 Ga0495587_0012380
1293 Ga0495587_0017914
1294 Ga0495587_0175206
1295 Ga0495645_0029199
1296 Ga0495645_0055037
1297 Ga0495645_0240650
1298 Ga0495645_0380932
1299 Ga0495633_0036205
1300 Ga0495667_0000156
1301 Ga0495667_0003041
1302 Ga0495667_0044147
1303 Ga0495667_0054818
1304 Ga0495667_0076706
1305 Ga0495667_0139027
1306 Ga0495667_0279366
1307 Ga0495634_0017932
1308 Ga0495634_0019524
1309 Ga0495634_0228563
1310 Ga0495611_0037042
1311 Ga0495625_0045826
1312 Ga0495625_0105630
1313 Ga0495635_0011746
1314 Ga0495635_0021778
1315 Ga0495657_0000383
1316 Ga0495657_0007636
1317 Ga0495657_0019396
1318 Ga0495657_0025432
1319 Ga0495657_0027950
1320 Ga0495599_0000224
1321 Ga0495599_0003852
1322 Ga0495599_0017522
1323 Ga0495599_0034691
1324 Ga0495599_0177536
1325 Ga0495623_0000136
1326 Ga0495623_0015960
1327 Ga0495623_0041650
1328 Ga0495623_0084959
1329 Ga0495623_0130806
1330 Ga0495646_0003996
1331 Ga0495646_0019941
1332 Ga0495646_0026182
1333 Ga0495646_0046104
1334 Ga0495646_0162440
1335 Ga0495647_0015084
1336 Ga0495658_0027610
1337 Ga0495658_0085467
1338 Ga0495658_0231791
1339 Ga0495613_0032260
1340 Ga0495624_0017806
1341 Ga0495624_0033950
1342 Ga0495670_0001701
1343 Ga0495600_0001287
1344 Ga0495600_0012275
1345 Ga0495600_0030156
1346 Ga0495600_0082397
1347 Ga0495581_0005395
1348 Ga0495581_0017226
1349 Ga0495581_0147098
1350 Ga0495604_0000082
1351 Ga0495604_0006860
1352 Ga0495604_0016534
1353 Ga0495604_0040321
1354 Ga0495604_0041771
1355 Ga0495604_0156466
1356 Ga0495604_0189381
1357 Ga0495674_0002113
1358 Ga0495674_0015419
1359 Ga0495674_0017431
1360 Ga0495674_0086910
1361 Ga0495674_0127737
1362 Ga0495680_0003817
1363 Ga0495680_0013176
1364 Ga0495680_0023802
1365 Ga0495680_0075754
1366 Ga0495680_0082212
1367 Ga0495675_0000412
1368 Ga0495675_0020217
1369 Ga0495675_0037125
1370 Ga0495684_0009561
1371 Ga0495684_0039179
1372 Ga0495684_0065152
1373 Ga0495684_0084864
1374 Ga0495684_0115073
1375 Ga0495684_0226530
1376 Ga0495684_0392843
1377 Ga0495684_0491729
1378 Ga0495593_0006417
1379 Ga0495593_0063331
1380 Ga0495602_0000313
1381 Ga0495602_0033635
1382 Ga0495602_0060885
1383 Ga0495602_0092313
1384 Ga0495602_0132169
1385 Ga0495602_0162873
1386 Ga0495602_0179515
1387 Ga0495614_0022530
1388 Ga0496101_0041381
1389 Ga0496101_0361671
1390 Ga0496102_0070337
1391 Ga0496102_0121043
1392 Ga0496104_0006232
1393 Ga0496104_0038505
1394 Ga0496105_0058690
1395 Ga0496105_0060226
1396 Ga0496107_0490122
1397 Ga0496108_0022674
1398 Ga0496109_0019006
1399 Ga0496109_0028541
1400 Ga0496110_0037690
1401 Ga0496110_0047600
1402 Ga0496110_0159342
1403 Ga0496112_0013857
1404 Ga0496112_0094830
1405 Ga0496112_0486739
1406 Ga0496114_0067779
1407 Ga0496115_0019933
1408 Ga0496115_0021631
1409 Ga0496115_0270040
1410 Ga0496126_0048759
1411 Ga0501031_0002739
1412 Ga0501032_0001062
1413 Ga0501032_0150291
1414 Ga0501033_0013416
1415 Ga0501033_0096445
1416 Ga0501033_0142928
1417 Ga0501034_0008441
1418 Ga0501036_0002819
1419 Ga0501036_0005101
1420 Ga0501036_0256867
1421 Ga0501037_0003576
1422 Ga0501037_0005498
1423 Ga0501038_0006037
1424 Ga0501038_0015893
1425 Ga0501038_0194791
1426 Ga0501039_0032563
1427 Ga0501039_0548223
1428 Ga0501040_0020832
1429 Ga0501040_0041932
1430 Ga0501041_0080710
1431 Ga0501042_0003645
1432 Ga0501042_0013874
1433 Ga0501042_0077476
1434 Ga0501043_0004612
1435 Ga0501043_0021002
1436 Ga0501043_0437928
1437 Ga0501046_0001763
1438 Ga0501047_0000535
1439 Ga0501047_0008610
1440 Ga0501047_0114513
1441 Ga0501047_0480040
1442 Ga0501048_0001513
1443 Ga0501048_0004016
1444 Ga0501048_0235927
1445 Ga0501068_0064549
1446 Ga0501069_0044581
1447 Ga0501070_0004990
1448 Ga0501071_0079117
1449 Ga0501072_0075783
1450 Ga0501073_0014722
1451 Ga0501073_0034461
1452 Ga0501074_0003504
1453 Ga0501074_0014423
1454 Ga0501074_0331129
1455 Ga0501075_0005306
1456 Ga0501076_0153726
1457 Ga0501076_0174475
1458 Ga0501079_0021237
1459 Ga0501079_0188689
1460 Ga0501080_0018406
1461 Ga0501080_0070273
1462 Ga0501081_0037435
1463 Ga0501083_0010229
1464 Ga0501035_0001696
1465 Ga0501035_0065893
1466 Ga0501035_0304391
1467 Ga0501044_0000246
1468 Ga0501044_0008525
1469 Ga0501044_0023676
1470 Ga0501044_0038474
1471 Ga0501045_0072910
1472 Ga0501045_0131074
1473 nmdc:mga03683_1643_c1
1474 nmdc:mga03683_23_c1
1475 nmdc:mga03n38_63773_c1
1476 nmdc:mga00v17_119063_c1
1477 nmdc:mga00v17_135958_c1
1478 nmdc:mga0yw44_103553_c1
1479 nmdc:mga0k408_19330_c1
1480 nmdc:mga0k408_19_c1
1481 nmdc:mga06z11_525_c1
1482 nmdc:mga04h51_803_c1
1483 nmdc:mga07m45_17205_c1
1484 nmdc:mga07m45_31_c1
1485 nmdc:mga07m45_53_c1
1486 nmdc:mga05p37_1250906_c1
1487 nmdc:mga05p37_2131_c2
1488 nmdc:mga05p37_340590_c1
1489 nmdc:mga05p37_9902_c1
1490 nmdc:mga09592_1164_c1
1491 nmdc:mga09592_22087_c1
1492 nmdc:mga09592_88922_c1
1493 nmdc:mga0qj67_339773_c1
1494 nmdc:mga0qj67_77451_c1
1495 nmdc:mga06r32_57566_c1
1496 nmdc:mga08y16_330235_c1
1497 nmdc:mga08y16_82502_c1
1498 nmdc:mga0n895_218029_c1
1499 nmdc:mga0n895_354635_c1
1500 nmdc:mga0n895_396216_c1
1501 nmdc:mga0n895_46083_c1
1502 nmdc:mga0rr50_123575_c1
1503 nmdc:mga0rr50_44834_c1
1504 nmdc:mga08x19_192841_c1
1505 nmdc:mga08x19_333806_c1
1506 nmdc:mga0a205_104981_c1
1507 nmdc:mga0a205_280090_c1
1508 nmdc:mga0a205_309113_c1
1509 nmdc:mga0sz30_1097_c1
1510 Ga0495601_0001684
1511 Ga0495601_0054831
1512 Ga0495601_0091011
1513 Ga0495601_0165528
1514 Ga0495601_0212974
1515 Ga0495612_0047634
1516 Ga0495595_0000925
1517 Ga0495595_0001051
1518 Ga0495595_0106049
1519 Ga0495619_0007502
1520 Ga0495619_0059121
1521 Ga0495619_0131735
1522 Ga0495619_0163017
1523 Ga0495619_0231888
1524 Ga0495619_0243699
1525 Ga0500607_064281
1526 Ga0500559_0039347
1527 Ga0500590_065762
1528 Ga0500622_0000294
1529 Ga0500637_0019520
1530 Ga0500645_001871
1531 Ga0500645_026308
1532 Ga0501084_0063397
1533 Ga0501084_0199999
1534 Ga0501084_0259744
1535 Ga0501084_0313447
1536 Ga0501082_0091980
1537 Ga0501082_0128814
1538 Ga0501082_0292876
1539 Ga0466962_0011392
1540 2676489930
1541 2857486237
1542 2884694760
1543 2891401259
1544 2895436379
1545 2895447192
1546 3003004346
1547 8053952300
1548 8055175973

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

59

120

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

134

232

0.94

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

54

299

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pea-assembly2.cif.gz_D crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9561 4 256
3pea-assembly2.cif.gz_F crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9552 4 256
4jjt-assembly1.cif.gz_C-2 the crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv 0.9515 4 234
3p85-assembly1.cif.gz_A crystal structure enoyl-coa hydratase from mycobacterium avium 0.9496 4 234
3qyr-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa16_2 mycobacterium paratuberculosis atcc baa-968 / k-10 0.9496 4 234
ID Description Score Start End Superfamily
af_Q54BX7_16_236_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9744 3 195 3.90.226.10
af_Q7ZZ04_32_233_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9681 1 199 3.90.226.10
4fzwB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9676 3 199 3.90.226.10
2qq3L01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.96 1 199 3.90.226.10
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9595 95 196 3.90.226.20
ID Description Score Start End GO Terms
AF-A0A2T9Y1X1-F1-model_v4 Enoyl-CoA hydratase 0.9812 3 212 GO:0005739
GO:0006635
GO:0016836
AF-A0A6L2PSF6-F1-model_v4 Enoyl-CoA hydratase 0.9772 3 212 GO:0005739
GO:0006635
GO:0016836
AF-A0A671EIJ6-F1-model_v4 Enoyl-CoA hydratase, mitochondrial (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) 0.9766 2 213 GO:0005739
GO:0006635
GO:0043956
AF-A0A5E4DHQ8-F1-model_v4 Enoyl-CoA hydratase, mitochondrial (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) 0.9766 4 212 GO:0005739
GO:0006635
GO:0016836
AF-A0A7J7UW85-F1-model_v4 Enoyl-CoA hydratase, mitochondrial (Enoyl-CoA hydratase 1) (Short-chain enoyl-CoA hydratase) 0.9763 2 215 GO:0005739
GO:0006635
GO:0016836

Map