F480165
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 383 | 1546 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10073786|Ga0182008_100737862 |
| Length | 180 |
| Sequence | MTTARGRSRRSAHGRLASLFLSFGRFDLMNHSLQLKLLDSRYGGEWPLPAYATEASAGLDLRAALDQSLVLHPGDAALVPSGLAIHLGDPSLCAVILPRSGLGHKHGIVLGNGTGLIDADYQGPLLISLWNRGRETFTIQPGDRIAQLVVLPIVRASLQVVDQFEASHRGDGGFGHTGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 78 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 79 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 80 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 81 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 94 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 168 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 169 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 170 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 171 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 193 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 194 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 195 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 196 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 197 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 198 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 199 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 210 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 213 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 223 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 224 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 225 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 226 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 227 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 286 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 308 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 313 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 316 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 317 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 326 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 327 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 328 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 329 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 330 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 331 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 332 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 333 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 334 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 335 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 336 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 337 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 338 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 339 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 340 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 341 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 342 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 343 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 344 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 345 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 346 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 347 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 348 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 349 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 350 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 351 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 352 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 353 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 354 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 355 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 356 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 357 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 358 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 359 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 360 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 361 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 362 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 363 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 364 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 365 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 366 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 367 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 368 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 369 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 370 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 371 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 372 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 373 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 374 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 375 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 376 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 377 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 378 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 379 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 380 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 381 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 382 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 383 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.33 |
| Metatranscriptomes | 1.16 |
| Isolates | 7.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.9 |
| Nodule | 0.26 |
| Rhizoplane | 5.56 |
| Rhizosphere | 66.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10073786 | 3300014497 | Bacteria | 1678 |
| 2 | SwRhRL2b_contig_1735385 | 2162886007 | Bacteria | 4183 |
| 3 | SwRhRL2b_contig_3057749 | 2162886007 | Bacteria | 1191 |
| 4 | JGI24736J21556_1006444 | 3300001904 | Bacteria | 1975 |
| 5 | JGI24741J21665_1000902 | 3300001915 | Bacteria | 8943 |
| 6 | JGI24740J21852_10013378 | 3300001979 | Bacteria | 3062 |
| 7 | JGI25152J39213_1000076 | 3300002773 | Bacteria | 66295 |
| 8 | JGI25150J39212_1000530 | 3300002774 | Bacteria | 15563 |
| 9 | JGI25151J46595_10000231 | 3300003187 | Bacteria | 66295 |
| 10 | JGI25151J46595_10013068 | 3300003187 | Bacteria | 3747 |
| 11 | JGI25153J46596_10000166 | 3300003215 | Bacteria | 66295 |
| 12 | rootH2_10011547 | 3300003320 | Bacteria | 6663 |
| 13 | Ga0055526_1000107 | 3300003771 | Bacteria | 72819 |
| 14 | Ga0055526_1006559 | 3300003771 | Bacteria | 6279 |
| 15 | Ga0055526_1006992 | 3300003771 | Bacteria | 5985 |
| 16 | Ga0055537_1000147 | 3300003773 | Bacteria | 52610 |
| 17 | Ga0055537_1000299 | 3300003773 | Bacteria | 34588 |
| 18 | Ga0055524_1000176 | 3300003775 | Bacteria | 72819 |
| 19 | Ga0055524_1015049 | 3300003775 | Bacteria | 2838 |
| 20 | Ga0055536_1001750 | 3300003781 | Bacteria | 12809 |
| 21 | Ga0055536_1002416 | 3300003781 | Bacteria | 10502 |
| 22 | Ga0055536_1004645 | 3300003781 | Bacteria | 6946 |
| 23 | Ga0055536_1012468 | 3300003781 | Bacteria | 3152 |
| 24 | Ga0055536_1022961 | 3300003781 | Bacteria | 1846 |
| 25 | Ga0055534_1000090 | 3300003784 | Bacteria | 71465 |
| 26 | Ga0055534_1000322 | 3300003784 | Bacteria | 31844 |
| 27 | Ga0055534_1000837 | 3300003784 | Bacteria | 14168 |
| 28 | Ga0055528_1000088 | 3300003790 | Bacteria | 72819 |
| 29 | Ga0055528_1000194 | 3300003790 | Bacteria | 51826 |
| 30 | Ga0055530_10001839 | 3300003791 | Bacteria | 14615 |
| 31 | Ga0055530_10002248 | 3300003791 | Bacteria | 12723 |
| 32 | Ga0055530_10002449 | 3300003791 | Bacteria | 11933 |
| 33 | Ga0055540_1016642 | 3300003792 | Bacteria | 2083 |
| 34 | Ga0055531_10003516 | 3300003794 | Bacteria | 9962 |
| 35 | Ga0055531_10008428 | 3300003794 | Bacteria | 5438 |
| 36 | Ga0058692_1000005 | 3300003856 | Bacteria | 398815 |
| 37 | Ga0058692_1000021 | 3300003856 | Bacteria | 240308 |
| 38 | Ga0065714_10108158 | 3300005288 | Bacteria | 1519 |
| 39 | Ga0065704_10071322 | 3300005289 | Bacteria | 11740 |
| 40 | Ga0065704_10187846 | 3300005289 | Bacteria | 1204 |
| 41 | Ga0065715_10031725 | 3300005293 | Bacteria | 1420 |
| 42 | Ga0065715_10111242 | 3300005293 | Bacteria | 2580 |
| 43 | Ga0065715_10218496 | 3300005293 | Bacteria | 1282 |
| 44 | Ga0065715_10260000 | 3300005293 | Bacteria | 1139 |
| 45 | Ga0065715_10392576 | 3300005293 | Bacteria | 892 |
| 46 | Ga0070658_10065811 | 3300005327 | Bacteria | 2959 |
| 47 | Ga0070683_100765709 | 3300005329 | Bacteria | 925 |
| 48 | Ga0070683_100833271 | 3300005329 | Bacteria | 884 |
| 49 | Ga0070670_100032140 | 3300005331 | Bacteria | 4520 |
| 50 | Ga0070670_100579330 | 3300005331 | Bacteria | 1003 |
| 51 | Ga0070670_100835604 | 3300005331 | Bacteria | 833 |
| 52 | Ga0070677_10229757 | 3300005333 | Bacteria | 911 |
| 53 | Ga0070677_10729348 | 3300005333 | Bacteria | 560 |
| 54 | Ga0070666_10800520 | 3300005335 | Bacteria | 694 |
| 55 | Ga0070680_100844357 | 3300005336 | Bacteria | 789 |
| 56 | Ga0070680_100965773 | 3300005336 | Bacteria | 735 |
| 57 | Ga0070682_100091334 | 3300005337 | Bacteria | 1993 |
| 58 | Ga0070660_100017200 | 3300005339 | Bacteria | 5267 |
| 59 | Ga0070660_100213612 | 3300005339 | Bacteria | 1566 |
| 60 | Ga0070689_101464279 | 3300005340 | Bacteria | 618 |
| 61 | Ga0070661_100192569 | 3300005344 | Bacteria | 1556 |
| 62 | Ga0070661_100830832 | 3300005344 | Bacteria | 759 |
| 63 | Ga0070668_100017205 | 3300005347 | Bacteria | 5411 |
| 64 | Ga0070668_100082220 | 3300005347 | Bacteria | 2526 |
| 65 | Ga0070668_100559441 | 3300005347 | Bacteria | 996 |
| 66 | Ga0070669_100374018 | 3300005353 | Bacteria | 1161 |
| 67 | Ga0070675_100222296 | 3300005354 | Bacteria | 1645 |
| 68 | Ga0070671_100061411 | 3300005355 | Bacteria | 3130 |
| 69 | Ga0070671_100116693 | 3300005355 | Bacteria | 2244 |
| 70 | Ga0070671_100753266 | 3300005355 | Bacteria | 846 |
| 71 | Ga0070674_100245789 | 3300005356 | Bacteria | 1403 |
| 72 | Ga0070674_100987612 | 3300005356 | Bacteria | 738 |
| 73 | Ga0070673_100102802 | 3300005364 | Bacteria | 2356 |
| 74 | Ga0070659_100081947 | 3300005366 | Bacteria | 2577 |
| 75 | Ga0070659_100740290 | 3300005366 | Bacteria | 852 |
| 76 | Ga0070667_100314501 | 3300005367 | Bacteria | 1412 |
| 77 | Ga0070667_101376530 | 3300005367 | Bacteria | 662 |
| 78 | Ga0070701_10378711 | 3300005438 | Bacteria | 891 |
| 79 | Ga0070663_100113960 | 3300005455 | Bacteria | 2035 |
| 80 | Ga0070663_100673681 | 3300005455 | Bacteria | 877 |
| 81 | Ga0070678_100040771 | 3300005456 | Bacteria | 3287 |
| 82 | Ga0070681_10398300 | 3300005458 | Bacteria | 1288 |
| 83 | Ga0070681_10886440 | 3300005458 | Bacteria | 810 |
| 84 | Ga0068867_100051053 | 3300005459 | Bacteria | 3049 |
| 85 | Ga0070679_100193708 | 3300005530 | Bacteria | 2001 |
| 86 | Ga0068853_100395029 | 3300005539 | Bacteria | 1293 |
| 87 | Ga0070672_100171919 | 3300005543 | Bacteria | 1802 |
| 88 | Ga0070696_100093329 | 3300005546 | Bacteria | 2146 |
| 89 | Ga0070693_100001019 | 3300005547 | Bacteria | 12488 |
| 90 | Ga0070665_100238917 | 3300005548 | Bacteria | 1817 |
| 91 | Ga0068855_101532279 | 3300005563 | Bacteria | 684 |
| 92 | Ga0070664_100007922 | 3300005564 | Bacteria | 8580 |
| 93 | Ga0070664_100065343 | 3300005564 | Bacteria | 3104 |
| 94 | Ga0068857_101036706 | 3300005577 | Bacteria | 790 |
| 95 | Ga0068854_100823886 | 3300005578 | Bacteria | 810 |
| 96 | Ga0068852_100012784 | 3300005616 | Bacteria | 6394 |
| 97 | Ga0068852_101215047 | 3300005616 | Bacteria | 775 |
| 98 | Ga0068859_100618195 | 3300005617 | Bacteria | 1176 |
| 99 | Ga0068861_100237731 | 3300005719 | Bacteria | 1548 |
| 100 | Ga0068861_100289575 | 3300005719 | Bacteria | 1414 |
| 101 | Ga0068851_10134654 | 3300005834 | Bacteria | 1339 |
| 102 | Ga0068870_10944277 | 3300005840 | Bacteria | 612 |
| 103 | Ga0068863_101294799 | 3300005841 | Bacteria | 736 |
| 104 | Ga0068862_101251349 | 3300005844 | Bacteria | 742 |
| 105 | Ga0081539_10016629 | 3300005985 | Bacteria | 5234 |
| 106 | Ga0075364_10173314 | 3300006051 | Bacteria | 1458 |
| 107 | Ga0075364_10300602 | 3300006051 | Bacteria | 1092 |
| 108 | Ga0075362_10222707 | 3300006177 | Bacteria | 922 |
| 109 | Ga0097620_100618191 | 3300006931 | Bacteria | 1176 |
| 110 | Ga0079104_1111531 | 3300006946 | Bacteria | 541 |
| 111 | Ga0105251_10000014 | 3300009011 | Bacteria | 150347 |
| 112 | Ga0105251_10002449 | 3300009011 | Bacteria | 14578 |
| 113 | Ga0105244_10065862 | 3300009036 | Bacteria | 1814 |
| 114 | Ga0105240_10072642 | 3300009093 | Bacteria | 4252 |
| 115 | Ga0105240_10208081 | 3300009093 | Bacteria | 2288 |
| 116 | Ga0105243_10003907 | 3300009148 | Bacteria | 11896 |
| 117 | Ga0105243_10022428 | 3300009148 | Bacteria | 4799 |
| 118 | Ga0105243_10037668 | 3300009148 | Bacteria | 3761 |
| 119 | Ga0105242_10108908 | 3300009176 | Bacteria | 2358 |
| 120 | Ga0105248_10407810 | 3300009177 | Bacteria | 1530 |
| 121 | Ga0105248_10919564 | 3300009177 | Bacteria | 988 |
| 122 | Ga0105248_13353722 | 3300009177 | Bacteria | 509 |
| 123 | Ga0105032_102531 | 3300009979 | Bacteria | 1628 |
| 124 | Ga0105246_10280278 | 3300011119 | Bacteria | 1337 |
| 125 | Ga0157318_1000725 | 3300012482 | Bacteria | 1511 |
| 126 | Ga0157322_1011021 | 3300012490 | Bacteria | 739 |
| 127 | Ga0157316_1000454 | 3300012510 | Bacteria | 2150 |
| 128 | Ga0157327_1000792 | 3300012512 | Bacteria | 1809 |
| 129 | Ga0157327_1019029 | 3300012512 | Bacteria | 755 |
| 130 | Ga0154019_129338 | 3300013044 | Bacteria | 699 |
| 131 | Ga0157373_10022336 | 3300013100 | Bacteria | 4589 |
| 132 | Ga0157373_10268713 | 3300013100 | Bacteria | 1207 |
| 133 | Ga0157373_10800651 | 3300013100 | Bacteria | 695 |
| 134 | Ga0157371_10003036 | 3300013102 | Bacteria | 15589 |
| 135 | Ga0157371_10018618 | 3300013102 | Bacteria | 5131 |
| 136 | Ga0157371_10117669 | 3300013102 | Bacteria | 1889 |
| 137 | Ga0157371_11033775 | 3300013102 | Bacteria | 628 |
| 138 | Ga0157371_11034349 | 3300013102 | Bacteria | 628 |
| 139 | Ga0157370_10090271 | 3300013104 | Bacteria | 2877 |
| 140 | Ga0157370_10110821 | 3300013104 | Bacteria | 2565 |
| 141 | Ga0157370_10147983 | 3300013104 | Bacteria | 2186 |
| 142 | Ga0157369_10165624 | 3300013105 | Bacteria | 2331 |
| 143 | Ga0157369_10314518 | 3300013105 | Bacteria | 1628 |
| 144 | Ga0163162_10875449 | 3300013306 | Bacteria | 1012 |
| 145 | Ga0163162_10930318 | 3300013306 | Bacteria | 981 |
| 146 | Ga0157372_10074997 | 3300013307 | Bacteria | 3815 |
| 147 | Ga0157372_10351287 | 3300013307 | Bacteria | 1718 |
| 148 | Ga0157375_10619585 | 3300013308 | Bacteria | 1240 |
| 149 | Ga0157380_10355758 | 3300014326 | Bacteria | 1372 |
| 150 | Ga0157380_10397465 | 3300014326 | Bacteria | 1306 |
| 151 | Ga0157380_10418061 | 3300014326 | Bacteria | 1278 |
| 152 | Ga0182008_10004347 | 3300014497 | Bacteria | 8287 |
| 153 | Ga0182008_10116459 | 3300014497 | Bacteria | 1326 |
| 154 | Ga0182008_10204165 | 3300014497 | Bacteria | 1007 |
| 155 | Ga0182006_1023345 | 3300015261 | Bacteria | 2562 |
| 156 | Ga0182006_1029292 | 3300015261 | Bacteria | 2231 |
| 157 | Ga0182006_1035632 | 3300015261 | Bacteria | 1982 |
| 158 | Ga0182006_1046573 | 3300015261 | Bacteria | 1684 |
| 159 | Ga0182006_1057926 | 3300015261 | Bacteria | 1471 |
| 160 | Ga0182007_10000500 | 3300015262 | Bacteria | 23316 |
| 161 | Ga0182005_1000186 | 3300015265 | Bacteria | 42690 |
| 162 | Ga0182005_1028194 | 3300015265 | Bacteria | 1531 |
| 163 | Ga0183360_10004 | 3300015689 | Bacteria | 289992 |
| 164 | Ga0183361_10143 | 3300016635 | Bacteria | 2422 |
| 165 | Ga0163161_10309616 | 3300017792 | Bacteria | 1246 |
| 166 | Ga0163161_10380784 | 3300017792 | Bacteria | 1128 |
| 167 | Ga0163161_10602251 | 3300017792 | Bacteria | 906 |
| 168 | Ga0206356_11710452 | 3300020070 | Bacteria | 7545 |
| 169 | Ga0206351_10226310 | 3300020077 | Bacteria | 5919 |
| 170 | Ga0206350_11473204 | 3300020080 | Bacteria | 2927 |
| 171 | Ga0206354_10337747 | 3300020081 | Bacteria | 3089 |
| 172 | Ga0206353_10206423 | 3300020082 | Bacteria | 709 |
| 173 | Ga0206353_10721119 | 3300020082 | Bacteria | 896 |
| 174 | Ga0206353_10726987 | 3300020082 | Bacteria | 2174 |
| 175 | Ga0154015_1073503 | 3300020610 | Bacteria | 8676 |
| 176 | Ga0207425_1000029 | 3300025245 | Bacteria | 268521 |
| 177 | Ga0209129_1000216 | 3300025258 | Bacteria | 66352 |
| 178 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 179 | Ga0209565_1000071 | 3300025263 | Bacteria | 166213 |
| 180 | Ga0209565_1006967 | 3300025263 | Bacteria | 3102 |
| 181 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 182 | Ga0209673_1001159 | 3300025273 | Bacteria | 28752 |
| 183 | Ga0209673_1005118 | 3300025273 | Bacteria | 6717 |
| 184 | Ga0209130_1023919 | 3300025284 | Bacteria | 1340 |
| 185 | Ga0209130_1024273 | 3300025284 | Bacteria | 1325 |
| 186 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 187 | Ga0209675_1000018 | 3300025291 | Bacteria | 377481 |
| 188 | Ga0209675_1003998 | 3300025291 | Bacteria | 6729 |
| 189 | Ga0209675_1004010 | 3300025291 | Bacteria | 6718 |
| 190 | Ga0209676_1000035 | 3300025292 | Bacteria | 459284 |
| 191 | Ga0209676_1000185 | 3300025292 | Bacteria | 142505 |
| 192 | Ga0209676_1000248 | 3300025292 | Bacteria | 115456 |
| 193 | Ga0209676_1001632 | 3300025292 | Bacteria | 19793 |
| 194 | Ga0209676_1002505 | 3300025292 | Bacteria | 12861 |
| 195 | Ga0209676_1003269 | 3300025292 | Bacteria | 10188 |
| 196 | Ga0209676_1004137 | 3300025292 | Bacteria | 8260 |
| 197 | Ga0209676_1004879 | 3300025292 | Bacteria | 7244 |
| 198 | Ga0209676_1015746 | 3300025292 | Bacteria | 2767 |
| 199 | Ga0209025_1000076 | 3300025294 | Bacteria | 273934 |
| 200 | Ga0209025_1002264 | 3300025294 | Bacteria | 21076 |
| 201 | Ga0209025_1003682 | 3300025294 | Bacteria | 14145 |
| 202 | Ga0209025_1046408 | 3300025294 | Bacteria | 1787 |
| 203 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 204 | Ga0209564_1000148 | 3300025295 | Bacteria | 172177 |
| 205 | Ga0209564_1016519 | 3300025295 | Bacteria | 2932 |
| 206 | Ga0209758_1000473 | 3300025297 | Bacteria | 66352 |
| 207 | Ga0209758_1029718 | 3300025297 | Bacteria | 2277 |
| 208 | Ga0209050_1000182 | 3300025298 | Bacteria | 142435 |
| 209 | Ga0209050_1000865 | 3300025298 | Bacteria | 40908 |
| 210 | Ga0209050_1000896 | 3300025298 | Bacteria | 39492 |
| 211 | Ga0209050_1006684 | 3300025298 | Bacteria | 6750 |
| 212 | Ga0209050_1021068 | 3300025298 | Bacteria | 2394 |
| 213 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 214 | Ga0209256_1002608 | 3300025299 | Bacteria | 14282 |
| 215 | Ga0209256_1004525 | 3300025299 | Bacteria | 8674 |
| 216 | Ga0209256_1004737 | 3300025299 | Bacteria | 8317 |
| 217 | Ga0209256_1008272 | 3300025299 | Bacteria | 4864 |
| 218 | Ga0209256_1020379 | 3300025299 | Bacteria | 2071 |
| 219 | Ga0207426_1063551 | 3300025302 | Bacteria | 1053 |
| 220 | Ga0209051_1001212 | 3300025303 | Bacteria | 23226 |
| 221 | Ga0209051_1023573 | 3300025303 | Bacteria | 2554 |
| 222 | Ga0209257_1000154 | 3300025304 | Bacteria | 185887 |
| 223 | Ga0209257_1000348 | 3300025304 | Bacteria | 95101 |
| 224 | Ga0209257_1000470 | 3300025304 | Bacteria | 73603 |
| 225 | Ga0209257_1000611 | 3300025304 | Bacteria | 58189 |
| 226 | Ga0209257_1001025 | 3300025304 | Bacteria | 37552 |
| 227 | Ga0209257_1002151 | 3300025304 | Bacteria | 20504 |
| 228 | Ga0209257_1002742 | 3300025304 | Bacteria | 16697 |
| 229 | Ga0209257_1002838 | 3300025304 | Bacteria | 16251 |
| 230 | Ga0209257_1003916 | 3300025304 | Bacteria | 12102 |
| 231 | Ga0209257_1021017 | 3300025304 | Bacteria | 2387 |
| 232 | Ga0207656_10048365 | 3300025321 | Bacteria | 1831 |
| 233 | Ga0207655_1088582 | 3300025728 | Bacteria | 1095 |
| 234 | Ga0207713_1000290 | 3300025735 | Bacteria | 58238 |
| 235 | Ga0207713_1007313 | 3300025735 | Bacteria | 6540 |
| 236 | Ga0207682_10105183 | 3300025893 | Bacteria | 1238 |
| 237 | Ga0207682_10122292 | 3300025893 | Bacteria | 1155 |
| 238 | Ga0207647_10000890 | 3300025904 | Bacteria | 23143 |
| 239 | Ga0207643_10185001 | 3300025908 | Bacteria | 1262 |
| 240 | Ga0207705_10002475 | 3300025909 | Bacteria | 14229 |
| 241 | Ga0207705_10010051 | 3300025909 | Bacteria | 6887 |
| 242 | Ga0207705_10161744 | 3300025909 | Bacteria | 1682 |
| 243 | Ga0207707_10001264 | 3300025912 | Bacteria | 23623 |
| 244 | Ga0207707_10003347 | 3300025912 | Bacteria | 14229 |
| 245 | Ga0207707_10453110 | 3300025912 | Bacteria | 1098 |
| 246 | Ga0207695_10006903 | 3300025913 | Bacteria | 14602 |
| 247 | Ga0207695_10011668 | 3300025913 | Bacteria | 10620 |
| 248 | Ga0207660_10009796 | 3300025917 | Bacteria | 6205 |
| 249 | Ga0207660_10010767 | 3300025917 | Bacteria | 5943 |
| 250 | Ga0207660_10562083 | 3300025917 | Bacteria | 928 |
| 251 | Ga0207662_10290782 | 3300025918 | Bacteria | 1084 |
| 252 | Ga0207657_10051651 | 3300025919 | Bacteria | 3573 |
| 253 | Ga0207657_10699508 | 3300025919 | Bacteria | 787 |
| 254 | Ga0207649_10003122 | 3300025920 | Bacteria | 9089 |
| 255 | Ga0207652_10001254 | 3300025921 | Bacteria | 22591 |
| 256 | Ga0207652_10003823 | 3300025921 | Bacteria | 12344 |
| 257 | Ga0207681_10028705 | 3300025923 | Bacteria | 3606 |
| 258 | Ga0207681_10144850 | 3300025923 | Bacteria | 1774 |
| 259 | Ga0207650_10325159 | 3300025925 | Bacteria | 1260 |
| 260 | Ga0207659_10122478 | 3300025926 | Bacteria | 1995 |
| 261 | Ga0207644_10036484 | 3300025931 | Bacteria | 3452 |
| 262 | Ga0207644_10042516 | 3300025931 | Bacteria | 3220 |
| 263 | Ga0207644_10218122 | 3300025931 | Bacteria | 1511 |
| 264 | Ga0207644_10323305 | 3300025931 | Bacteria | 1248 |
| 265 | Ga0207690_10036274 | 3300025932 | Bacteria | 3191 |
| 266 | Ga0207709_10001022 | 3300025935 | Bacteria | 20703 |
| 267 | Ga0207709_10002288 | 3300025935 | Bacteria | 12152 |
| 268 | Ga0207709_10161677 | 3300025935 | Bacteria | 1562 |
| 269 | Ga0207669_10245256 | 3300025937 | Bacteria | 1330 |
| 270 | Ga0207669_10611396 | 3300025937 | Bacteria | 887 |
| 271 | Ga0207691_10007261 | 3300025940 | Bacteria | 10684 |
| 272 | Ga0207691_10128498 | 3300025940 | Bacteria | 2240 |
| 273 | Ga0207711_11017361 | 3300025941 | Bacteria | 768 |
| 274 | Ga0207711_11269628 | 3300025941 | Bacteria | 678 |
| 275 | Ga0207661_10011573 | 3300025944 | Bacteria | 6399 |
| 276 | Ga0207679_10034352 | 3300025945 | Bacteria | 3576 |
| 277 | Ga0207679_10367417 | 3300025945 | Bacteria | 1258 |
| 278 | Ga0207679_10974384 | 3300025945 | Bacteria | 777 |
| 279 | Ga0207679_11410404 | 3300025945 | Bacteria | 639 |
| 280 | Ga0207667_10036564 | 3300025949 | Bacteria | 5262 |
| 281 | Ga0207667_10435844 | 3300025949 | Bacteria | 1333 |
| 282 | Ga0207651_10150870 | 3300025960 | Bacteria | 1809 |
| 283 | Ga0207651_11039770 | 3300025960 | Bacteria | 733 |
| 284 | Ga0207668_10002517 | 3300025972 | Bacteria | 10702 |
| 285 | Ga0207668_10589693 | 3300025972 | Bacteria | 967 |
| 286 | Ga0207640_10476289 | 3300025981 | Bacteria | 1034 |
| 287 | Ga0207658_10159626 | 3300025986 | Bacteria | 1847 |
| 288 | Ga0207639_10001300 | 3300026041 | Bacteria | 16879 |
| 289 | Ga0207678_10778947 | 3300026067 | Bacteria | 844 |
| 290 | Ga0207702_10004226 | 3300026078 | Bacteria | 12830 |
| 291 | Ga0207648_10048102 | 3300026089 | Bacteria | 3735 |
| 292 | Ga0207676_11025218 | 3300026095 | Bacteria | 814 |
| 293 | Ga0207674_10933704 | 3300026116 | Bacteria | 836 |
| 294 | Ga0207675_100178501 | 3300026118 | Bacteria | 2033 |
| 295 | Ga0207675_100193144 | 3300026118 | Bacteria | 1953 |
| 296 | Ga0207675_100269526 | 3300026118 | Bacteria | 1652 |
| 297 | Ga0207683_10053759 | 3300026121 | Bacteria | 3531 |
| 298 | Ga0207683_10183061 | 3300026121 | Bacteria | 1900 |
| 299 | Ga0207698_10000835 | 3300026142 | Bacteria | 17845 |
| 300 | Ga0207698_10328092 | 3300026142 | Bacteria | 1436 |
| 301 | Ga0209371_1000031 | 3300027312 | Bacteria | 399263 |
| 302 | Ga0209371_1000045 | 3300027312 | Bacteria | 316174 |
| 303 | Ga0209999_1031017 | 3300027543 | Bacteria | 992 |
| 304 | Ga0209982_1002311 | 3300027552 | Bacteria | 2672 |
| 305 | Ga0210002_1027152 | 3300027617 | Bacteria | 942 |
| 306 | Ga0209983_1001352 | 3300027665 | Bacteria | 5460 |
| 307 | Ga0209971_1000880 | 3300027682 | Bacteria | 7709 |
| 308 | Ga0209974_10117793 | 3300027876 | Bacteria | 939 |
| 309 | Ga0209974_10278191 | 3300027876 | Bacteria | 636 |
| 310 | Ga0268266_10015106 | 3300028379 | Bacteria | 6631 |
| 311 | Ga0268266_10065663 | 3300028379 | Bacteria | 3137 |
| 312 | Ga0268266_10153289 | 3300028379 | Bacteria | 2079 |
| 313 | Ga0268265_11349322 | 3300028380 | Bacteria | 714 |
| 314 | Ga0307515_10306778 | 3300028794 | Bacteria | 1266 |
| 315 | Ga0268256_1000034 | 3300030500 | Bacteria | 398909 |
| 316 | Ga0268256_1000047 | 3300030500 | Bacteria | 316174 |
| 317 | Ga0316177_1065610 | 3300030731 | Bacteria | 6788 |
| 318 | Ga0316176_1173906 | 3300030732 | Bacteria | 3511 |
| 319 | Ga0314311_1089126 | 3300030733 | Bacteria | 6400 |
| 320 | Ga0316181_1125246 | 3300030744 | Bacteria | 714 |
| 321 | Ga0316182_1011388 | 3300030745 | Bacteria | 2188 |
| 322 | Ga0307513_10008176 | 3300031456 | Bacteria | 13424 |
| 323 | Ga0307513_10114462 | 3300031456 | Bacteria | 2682 |
| 324 | Ga0307513_10233009 | 3300031456 | Bacteria | 1653 |
| 325 | Ga0307509_10000566 | 3300031507 | Bacteria | 63345 |
| 326 | Ga0307408_100025339 | 3300031548 | Bacteria | 4062 |
| 327 | Ga0307408_100129644 | 3300031548 | Bacteria | 1966 |
| 328 | Ga0307408_100577117 | 3300031548 | Bacteria | 996 |
| 329 | Ga0307408_100794203 | 3300031548 | Bacteria | 858 |
| 330 | Ga0307408_101096401 | 3300031548 | Bacteria | 738 |
| 331 | Ga0307405_10109363 | 3300031731 | Bacteria | 1870 |
| 332 | Ga0307405_10357418 | 3300031731 | Bacteria | 1129 |
| 333 | Ga0307405_10554793 | 3300031731 | Bacteria | 930 |
| 334 | Ga0307413_10012467 | 3300031824 | Bacteria | 4234 |
| 335 | Ga0307413_10173591 | 3300031824 | Bacteria | 1528 |
| 336 | Ga0307413_10233368 | 3300031824 | Bacteria | 1353 |
| 337 | Ga0307413_10496821 | 3300031824 | Bacteria | 979 |
| 338 | Ga0307413_10673485 | 3300031824 | Bacteria | 856 |
| 339 | Ga0307413_10679676 | 3300031824 | Bacteria | 853 |
| 340 | Ga0307410_10056716 | 3300031852 | Bacteria | 2665 |
| 341 | Ga0307410_10576654 | 3300031852 | Bacteria | 936 |
| 342 | Ga0307410_10867676 | 3300031852 | Bacteria | 771 |
| 343 | Ga0307410_10916808 | 3300031852 | Bacteria | 751 |
| 344 | Ga0307406_10016668 | 3300031901 | Bacteria | 4276 |
| 345 | Ga0307406_10017565 | 3300031901 | Bacteria | 4167 |
| 346 | Ga0307406_10088204 | 3300031901 | Bacteria | 2081 |
| 347 | Ga0307407_10278344 | 3300031903 | Bacteria | 1158 |
| 348 | Ga0307407_10641623 | 3300031903 | Bacteria | 795 |
| 349 | Ga0307412_10001099 | 3300031911 | Bacteria | 15496 |
| 350 | Ga0307412_10213123 | 3300031911 | Bacteria | 1475 |
| 351 | Ga0307412_10978919 | 3300031911 | Bacteria | 746 |
| 352 | Ga0307412_11944044 | 3300031911 | Bacteria | 543 |
| 353 | Ga0307409_100273287 | 3300031995 | Bacteria | 1557 |
| 354 | Ga0307416_100519871 | 3300032002 | Bacteria | 1258 |
| 355 | Ga0307416_100586486 | 3300032002 | Bacteria | 1193 |
| 356 | Ga0307414_10004133 | 3300032004 | Bacteria | 7838 |
| 357 | Ga0307414_10007643 | 3300032004 | Bacteria | 6084 |
| 358 | Ga0307414_10018313 | 3300032004 | Bacteria | 4307 |
| 359 | Ga0307414_10061238 | 3300032004 | Bacteria | 2665 |
| 360 | Ga0307414_10064446 | 3300032004 | Bacteria | 2609 |
| 361 | Ga0307414_10099940 | 3300032004 | Bacteria | 2181 |
| 362 | Ga0307414_10101031 | 3300032004 | Bacteria | 2170 |
| 363 | Ga0307414_10143525 | 3300032004 | Bacteria | 1872 |
| 364 | Ga0307414_10167432 | 3300032004 | Bacteria | 1753 |
| 365 | Ga0307414_10169330 | 3300032004 | Bacteria | 1744 |
| 366 | Ga0307414_10208240 | 3300032004 | Bacteria | 1596 |
| 367 | Ga0307414_10247937 | 3300032004 | Bacteria | 1478 |
| 368 | Ga0307414_10277569 | 3300032004 | Bacteria | 1406 |
| 369 | Ga0307414_10284792 | 3300032004 | Bacteria | 1390 |
| 370 | Ga0307414_10306313 | 3300032004 | Bacteria | 1346 |
| 371 | Ga0307414_10385489 | 3300032004 | Bacteria | 1213 |
| 372 | Ga0307414_10425236 | 3300032004 | Bacteria | 1159 |
| 373 | Ga0307414_11415311 | 3300032004 | Bacteria | 646 |
| 374 | Ga0307411_10103182 | 3300032005 | Bacteria | 2022 |
| 375 | Ga0307411_10139037 | 3300032005 | Bacteria | 1788 |
| 376 | Ga0307411_10142218 | 3300032005 | Bacteria | 1771 |
| 377 | Ga0307411_10221821 | 3300032005 | Bacteria | 1467 |
| 378 | Ga0307411_10234605 | 3300032005 | Bacteria | 1432 |
| 379 | Ga0307411_10498920 | 3300032005 | Bacteria | 1028 |
| 380 | Ga0307411_11402249 | 3300032005 | Bacteria | 639 |
| 381 | Ga0307411_12043738 | 3300032005 | Bacteria | 535 |
| 382 | Ga0307415_100455479 | 3300032126 | Bacteria | 1107 |
| 383 | Ga0307415_100580651 | 3300032126 | Bacteria | 994 |
| 384 | Ga0307415_101277245 | 3300032126 | Bacteria | 694 |
| 385 | Ga0307415_101745220 | 3300032126 | Bacteria | 601 |
| 386 | Ga0316584_0202741 | 3300036712 | Bacteria | 1463 |
| 387 | Ga0395899_0034263 | 3300037312 | Bacteria | 3812 |
| 388 | Ga0395899_0338679 | 3300037312 | Bacteria | 1009 |
| 389 | Ga0395900_0158839 | 3300037418 | Bacteria | 2307 |
| 390 | Ga0395898_0177422 | 3300037466 | Bacteria | 2036 |
| 391 | Ga0395905_0002323 | 3300037471 | Bacteria | 21279 |
| 392 | Ga0395905_0126074 | 3300037471 | Bacteria | 2407 |
| 393 | Ga0395905_0130312 | 3300037471 | Bacteria | 2365 |
| 394 | Ga0395905_0256919 | 3300037471 | Bacteria | 1632 |
| 395 | Ga0395905_0709179 | 3300037471 | Bacteria | 908 |
| 396 | Ga0395901_0142130 | 3300038443 | Bacteria | 2522 |
| 397 | Ga0237819_01020 | 3300038705 | Bacteria | 8403 |
| 398 | Ga0439436_0005257 | 3300041404 | Bacteria | 3964 |
| 399 | Ga0439436_0006797 | 3300041404 | Bacteria | 3516 |
| 400 | Ga0439436_0014468 | 3300041404 | Bacteria | 2379 |
| 401 | Ga0439436_0027328 | 3300041404 | Bacteria | 1669 |
| 402 | Ga0439436_0028860 | 3300041404 | Bacteria | 1618 |
| 403 | Ga0439436_0036701 | 3300041404 | Bacteria | 1413 |
| 404 | Ga0439439_0001752 | 3300041406 | Bacteria | 4433 |
| 405 | Ga0439439_0114542 | 3300041406 | Bacteria | 749 |
| 406 | Ga0439447_002949 | 3300041407 | Bacteria | 6096 |
| 407 | Ga0439461_0003662 | 3300041410 | Bacteria | 2535 |
| 408 | Ga0439466_0086037 | 3300041411 | Bacteria | 988 |
| 409 | Ga0439465_0003842 | 3300041413 | Bacteria | 4902 |
| 410 | Ga0439465_0004300 | 3300041413 | Bacteria | 4621 |
| 411 | Ga0439465_0088744 | 3300041413 | Bacteria | 1056 |
| 412 | Ga0451789_0367235 | 3300041443 | Bacteria | 1109 |
| 413 | Ga0451789_0389000 | 3300041443 | Bacteria | 1032 |
| 414 | Ga0451791_0110578 | 3300041451 | Bacteria | 986 |
| 415 | Ga0451791_0632881 | 3300041451 | Bacteria | 3186 |
| 416 | Ga0451791_0885769 | 3300041451 | Bacteria | 804 |
| 417 | Ga0451793_0890414 | 3300041452 | Bacteria | 1320 |
| 418 | Ga0451793_1101108 | 3300041452 | Bacteria | 915 |
| 419 | Ga0451793_1895117 | 3300041452 | Bacteria | 1979 |
| 420 | Ga0451797_0247115 | 3300041453 | Bacteria | 1866 |
| 421 | Ga0451797_0262733 | 3300041453 | Bacteria | 616 |
| 422 | Ga0451797_0426620 | 3300041453 | Bacteria | 2006 |
| 423 | Ga0451797_1530440 | 3300041453 | Bacteria | 1607 |
| 424 | Ga0451795_0392750 | 3300041456 | Bacteria | 578 |
| 425 | Ga0451798_0529292 | 3300041458 | Bacteria | 1179 |
| 426 | Ga0451800_0938602 | 3300041459 | Bacteria | 1329 |
| 427 | Ga0451802_0958836 | 3300041460 | Bacteria | 1075 |
| 428 | Ga0451802_1048206 | 3300041460 | Bacteria | 1506 |
| 429 | Ga0451802_1116100 | 3300041460 | Bacteria | 885 |
| 430 | Ga0451806_374272 | 3300041462 | Bacteria | 968 |
| 431 | Ga0451807_0122575 | 3300041486 | Bacteria | 1668 |
| 432 | Ga0451807_0838424 | 3300041486 | Bacteria | 1096 |
| 433 | Ga0451807_1303316 | 3300041486 | Bacteria | 1347 |
| 434 | Ga0451833_0129506 | 3300041491 | Bacteria | 934 |
| 435 | Ga0451833_0262464 | 3300041491 | Bacteria | 622 |
| 436 | Ga0451833_0948954 | 3300041491 | Bacteria | 957 |
| 437 | Ga0451837_0080165 | 3300041494 | Bacteria | 1241 |
| 438 | Ga0451837_0404346 | 3300041494 | Bacteria | 912 |
| 439 | Ga0451837_1000932 | 3300041494 | Bacteria | 2892 |
| 440 | Ga0451837_1144477 | 3300041494 | Bacteria | 816 |
| 441 | Ga0451837_1541278 | 3300041494 | Bacteria | 660 |
| 442 | Ga0451841_0575958 | 3300041498 | Bacteria | 700 |
| 443 | Ga0451847_0598769 | 3300041503 | Bacteria | 578 |
| 444 | Ga0451843_0033527 | 3300041509 | Bacteria | 2351 |
| 445 | Ga0451843_0818476 | 3300041509 | Bacteria | 2380 |
| 446 | Ga0451843_1251261 | 3300041509 | Bacteria | 2245 |
| 447 | Ga0451853_0966211 | 3300041512 | Bacteria | 755 |
| 448 | Ga0451853_1206899 | 3300041512 | Bacteria | 702 |
| 449 | Ga0439433_0064466 | 3300041999 | Bacteria | 877 |
| 450 | Ga0439433_0109546 | 3300041999 | Bacteria | 690 |
| 451 | Ga0439445_0001427 | 3300042004 | Bacteria | 5189 |
| 452 | Ga0439445_0042401 | 3300042004 | Bacteria | 1212 |
| 453 | Ga0439432_009347 | 3300042006 | Bacteria | 3421 |
| 454 | Ga0439432_031207 | 3300042006 | Bacteria | 1724 |
| 455 | Ga0439432_033157 | 3300042006 | Bacteria | 1663 |
| 456 | Ga0439432_169007 | 3300042006 | Bacteria | 638 |
| 457 | Ga0439449_0000397 | 3300042007 | Bacteria | 16116 |
| 458 | Ga0439449_0002795 | 3300042007 | Bacteria | 6781 |
| 459 | Ga0439449_0003184 | 3300042007 | Bacteria | 6395 |
| 460 | Ga0439449_0007071 | 3300042007 | Bacteria | 4274 |
| 461 | Ga0439449_0031507 | 3300042007 | Bacteria | 1976 |
| 462 | Ga0439449_0059119 | 3300042007 | Bacteria | 1415 |
| 463 | Ga0439449_0101197 | 3300042007 | Bacteria | 1065 |
| 464 | Ga0439449_0103698 | 3300042007 | Bacteria | 1052 |
| 465 | Ga0439449_0284787 | 3300042007 | Bacteria | 623 |
| 466 | Ga0439452_035451 | 3300042010 | Bacteria | 1201 |
| 467 | Ga0439457_064934 | 3300042014 | Bacteria | 829 |
| 468 | Ga0439462_0011239 | 3300042015 | Bacteria | 2277 |
| 469 | Ga0450911_001313 | 3300042115 | Bacteria | 5872 |
| 470 | Ga0450894_008310 | 3300042131 | Bacteria | 1342 |
| 471 | Ga0450898_051691 | 3300042134 | Bacteria | 795 |
| 472 | Ga0450898_079098 | 3300042134 | Bacteria | 667 |
| 473 | Ga0450905_001592 | 3300042142 | Bacteria | 2894 |
| 474 | Ga0450918_065583 | 3300042531 | Bacteria | 676 |
| 475 | Ga0450901_004821 | 3300042533 | Bacteria | 1389 |
| 476 | Ga0451577_0005595 | 3300042876 | Bacteria | 12786 |
| 477 | Ga0439440_0019513 | 3300042993 | Bacteria | 1513 |
| 478 | Ga0466972_0315316 | 3300044658 | Bacteria | 731 |
| 479 | Ga0453684_0333386 | 3300044712 | Bacteria | 1715 |
| 480 | Ga0466967_0369552 | 3300045976 | Bacteria | 1391 |
| 481 | Ga0495627_002530 | 3300046453 | Bacteria | 8703 |
| 482 | Ga0495627_126379 | 3300046453 | Bacteria | 720 |
| 483 | Ga0495638_0000231 | 3300046460 | Bacteria | 76477 |
| 484 | Ga0495638_0019350 | 3300046460 | Bacteria | 4504 |
| 485 | Ga0495638_0181314 | 3300046460 | Bacteria | 1201 |
| 486 | Ga0495638_0183314 | 3300046460 | Bacteria | 1193 |
| 487 | Ga0495650_0132018 | 3300046471 | Bacteria | 910 |
| 488 | Ga0495605_0011245 | 3300046474 | Bacteria | 4997 |
| 489 | Ga0495607_0093207 | 3300046501 | Bacteria | 1627 |
| 490 | Ga0495606_0041634 | 3300046507 | Bacteria | 3079 |
| 491 | Ga0495610_0000242 | 3300046512 | Bacteria | 57692 |
| 492 | Ga0495610_0022452 | 3300046512 | Bacteria | 3452 |
| 493 | Ga0495631_0001336 | 3300046518 | Bacteria | 15073 |
| 494 | Ga0495631_0234769 | 3300046518 | Bacteria | 782 |
| 495 | Ga0495632_0066337 | 3300046519 | Bacteria | 1742 |
| 496 | Ga0495643_0000701 | 3300046522 | Bacteria | 38480 |
| 497 | Ga0495663_0001362 | 3300046525 | Bacteria | 7702 |
| 498 | Ga0495663_0003977 | 3300046525 | Bacteria | 4200 |
| 499 | Ga0495663_0007413 | 3300046525 | Bacteria | 3033 |
| 500 | Ga0495663_0010786 | 3300046525 | Bacteria | 2543 |
| 501 | Ga0495663_0015525 | 3300046525 | Bacteria | 2146 |
| 502 | Ga0495663_0020927 | 3300046525 | Bacteria | 1880 |
| 503 | Ga0495663_0066880 | 3300046525 | Bacteria | 1138 |
| 504 | Ga0495663_0090240 | 3300046525 | Bacteria | 998 |
| 505 | Ga0495663_0220489 | 3300046525 | Bacteria | 666 |
| 506 | Ga0495654_0141416 | 3300046530 | Bacteria | 1072 |
| 507 | Ga0495609_0040483 | 3300046538 | Bacteria | 2097 |
| 508 | Ga0495609_0141699 | 3300046538 | Bacteria | 1026 |
| 509 | Ga0495621_0064087 | 3300046539 | Bacteria | 1340 |
| 510 | Ga0495633_0002603 | 3300046558 | Bacteria | 12621 |
| 511 | Ga0495633_0007084 | 3300046558 | Bacteria | 6521 |
| 512 | Ga0495633_0114800 | 3300046558 | Bacteria | 1248 |
| 513 | Ga0495656_0000725 | 3300046615 | Bacteria | 10653 |
| 514 | Ga0495656_0003229 | 3300046615 | Bacteria | 5498 |
| 515 | Ga0495656_0057305 | 3300046615 | Bacteria | 1686 |
| 516 | Ga0495656_0064229 | 3300046615 | Bacteria | 1611 |
| 517 | Ga0495668_0001500 | 3300046616 | Bacteria | 22305 |
| 518 | Ga0495668_0061339 | 3300046616 | Bacteria | 2074 |
| 519 | Ga0495625_0174766 | 3300046660 | Bacteria | 1431 |
| 520 | Ga0495625_0499185 | 3300046660 | Bacteria | 744 |
| 521 | Ga0495659_0018838 | 3300046664 | Bacteria | 2304 |
| 522 | Ga0495659_0024353 | 3300046664 | Bacteria | 2064 |
| 523 | Ga0495659_0182379 | 3300046664 | Bacteria | 855 |
| 524 | Ga0495670_0072717 | 3300046691 | Bacteria | 1742 |
| 525 | Ga0495670_0200281 | 3300046691 | Bacteria | 1057 |
| 526 | Ga0495670_0740530 | 3300046691 | Bacteria | 536 |
| 527 | Ga0495671_0002713 | 3300046692 | Bacteria | 11086 |
| 528 | Ga0495660_0151864 | 3300046810 | Bacteria | 1143 |
| 529 | Ga0495636_0000850 | 3300047318 | Bacteria | 11263 |
| 530 | Ga0495636_0054635 | 3300047318 | Bacteria | 1678 |
| 531 | Ga0495636_0080216 | 3300047318 | Bacteria | 1404 |
| 532 | Ga0495636_0094429 | 3300047318 | Bacteria | 1301 |
| 533 | Ga0495636_0149047 | 3300047318 | Bacteria | 1048 |
| 534 | Ga0495672_0000092 | 3300047320 | Bacteria | 146431 |
| 535 | Ga0495677_0056861 | 3300047445 | Bacteria | 1446 |
| 536 | Ga0495685_027545 | 3300047447 | Bacteria | 1955 |
| 537 | Ga0495681_0201398 | 3300047470 | Bacteria | 807 |
| 538 | Ga0495681_0364037 | 3300047470 | Bacteria | 547 |
| 539 | Ga0495686_0002273 | 3300047472 | Bacteria | 18497 |
| 540 | Ga0495686_0024577 | 3300047472 | Bacteria | 3956 |
| 541 | Ga0495686_0249485 | 3300047472 | Bacteria | 998 |
| 542 | Ga0495615_0014537 | 3300048090 | Bacteria | 1666 |
| 543 | Ga0496100_0136465 | 3300048903 | Bacteria | 1734 |
| 544 | Ga0496100_0142363 | 3300048903 | Bacteria | 1701 |
| 545 | Ga0496100_0332157 | 3300048903 | Bacteria | 1144 |
| 546 | Ga0496101_0115545 | 3300048904 | Bacteria | 2024 |
| 547 | Ga0496101_0304176 | 3300048904 | Bacteria | 1249 |
| 548 | Ga0496102_0233461 | 3300048905 | Bacteria | 1734 |
| 549 | Ga0496104_0143547 | 3300048907 | Bacteria | 2293 |
| 550 | Ga0496106_0018879 | 3300048909 | Bacteria | 5110 |
| 551 | Ga0496106_0796300 | 3300048909 | Bacteria | 750 |
| 552 | Ga0496107_0024397 | 3300048910 | Bacteria | 4278 |
| 553 | Ga0496108_0138026 | 3300048911 | Bacteria | 2099 |
| 554 | Ga0496108_0253319 | 3300048911 | Bacteria | 1532 |
| 555 | Ga0496109_0084181 | 3300048912 | Bacteria | 2933 |
| 556 | Ga0496109_0309026 | 3300048912 | Bacteria | 1491 |
| 557 | Ga0496109_0749390 | 3300048912 | Bacteria | 914 |
| 558 | Ga0496110_0194140 | 3300048913 | Bacteria | 1843 |
| 559 | Ga0496110_0265740 | 3300048913 | Bacteria | 1562 |
| 560 | Ga0496112_0858063 | 3300048915 | Bacteria | 831 |
| 561 | Ga0496113_0033885 | 3300048916 | Bacteria | 3722 |
| 562 | Ga0496113_0092392 | 3300048916 | Bacteria | 2334 |
| 563 | Ga0496114_0004682 | 3300048917 | Bacteria | 10640 |
| 564 | Ga0496116_0003037 | 3300048919 | Bacteria | 16975 |
| 565 | Ga0496116_0047167 | 3300048919 | Bacteria | 2901 |
| 566 | Ga0496117_0002348 | 3300048920 | Bacteria | 24193 |
| 567 | Ga0496117_0004119 | 3300048920 | Bacteria | 16288 |
| 568 | Ga0496117_0004182 | 3300048920 | Bacteria | 16142 |
| 569 | Ga0496117_0008480 | 3300048920 | Bacteria | 9755 |
| 570 | Ga0496117_0129021 | 3300048920 | Bacteria | 1536 |
| 571 | Ga0496117_0303502 | 3300048920 | Bacteria | 844 |
| 572 | Ga0496118_0003159 | 3300048921 | Bacteria | 21056 |
| 573 | Ga0496118_0004490 | 3300048921 | Bacteria | 16520 |
| 574 | Ga0496118_0004569 | 3300048921 | Bacteria | 16301 |
| 575 | Ga0496118_0025445 | 3300048921 | Bacteria | 5075 |
| 576 | Ga0496118_0027373 | 3300048921 | Bacteria | 4826 |
| 577 | Ga0496118_0031274 | 3300048921 | Bacteria | 4417 |
| 578 | Ga0496118_0032518 | 3300048921 | Bacteria | 4295 |
| 579 | Ga0496118_0093093 | 3300048921 | Bacteria | 2066 |
| 580 | Ga0496118_0136849 | 3300048921 | Bacteria | 1561 |
| 581 | Ga0496119_0000176 | 3300048922 | Bacteria | 89501 |
| 582 | Ga0496119_0001471 | 3300048922 | Bacteria | 28191 |
| 583 | Ga0496119_0066333 | 3300048922 | Bacteria | 2133 |
| 584 | Ga0496120_0000277 | 3300048923 | Bacteria | 85951 |
| 585 | Ga0496120_0003247 | 3300048923 | Bacteria | 15046 |
| 586 | Ga0496121_0008895 | 3300048924 | Bacteria | 11667 |
| 587 | Ga0496121_0010562 | 3300048924 | Bacteria | 10384 |
| 588 | Ga0496121_0046062 | 3300048924 | Bacteria | 3737 |
| 589 | Ga0496121_0060547 | 3300048924 | Bacteria | 3113 |
| 590 | Ga0496122_0000144 | 3300048925 | Bacteria | 166503 |
| 591 | Ga0496122_0003749 | 3300048925 | Bacteria | 19606 |
| 592 | Ga0496122_0008640 | 3300048925 | Bacteria | 10930 |
| 593 | Ga0496122_0009056 | 3300048925 | Bacteria | 10565 |
| 594 | Ga0496122_0014795 | 3300048925 | Bacteria | 7517 |
| 595 | Ga0496122_0020337 | 3300048925 | Bacteria | 6003 |
| 596 | Ga0496122_0073409 | 3300048925 | Bacteria | 2425 |
| 597 | Ga0496122_0076587 | 3300048925 | Bacteria | 2353 |
| 598 | Ga0496122_0241953 | 3300048925 | Bacteria | 1016 |
| 599 | Ga0496123_0000665 | 3300048926 | Bacteria | 56849 |
| 600 | Ga0496123_0001387 | 3300048926 | Bacteria | 33973 |
| 601 | Ga0496123_0010195 | 3300048926 | Bacteria | 8339 |
| 602 | Ga0496123_0023413 | 3300048926 | Bacteria | 4727 |
| 603 | Ga0496123_0046011 | 3300048926 | Bacteria | 2964 |
| 604 | Ga0496123_0060932 | 3300048926 | Bacteria | 2429 |
| 605 | Ga0496123_0195517 | 3300048926 | Bacteria | 1042 |
| 606 | Ga0496124_0000020 | 3300048927 | Bacteria | 434107 |
| 607 | Ga0496124_0001413 | 3300048927 | Bacteria | 35745 |
| 608 | Ga0496124_0001960 | 3300048927 | Bacteria | 28118 |
| 609 | Ga0496124_0005910 | 3300048927 | Bacteria | 13543 |
| 610 | Ga0496124_0015555 | 3300048927 | Bacteria | 7285 |
| 611 | Ga0496124_0020487 | 3300048927 | Bacteria | 6108 |
| 612 | Ga0496124_0021623 | 3300048927 | Bacteria | 5925 |
| 613 | Ga0496124_0116272 | 3300048927 | Bacteria | 2144 |
| 614 | Ga0496124_0188697 | 3300048927 | Bacteria | 1579 |
| 615 | Ga0496124_0228072 | 3300048927 | Bacteria | 1395 |
| 616 | Ga0496124_0371223 | 3300048927 | Bacteria | 1004 |
| 617 | Ga0496125_0001174 | 3300048928 | Bacteria | 39666 |
| 618 | Ga0496125_0006187 | 3300048928 | Bacteria | 13037 |
| 619 | Ga0496125_0012715 | 3300048928 | Bacteria | 8328 |
| 620 | Ga0496125_0030967 | 3300048928 | Bacteria | 4777 |
| 621 | Ga0496125_0079723 | 3300048928 | Bacteria | 2510 |
| 622 | Ga0496125_0105459 | 3300048928 | Bacteria | 2060 |
| 623 | Ga0496125_0299195 | 3300048928 | Bacteria | 986 |
| 624 | Ga0496125_0437111 | 3300048928 | Bacteria | 753 |
| 625 | Ga0496126_0008940 | 3300048929 | Bacteria | 10727 |
| 626 | Ga0496126_0048096 | 3300048929 | Bacteria | 3901 |
| 627 | Ga0496126_0059449 | 3300048929 | Bacteria | 3442 |
| 628 | Ga0496126_0145910 | 3300048929 | Bacteria | 2032 |
| 629 | Ga0496126_0229726 | 3300048929 | Bacteria | 1555 |
| 630 | Ga0496126_0231035 | 3300048929 | Bacteria | 1550 |
| 631 | Ga0496126_0817728 | 3300048929 | Bacteria | 713 |
| 632 | Ga0496126_0817785 | 3300048929 | Bacteria | 713 |
| 633 | Ga0501290_004964 | 3300049513 | Bacteria | 1661 |
| 634 | Ga0501300_005594 | 3300049523 | Bacteria | 1850 |
| 635 | Ga0501031_0007657 | 3300049568 | Bacteria | 7028 |
| 636 | Ga0501031_0074716 | 3300049568 | Bacteria | 2207 |
| 637 | Ga0501031_0232126 | 3300049568 | Bacteria | 1200 |
| 638 | Ga0501032_0019427 | 3300049569 | Bacteria | 4754 |
| 639 | Ga0501032_0134917 | 3300049569 | Bacteria | 1627 |
| 640 | Ga0501033_0001420 | 3300049570 | Bacteria | 21266 |
| 641 | Ga0501033_0029300 | 3300049570 | Bacteria | 4137 |
| 642 | Ga0501033_0154439 | 3300049570 | Bacteria | 1654 |
| 643 | Ga0501033_0302562 | 3300049570 | Bacteria | 1125 |
| 644 | Ga0501034_0000367 | 3300049571 | Bacteria | 76895 |
| 645 | Ga0501034_0000798 | 3300049571 | Bacteria | 46906 |
| 646 | Ga0501034_0002483 | 3300049571 | Bacteria | 22159 |
| 647 | Ga0501034_0014196 | 3300049571 | Bacteria | 8210 |
| 648 | Ga0501034_0034412 | 3300049571 | Bacteria | 5135 |
| 649 | Ga0501034_0485734 | 3300049571 | Bacteria | 1150 |
| 650 | Ga0501034_0586523 | 3300049571 | Bacteria | 1021 |
| 651 | Ga0501034_0616366 | 3300049571 | Bacteria | 989 |
| 652 | Ga0501036_0003765 | 3300049572 | Bacteria | 12156 |
| 653 | Ga0501036_0378351 | 3300049572 | Bacteria | 1182 |
| 654 | Ga0501036_0561336 | 3300049572 | Bacteria | 948 |
| 655 | Ga0501037_0003115 | 3300049573 | Bacteria | 12021 |
| 656 | Ga0501037_0118874 | 3300049573 | Bacteria | 1901 |
| 657 | Ga0501037_0180287 | 3300049573 | Bacteria | 1499 |
| 658 | Ga0501037_0193849 | 3300049573 | Bacteria | 1438 |
| 659 | Ga0501038_0000610 | 3300049574 | Bacteria | 31817 |
| 660 | Ga0501038_0022312 | 3300049574 | Bacteria | 5675 |
| 661 | Ga0501039_0015127 | 3300049575 | Bacteria | 5903 |
| 662 | Ga0501039_0327895 | 3300049575 | Bacteria | 1203 |
| 663 | Ga0501043_0003950 | 3300049579 | Bacteria | 12160 |
| 664 | Ga0501043_0005273 | 3300049579 | Bacteria | 10448 |
| 665 | Ga0501046_0596660 | 3300049580 | Bacteria | 784 |
| 666 | Ga0501047_0032812 | 3300049581 | Bacteria | 5013 |
| 667 | Ga0501047_0070906 | 3300049581 | Bacteria | 3354 |
| 668 | Ga0501047_0503870 | 3300049581 | Bacteria | 1037 |
| 669 | Ga0501067_0492754 | 3300049583 | Bacteria | 685 |
| 670 | Ga0501069_0048200 | 3300049585 | Bacteria | 2365 |
| 671 | Ga0501069_0067919 | 3300049585 | Bacteria | 1994 |
| 672 | Ga0501069_0478980 | 3300049585 | Bacteria | 741 |
| 673 | Ga0501070_0015328 | 3300049586 | Bacteria | 6449 |
| 674 | Ga0501070_0018010 | 3300049586 | Bacteria | 5926 |
| 675 | Ga0501070_0051642 | 3300049586 | Bacteria | 3413 |
| 676 | Ga0501070_0171477 | 3300049586 | Bacteria | 1787 |
| 677 | Ga0501071_0015686 | 3300049587 | Bacteria | 5203 |
| 678 | Ga0501073_0008696 | 3300049589 | Bacteria | 7518 |
| 679 | Ga0501073_0139904 | 3300049589 | Bacteria | 1677 |
| 680 | Ga0501074_0009659 | 3300049590 | Bacteria | 7002 |
| 681 | Ga0501074_0032514 | 3300049590 | Bacteria | 3779 |
| 682 | Ga0501202_027857 | 3300049652 | Bacteria | 1163 |
| 683 | Ga0501202_063332 | 3300049652 | Bacteria | 840 |
| 684 | Ga0501238_032312 | 3300049671 | Bacteria | 759 |
| 685 | Ga0501240_068913 | 3300049673 | Bacteria | 637 |
| 686 | Ga0501257_083595 | 3300049686 | Bacteria | 825 |
| 687 | Ga0501258_054904 | 3300049687 | Bacteria | 564 |
| 688 | Ga0501225_0008942 | 3300049705 | Bacteria | 2866 |
| 689 | Ga0501079_0118427 | 3300049741 | Bacteria | 2059 |
| 690 | Ga0501079_0148072 | 3300049741 | Bacteria | 1830 |
| 691 | Ga0501080_0005331 | 3300049742 | Bacteria | 11457 |
| 692 | Ga0501080_0005548 | 3300049742 | Bacteria | 11267 |
| 693 | Ga0501080_0024487 | 3300049742 | Bacteria | 5594 |
| 694 | Ga0501263_018100 | 3300049760 | Bacteria | 930 |
| 695 | Ga0501266_014097 | 3300049763 | Bacteria | 1045 |
| 696 | Ga0501270_014135 | 3300049767 | Bacteria | 1118 |
| 697 | Ga0501270_030383 | 3300049767 | Bacteria | 888 |
| 698 | Ga0501274_032573 | 3300049771 | Bacteria | 595 |
| 699 | Ga0501275_000092 | 3300049772 | Bacteria | 9192 |
| 700 | Ga0501279_040058 | 3300049775 | Bacteria | 717 |
| 701 | Ga0501280_055492 | 3300049776 | Bacteria | 677 |
| 702 | Ga0501035_0000992 | 3300049822 | Bacteria | 29984 |
| 703 | Ga0501035_0002406 | 3300049822 | Bacteria | 18342 |
| 704 | Ga0501035_0064630 | 3300049822 | Bacteria | 3251 |
| 705 | Ga0501035_0356685 | 3300049822 | Bacteria | 1222 |
| 706 | Ga0501044_0002382 | 3300049823 | Bacteria | 21418 |
| 707 | Ga0501044_0003326 | 3300049823 | Bacteria | 18120 |
| 708 | Ga0501044_0101121 | 3300049823 | Bacteria | 2900 |
| 709 | Ga0501044_0191042 | 3300049823 | Bacteria | 2010 |
| 710 | Ga0501044_1547779 | 3300049823 | Bacteria | 528 |
| 711 | nmdc:mga03683_194673_c1 | 3300050489 | Bacteria | 928 |
| 712 | nmdc:mga00v17_680_c1 | 3300050491 | Bacteria | 18694 |
| 713 | Ga0500577_0041736 | 3300053142 | Bacteria | 1675 |
| 714 | Ga0500634_0000117 | 3300053161 | Bacteria | 29635 |
| 715 | Ga0500609_018035 | 3300053731 | Bacteria | 960 |
| 716 | 2572255764 | 2571042365 | Bacteria | 3289345 |
| 717 | 2574429127 | 2574179768 | Bacteria | 4907129 |
| 718 | 2578459988 | 2576861471 | Bacteria | 4648976 |
| 719 | 2643817083 | 2643221559 | Bacteria | 4424915 |
| 720 | 2643879649 | 2643221573 | Bacteria | 4784121 |
| 721 | 2643906531 | 2643221579 | Bacteria | 4443405 |
| 722 | 2643913961 | 2643221581 | Bacteria | 3893603 |
| 723 | 2643939599 | 2643221586 | Bacteria | 4446529 |
| 724 | 2643976527 | 2643221593 | Bacteria | 6296053 |
| 725 | 2644080469 | 2643221612 | Bacteria | 4361984 |
| 726 | 2644530869 | 2643221695 | Bacteria | 3441323 |
| 727 | 2644663311 | 2643221720 | Bacteria | 4694283 |
| 728 | 2644696577 | 2643221727 | Bacteria | 4415595 |
| 729 | 2644701190 | 2643221728 | Bacteria | 4797149 |
| 730 | 2747950168 | 2747842428 | Bacteria | 4689383 |
| 731 | 2748019908 | 2747842501 | Bacteria | 5293829 |
| 732 | 2765577276 | 2765235840 | Bacteria | 4663337 |
| 733 | 2816519917 | 2816332141 | Bacteria | 4436036 |
| 734 | 2819663216 | 2818991457 | Bacteria | 5323295 |
| 735 | 2842394658 | 2842391507 | Bacteria | 4486072 |
| 736 | 2842760819 | 2842757796 | Bacteria | 3981385 |
| 737 | 2842784493 | 2842780639 | Bacteria | 4337790 |
| 738 | 2848699904 | 2848694841 | Bacteria | 9205737 |
| 739 | 2852652559 | 2852649853 | Bacteria | 4036942 |
| 740 | 2852689210 | 2852684882 | Bacteria | 5463342 |
| 741 | 2857445574 | 2857442823 | Bacteria | 4562550 |
| 742 | 2874223810 | 2874220319 | Bacteria | 4594709 |
| 743 | 2894417591 | 2894414249 | Bacteria | 4405451 |
| 744 | 2895502940 | 2895498888 | Bacteria | 5283788 |
| 745 | 2895512979 | 2895511927 | Bacteria | 6802080 |
| 746 | 2895522991 | 2895522137 | Bacteria | 3284416 |
| 747 | 2895526886 | 2895525241 | Bacteria | 3388457 |
| 748 | 2919090268 | 2919089067 | Bacteria | 4560942 |
| 749 | 2919133045 | 2919130084 | Bacteria | 5301837 |
| 750 | 2919138422 | 2919134579 | Bacteria | 4480386 |
| 751 | 2919513869 | 2919513703 | Bacteria | 3844312 |
| 752 | 2919678696 | 2919675420 | Bacteria | 3969095 |
| 753 | 2923516428 | 2923516293 | Bacteria | 3716336 |
| 754 | 2928498219 | 2928496128 | Bacteria | 4631123 |
| 755 | 2929195905 | 2929195423 | Bacteria | 5325372 |
| 756 | 2931382436 | 2931380184 | Bacteria | 4455911 |
| 757 | 2937613718 | 2937610967 | Bacteria | 4618818 |
| 758 | 2939593066 | 2939589442 | Bacteria | 4214238 |
| 759 | 2939626215 | 2939622612 | Bacteria | 4698046 |
| 760 | 2939627834 | 2939626828 | Bacteria | 4695272 |
| 761 | 2941479648 | 2941475908 | Bacteria | 4145589 |
| 762 | 2941493950 | 2941489479 | Bacteria | 6313767 |
| 763 | 2961050574 | 2961047084 | Bacteria | 4594415 |
| 764 | 2961065751 | 2961064222 | Bacteria | 4749990 |
| 765 | 2974310418 | 2974307012 | Bacteria | 4172388 |
| 766 | 2977251150 | 2977247770 | Bacteria | 4160543 |
| 767 | 2987605785 | 2987605356 | Bacteria | 4187822 |
| 768 | 2995953818 | 2995948881 | Bacteria | 6358104 |
| 769 | 8002870874 | 8002869464 | Bacteria | 3588529 |
| 770 | 8003017378 | 8003014200 | Bacteria | 4059994 |
| 771 | 8021623163 | 8021622325 | Bacteria | 4844743 |
| 772 | 8021629731 | 8021626552 | Bacteria | 4665214 |
| 773 | 8021648984 | 8021648035 | Bacteria | 4772378 |
| 774 | Ga0182008_10073786 | |||
| 775 | SwRhRL2b_contig_1735385 | |||
| 776 | SwRhRL2b_contig_3057749 | |||
| 777 | JGI24736J21556_1006444 | |||
| 778 | JGI24741J21665_1000902 | |||
| 779 | JGI24740J21852_10013378 | |||
| 780 | JGI25152J39213_1000076 | |||
| 781 | JGI25150J39212_1000530 | |||
| 782 | JGI25151J46595_10000231 | |||
| 783 | JGI25151J46595_10013068 | |||
| 784 | JGI25153J46596_10000166 | |||
| 785 | rootH2_10011547 | |||
| 786 | Ga0055526_1000107 | |||
| 787 | Ga0055526_1006559 | |||
| 788 | Ga0055526_1006992 | |||
| 789 | Ga0055537_1000147 | |||
| 790 | Ga0055537_1000299 | |||
| 791 | Ga0055524_1000176 | |||
| 792 | Ga0055524_1015049 | |||
| 793 | Ga0055536_1001750 | |||
| 794 | Ga0055536_1002416 | |||
| 795 | Ga0055536_1004645 | |||
| 796 | Ga0055536_1012468 | |||
| 797 | Ga0055536_1022961 | |||
| 798 | Ga0055534_1000090 | |||
| 799 | Ga0055534_1000322 | |||
| 800 | Ga0055534_1000837 | |||
| 801 | Ga0055528_1000088 | |||
| 802 | Ga0055528_1000194 | |||
| 803 | Ga0055530_10001839 | |||
| 804 | Ga0055530_10002248 | |||
| 805 | Ga0055530_10002449 | |||
| 806 | Ga0055540_1016642 | |||
| 807 | Ga0055531_10003516 | |||
| 808 | Ga0055531_10008428 | |||
| 809 | Ga0058692_1000005 | |||
| 810 | Ga0058692_1000021 | |||
| 811 | Ga0065714_10108158 | |||
| 812 | Ga0065704_10071322 | |||
| 813 | Ga0065704_10187846 | |||
| 814 | Ga0065715_10031725 | |||
| 815 | Ga0065715_10111242 | |||
| 816 | Ga0065715_10218496 | |||
| 817 | Ga0065715_10260000 | |||
| 818 | Ga0065715_10392576 | |||
| 819 | Ga0070658_10065811 | |||
| 820 | Ga0070683_100765709 | |||
| 821 | Ga0070683_100833271 | |||
| 822 | Ga0070670_100032140 | |||
| 823 | Ga0070670_100579330 | |||
| 824 | Ga0070670_100835604 | |||
| 825 | Ga0070677_10229757 | |||
| 826 | Ga0070677_10729348 | |||
| 827 | Ga0070666_10800520 | |||
| 828 | Ga0070680_100844357 | |||
| 829 | Ga0070680_100965773 | |||
| 830 | Ga0070682_100091334 | |||
| 831 | Ga0070660_100017200 | |||
| 832 | Ga0070660_100213612 | |||
| 833 | Ga0070689_101464279 | |||
| 834 | Ga0070661_100192569 | |||
| 835 | Ga0070661_100830832 | |||
| 836 | Ga0070668_100017205 | |||
| 837 | Ga0070668_100082220 | |||
| 838 | Ga0070668_100559441 | |||
| 839 | Ga0070669_100374018 | |||
| 840 | Ga0070675_100222296 | |||
| 841 | Ga0070671_100061411 | |||
| 842 | Ga0070671_100116693 | |||
| 843 | Ga0070671_100753266 | |||
| 844 | Ga0070674_100245789 | |||
| 845 | Ga0070674_100987612 | |||
| 846 | Ga0070673_100102802 | |||
| 847 | Ga0070659_100081947 | |||
| 848 | Ga0070659_100740290 | |||
| 849 | Ga0070667_100314501 | |||
| 850 | Ga0070667_101376530 | |||
| 851 | Ga0070701_10378711 | |||
| 852 | Ga0070663_100113960 | |||
| 853 | Ga0070663_100673681 | |||
| 854 | Ga0070678_100040771 | |||
| 855 | Ga0070681_10398300 | |||
| 856 | Ga0070681_10886440 | |||
| 857 | Ga0068867_100051053 | |||
| 858 | Ga0070679_100193708 | |||
| 859 | Ga0068853_100395029 | |||
| 860 | Ga0070672_100171919 | |||
| 861 | Ga0070696_100093329 | |||
| 862 | Ga0070693_100001019 | |||
| 863 | Ga0070665_100238917 | |||
| 864 | Ga0068855_101532279 | |||
| 865 | Ga0070664_100007922 | |||
| 866 | Ga0070664_100065343 | |||
| 867 | Ga0068857_101036706 | |||
| 868 | Ga0068854_100823886 | |||
| 869 | Ga0068852_100012784 | |||
| 870 | Ga0068852_101215047 | |||
| 871 | Ga0068859_100618195 | |||
| 872 | Ga0068861_100237731 | |||
| 873 | Ga0068861_100289575 | |||
| 874 | Ga0068851_10134654 | |||
| 875 | Ga0068870_10944277 | |||
| 876 | Ga0068863_101294799 | |||
| 877 | Ga0068862_101251349 | |||
| 878 | Ga0081539_10016629 | |||
| 879 | Ga0075364_10173314 | |||
| 880 | Ga0075364_10300602 | |||
| 881 | Ga0075362_10222707 | |||
| 882 | Ga0097620_100618191 | |||
| 883 | Ga0079104_1111531 | |||
| 884 | Ga0105251_10000014 | |||
| 885 | Ga0105251_10002449 | |||
| 886 | Ga0105244_10065862 | |||
| 887 | Ga0105240_10072642 | |||
| 888 | Ga0105240_10208081 | |||
| 889 | Ga0105243_10003907 | |||
| 890 | Ga0105243_10022428 | |||
| 891 | Ga0105243_10037668 | |||
| 892 | Ga0105242_10108908 | |||
| 893 | Ga0105248_10407810 | |||
| 894 | Ga0105248_10919564 | |||
| 895 | Ga0105248_13353722 | |||
| 896 | Ga0105032_102531 | |||
| 897 | Ga0105246_10280278 | |||
| 898 | Ga0157318_1000725 | |||
| 899 | Ga0157322_1011021 | |||
| 900 | Ga0157316_1000454 | |||
| 901 | Ga0157327_1000792 | |||
| 902 | Ga0157327_1019029 | |||
| 903 | Ga0154019_129338 | |||
| 904 | Ga0157373_10022336 | |||
| 905 | Ga0157373_10268713 | |||
| 906 | Ga0157373_10800651 | |||
| 907 | Ga0157371_10003036 | |||
| 908 | Ga0157371_10018618 | |||
| 909 | Ga0157371_10117669 | |||
| 910 | Ga0157371_11033775 | |||
| 911 | Ga0157371_11034349 | |||
| 912 | Ga0157370_10090271 | |||
| 913 | Ga0157370_10110821 | |||
| 914 | Ga0157370_10147983 | |||
| 915 | Ga0157369_10165624 | |||
| 916 | Ga0157369_10314518 | |||
| 917 | Ga0163162_10875449 | |||
| 918 | Ga0163162_10930318 | |||
| 919 | Ga0157372_10074997 | |||
| 920 | Ga0157372_10351287 | |||
| 921 | Ga0157375_10619585 | |||
| 922 | Ga0157380_10355758 | |||
| 923 | Ga0157380_10397465 | |||
| 924 | Ga0157380_10418061 | |||
| 925 | Ga0182008_10004347 | |||
| 926 | Ga0182008_10116459 | |||
| 927 | Ga0182008_10204165 | |||
| 928 | Ga0182006_1023345 | |||
| 929 | Ga0182006_1029292 | |||
| 930 | Ga0182006_1035632 | |||
| 931 | Ga0182006_1046573 | |||
| 932 | Ga0182006_1057926 | |||
| 933 | Ga0182007_10000500 | |||
| 934 | Ga0182005_1000186 | |||
| 935 | Ga0182005_1028194 | |||
| 936 | Ga0183360_10004 | |||
| 937 | Ga0183361_10143 | |||
| 938 | Ga0163161_10309616 | |||
| 939 | Ga0163161_10380784 | |||
| 940 | Ga0163161_10602251 | |||
| 941 | Ga0206356_11710452 | |||
| 942 | Ga0206351_10226310 | |||
| 943 | Ga0206350_11473204 | |||
| 944 | Ga0206354_10337747 | |||
| 945 | Ga0206353_10206423 | |||
| 946 | Ga0206353_10721119 | |||
| 947 | Ga0206353_10726987 | |||
| 948 | Ga0154015_1073503 | |||
| 949 | Ga0207425_1000029 | |||
| 950 | Ga0209129_1000216 | |||
| 951 | Ga0209565_1000002 | |||
| 952 | Ga0209565_1000071 | |||
| 953 | Ga0209565_1006967 | |||
| 954 | Ga0209673_1000002 | |||
| 955 | Ga0209673_1001159 | |||
| 956 | Ga0209673_1005118 | |||
| 957 | Ga0209130_1023919 | |||
| 958 | Ga0209130_1024273 | |||
| 959 | Ga0209675_1000002 | |||
| 960 | Ga0209675_1000018 | |||
| 961 | Ga0209675_1003998 | |||
| 962 | Ga0209675_1004010 | |||
| 963 | Ga0209676_1000035 | |||
| 964 | Ga0209676_1000185 | |||
| 965 | Ga0209676_1000248 | |||
| 966 | Ga0209676_1001632 | |||
| 967 | Ga0209676_1002505 | |||
| 968 | Ga0209676_1003269 | |||
| 969 | Ga0209676_1004137 | |||
| 970 | Ga0209676_1004879 | |||
| 971 | Ga0209676_1015746 | |||
| 972 | Ga0209025_1000076 | |||
| 973 | Ga0209025_1002264 | |||
| 974 | Ga0209025_1003682 | |||
| 975 | Ga0209025_1046408 | |||
| 976 | Ga0209564_1000004 | |||
| 977 | Ga0209564_1000148 | |||
| 978 | Ga0209564_1016519 | |||
| 979 | Ga0209758_1000473 | |||
| 980 | Ga0209758_1029718 | |||
| 981 | Ga0209050_1000182 | |||
| 982 | Ga0209050_1000865 | |||
| 983 | Ga0209050_1000896 | |||
| 984 | Ga0209050_1006684 | |||
| 985 | Ga0209050_1021068 | |||
| 986 | Ga0209256_1000004 | |||
| 987 | Ga0209256_1002608 | |||
| 988 | Ga0209256_1004525 | |||
| 989 | Ga0209256_1004737 | |||
| 990 | Ga0209256_1008272 | |||
| 991 | Ga0209256_1020379 | |||
| 992 | Ga0207426_1063551 | |||
| 993 | Ga0209051_1001212 | |||
| 994 | Ga0209051_1023573 | |||
| 995 | Ga0209257_1000154 | |||
| 996 | Ga0209257_1000348 | |||
| 997 | Ga0209257_1000470 | |||
| 998 | Ga0209257_1000611 | |||
| 999 | Ga0209257_1001025 | |||
| 1000 | Ga0209257_1002151 | |||
| 1001 | Ga0209257_1002742 | |||
| 1002 | Ga0209257_1002838 | |||
| 1003 | Ga0209257_1003916 | |||
| 1004 | Ga0209257_1021017 | |||
| 1005 | Ga0207656_10048365 | |||
| 1006 | Ga0207655_1088582 | |||
| 1007 | Ga0207713_1000290 | |||
| 1008 | Ga0207713_1007313 | |||
| 1009 | Ga0207682_10105183 | |||
| 1010 | Ga0207682_10122292 | |||
| 1011 | Ga0207647_10000890 | |||
| 1012 | Ga0207643_10185001 | |||
| 1013 | Ga0207705_10002475 | |||
| 1014 | Ga0207705_10010051 | |||
| 1015 | Ga0207705_10161744 | |||
| 1016 | Ga0207707_10001264 | |||
| 1017 | Ga0207707_10003347 | |||
| 1018 | Ga0207707_10453110 | |||
| 1019 | Ga0207695_10006903 | |||
| 1020 | Ga0207695_10011668 | |||
| 1021 | Ga0207660_10009796 | |||
| 1022 | Ga0207660_10010767 | |||
| 1023 | Ga0207660_10562083 | |||
| 1024 | Ga0207662_10290782 | |||
| 1025 | Ga0207657_10051651 | |||
| 1026 | Ga0207657_10699508 | |||
| 1027 | Ga0207649_10003122 | |||
| 1028 | Ga0207652_10001254 | |||
| 1029 | Ga0207652_10003823 | |||
| 1030 | Ga0207681_10028705 | |||
| 1031 | Ga0207681_10144850 | |||
| 1032 | Ga0207650_10325159 | |||
| 1033 | Ga0207659_10122478 | |||
| 1034 | Ga0207644_10036484 | |||
| 1035 | Ga0207644_10042516 | |||
| 1036 | Ga0207644_10218122 | |||
| 1037 | Ga0207644_10323305 | |||
| 1038 | Ga0207690_10036274 | |||
| 1039 | Ga0207709_10001022 | |||
| 1040 | Ga0207709_10002288 | |||
| 1041 | Ga0207709_10161677 | |||
| 1042 | Ga0207669_10245256 | |||
| 1043 | Ga0207669_10611396 | |||
| 1044 | Ga0207691_10007261 | |||
| 1045 | Ga0207691_10128498 | |||
| 1046 | Ga0207711_11017361 | |||
| 1047 | Ga0207711_11269628 | |||
| 1048 | Ga0207661_10011573 | |||
| 1049 | Ga0207679_10034352 | |||
| 1050 | Ga0207679_10367417 | |||
| 1051 | Ga0207679_10974384 | |||
| 1052 | Ga0207679_11410404 | |||
| 1053 | Ga0207667_10036564 | |||
| 1054 | Ga0207667_10435844 | |||
| 1055 | Ga0207651_10150870 | |||
| 1056 | Ga0207651_11039770 | |||
| 1057 | Ga0207668_10002517 | |||
| 1058 | Ga0207668_10589693 | |||
| 1059 | Ga0207640_10476289 | |||
| 1060 | Ga0207658_10159626 | |||
| 1061 | Ga0207639_10001300 | |||
| 1062 | Ga0207678_10778947 | |||
| 1063 | Ga0207702_10004226 | |||
| 1064 | Ga0207648_10048102 | |||
| 1065 | Ga0207676_11025218 | |||
| 1066 | Ga0207674_10933704 | |||
| 1067 | Ga0207675_100178501 | |||
| 1068 | Ga0207675_100193144 | |||
| 1069 | Ga0207675_100269526 | |||
| 1070 | Ga0207683_10053759 | |||
| 1071 | Ga0207683_10183061 | |||
| 1072 | Ga0207698_10000835 | |||
| 1073 | Ga0207698_10328092 | |||
| 1074 | Ga0209371_1000031 | |||
| 1075 | Ga0209371_1000045 | |||
| 1076 | Ga0209999_1031017 | |||
| 1077 | Ga0209982_1002311 | |||
| 1078 | Ga0210002_1027152 | |||
| 1079 | Ga0209983_1001352 | |||
| 1080 | Ga0209971_1000880 | |||
| 1081 | Ga0209974_10117793 | |||
| 1082 | Ga0209974_10278191 | |||
| 1083 | Ga0268266_10015106 | |||
| 1084 | Ga0268266_10065663 | |||
| 1085 | Ga0268266_10153289 | |||
| 1086 | Ga0268265_11349322 | |||
| 1087 | Ga0307515_10306778 | |||
| 1088 | Ga0268256_1000034 | |||
| 1089 | Ga0268256_1000047 | |||
| 1090 | Ga0316177_1065610 | |||
| 1091 | Ga0316176_1173906 | |||
| 1092 | Ga0314311_1089126 | |||
| 1093 | Ga0316181_1125246 | |||
| 1094 | Ga0316182_1011388 | |||
| 1095 | Ga0307513_10008176 | |||
| 1096 | Ga0307513_10114462 | |||
| 1097 | Ga0307513_10233009 | |||
| 1098 | Ga0307509_10000566 | |||
| 1099 | Ga0307408_100025339 | |||
| 1100 | Ga0307408_100129644 | |||
| 1101 | Ga0307408_100577117 | |||
| 1102 | Ga0307408_100794203 | |||
| 1103 | Ga0307408_101096401 | |||
| 1104 | Ga0307405_10109363 | |||
| 1105 | Ga0307405_10357418 | |||
| 1106 | Ga0307405_10554793 | |||
| 1107 | Ga0307413_10012467 | |||
| 1108 | Ga0307413_10173591 | |||
| 1109 | Ga0307413_10233368 | |||
| 1110 | Ga0307413_10496821 | |||
| 1111 | Ga0307413_10673485 | |||
| 1112 | Ga0307413_10679676 | |||
| 1113 | Ga0307410_10056716 | |||
| 1114 | Ga0307410_10576654 | |||
| 1115 | Ga0307410_10867676 | |||
| 1116 | Ga0307410_10916808 | |||
| 1117 | Ga0307406_10016668 | |||
| 1118 | Ga0307406_10017565 | |||
| 1119 | Ga0307406_10088204 | |||
| 1120 | Ga0307407_10278344 | |||
| 1121 | Ga0307407_10641623 | |||
| 1122 | Ga0307412_10001099 | |||
| 1123 | Ga0307412_10213123 | |||
| 1124 | Ga0307412_10978919 | |||
| 1125 | Ga0307412_11944044 | |||
| 1126 | Ga0307409_100273287 | |||
| 1127 | Ga0307416_100519871 | |||
| 1128 | Ga0307416_100586486 | |||
| 1129 | Ga0307414_10004133 | |||
| 1130 | Ga0307414_10007643 | |||
| 1131 | Ga0307414_10018313 | |||
| 1132 | Ga0307414_10061238 | |||
| 1133 | Ga0307414_10064446 | |||
| 1134 | Ga0307414_10099940 | |||
| 1135 | Ga0307414_10101031 | |||
| 1136 | Ga0307414_10143525 | |||
| 1137 | Ga0307414_10167432 | |||
| 1138 | Ga0307414_10169330 | |||
| 1139 | Ga0307414_10208240 | |||
| 1140 | Ga0307414_10247937 | |||
| 1141 | Ga0307414_10277569 | |||
| 1142 | Ga0307414_10284792 | |||
| 1143 | Ga0307414_10306313 | |||
| 1144 | Ga0307414_10385489 | |||
| 1145 | Ga0307414_10425236 | |||
| 1146 | Ga0307414_11415311 | |||
| 1147 | Ga0307411_10103182 | |||
| 1148 | Ga0307411_10139037 | |||
| 1149 | Ga0307411_10142218 | |||
| 1150 | Ga0307411_10221821 | |||
| 1151 | Ga0307411_10234605 | |||
| 1152 | Ga0307411_10498920 | |||
| 1153 | Ga0307411_11402249 | |||
| 1154 | Ga0307411_12043738 | |||
| 1155 | Ga0307415_100455479 | |||
| 1156 | Ga0307415_100580651 | |||
| 1157 | Ga0307415_101277245 | |||
| 1158 | Ga0307415_101745220 | |||
| 1159 | Ga0316584_0202741 | |||
| 1160 | Ga0395899_0034263 | |||
| 1161 | Ga0395899_0338679 | |||
| 1162 | Ga0395900_0158839 | |||
| 1163 | Ga0395898_0177422 | |||
| 1164 | Ga0395905_0002323 | |||
| 1165 | Ga0395905_0126074 | |||
| 1166 | Ga0395905_0130312 | |||
| 1167 | Ga0395905_0256919 | |||
| 1168 | Ga0395905_0709179 | |||
| 1169 | Ga0395901_0142130 | |||
| 1170 | Ga0237819_01020 | |||
| 1171 | Ga0439436_0005257 | |||
| 1172 | Ga0439436_0006797 | |||
| 1173 | Ga0439436_0014468 | |||
| 1174 | Ga0439436_0027328 | |||
| 1175 | Ga0439436_0028860 | |||
| 1176 | Ga0439436_0036701 | |||
| 1177 | Ga0439439_0001752 | |||
| 1178 | Ga0439439_0114542 | |||
| 1179 | Ga0439447_002949 | |||
| 1180 | Ga0439461_0003662 | |||
| 1181 | Ga0439466_0086037 | |||
| 1182 | Ga0439465_0003842 | |||
| 1183 | Ga0439465_0004300 | |||
| 1184 | Ga0439465_0088744 | |||
| 1185 | Ga0451789_0367235 | |||
| 1186 | Ga0451789_0389000 | |||
| 1187 | Ga0451791_0110578 | |||
| 1188 | Ga0451791_0632881 | |||
| 1189 | Ga0451791_0885769 | |||
| 1190 | Ga0451793_0890414 | |||
| 1191 | Ga0451793_1101108 | |||
| 1192 | Ga0451793_1895117 | |||
| 1193 | Ga0451797_0247115 | |||
| 1194 | Ga0451797_0262733 | |||
| 1195 | Ga0451797_0426620 | |||
| 1196 | Ga0451797_1530440 | |||
| 1197 | Ga0451795_0392750 | |||
| 1198 | Ga0451798_0529292 | |||
| 1199 | Ga0451800_0938602 | |||
| 1200 | Ga0451802_0958836 | |||
| 1201 | Ga0451802_1048206 | |||
| 1202 | Ga0451802_1116100 | |||
| 1203 | Ga0451806_374272 | |||
| 1204 | Ga0451807_0122575 | |||
| 1205 | Ga0451807_0838424 | |||
| 1206 | Ga0451807_1303316 | |||
| 1207 | Ga0451833_0129506 | |||
| 1208 | Ga0451833_0262464 | |||
| 1209 | Ga0451833_0948954 | |||
| 1210 | Ga0451837_0080165 | |||
| 1211 | Ga0451837_0404346 | |||
| 1212 | Ga0451837_1000932 | |||
| 1213 | Ga0451837_1144477 | |||
| 1214 | Ga0451837_1541278 | |||
| 1215 | Ga0451841_0575958 | |||
| 1216 | Ga0451847_0598769 | |||
| 1217 | Ga0451843_0033527 | |||
| 1218 | Ga0451843_0818476 | |||
| 1219 | Ga0451843_1251261 | |||
| 1220 | Ga0451853_0966211 | |||
| 1221 | Ga0451853_1206899 | |||
| 1222 | Ga0439433_0064466 | |||
| 1223 | Ga0439433_0109546 | |||
| 1224 | Ga0439445_0001427 | |||
| 1225 | Ga0439445_0042401 | |||
| 1226 | Ga0439432_009347 | |||
| 1227 | Ga0439432_031207 | |||
| 1228 | Ga0439432_033157 | |||
| 1229 | Ga0439432_169007 | |||
| 1230 | Ga0439449_0000397 | |||
| 1231 | Ga0439449_0002795 | |||
| 1232 | Ga0439449_0003184 | |||
| 1233 | Ga0439449_0007071 | |||
| 1234 | Ga0439449_0031507 | |||
| 1235 | Ga0439449_0059119 | |||
| 1236 | Ga0439449_0101197 | |||
| 1237 | Ga0439449_0103698 | |||
| 1238 | Ga0439449_0284787 | |||
| 1239 | Ga0439452_035451 | |||
| 1240 | Ga0439457_064934 | |||
| 1241 | Ga0439462_0011239 | |||
| 1242 | Ga0450911_001313 | |||
| 1243 | Ga0450894_008310 | |||
| 1244 | Ga0450898_051691 | |||
| 1245 | Ga0450898_079098 | |||
| 1246 | Ga0450905_001592 | |||
| 1247 | Ga0450918_065583 | |||
| 1248 | Ga0450901_004821 | |||
| 1249 | Ga0451577_0005595 | |||
| 1250 | Ga0439440_0019513 | |||
| 1251 | Ga0466972_0315316 | |||
| 1252 | Ga0453684_0333386 | |||
| 1253 | Ga0466967_0369552 | |||
| 1254 | Ga0495627_002530 | |||
| 1255 | Ga0495627_126379 | |||
| 1256 | Ga0495638_0000231 | |||
| 1257 | Ga0495638_0019350 | |||
| 1258 | Ga0495638_0181314 | |||
| 1259 | Ga0495638_0183314 | |||
| 1260 | Ga0495650_0132018 | |||
| 1261 | Ga0495605_0011245 | |||
| 1262 | Ga0495607_0093207 | |||
| 1263 | Ga0495606_0041634 | |||
| 1264 | Ga0495610_0000242 | |||
| 1265 | Ga0495610_0022452 | |||
| 1266 | Ga0495631_0001336 | |||
| 1267 | Ga0495631_0234769 | |||
| 1268 | Ga0495632_0066337 | |||
| 1269 | Ga0495643_0000701 | |||
| 1270 | Ga0495663_0001362 | |||
| 1271 | Ga0495663_0003977 | |||
| 1272 | Ga0495663_0007413 | |||
| 1273 | Ga0495663_0010786 | |||
| 1274 | Ga0495663_0015525 | |||
| 1275 | Ga0495663_0020927 | |||
| 1276 | Ga0495663_0066880 | |||
| 1277 | Ga0495663_0090240 | |||
| 1278 | Ga0495663_0220489 | |||
| 1279 | Ga0495654_0141416 | |||
| 1280 | Ga0495609_0040483 | |||
| 1281 | Ga0495609_0141699 | |||
| 1282 | Ga0495621_0064087 | |||
| 1283 | Ga0495633_0002603 | |||
| 1284 | Ga0495633_0007084 | |||
| 1285 | Ga0495633_0114800 | |||
| 1286 | Ga0495656_0000725 | |||
| 1287 | Ga0495656_0003229 | |||
| 1288 | Ga0495656_0057305 | |||
| 1289 | Ga0495656_0064229 | |||
| 1290 | Ga0495668_0001500 | |||
| 1291 | Ga0495668_0061339 | |||
| 1292 | Ga0495625_0174766 | |||
| 1293 | Ga0495625_0499185 | |||
| 1294 | Ga0495659_0018838 | |||
| 1295 | Ga0495659_0024353 | |||
| 1296 | Ga0495659_0182379 | |||
| 1297 | Ga0495670_0072717 | |||
| 1298 | Ga0495670_0200281 | |||
| 1299 | Ga0495670_0740530 | |||
| 1300 | Ga0495671_0002713 | |||
| 1301 | Ga0495660_0151864 | |||
| 1302 | Ga0495636_0000850 | |||
| 1303 | Ga0495636_0054635 | |||
| 1304 | Ga0495636_0080216 | |||
| 1305 | Ga0495636_0094429 | |||
| 1306 | Ga0495636_0149047 | |||
| 1307 | Ga0495672_0000092 | |||
| 1308 | Ga0495677_0056861 | |||
| 1309 | Ga0495685_027545 | |||
| 1310 | Ga0495681_0201398 | |||
| 1311 | Ga0495681_0364037 | |||
| 1312 | Ga0495686_0002273 | |||
| 1313 | Ga0495686_0024577 | |||
| 1314 | Ga0495686_0249485 | |||
| 1315 | Ga0495615_0014537 | |||
| 1316 | Ga0496100_0136465 | |||
| 1317 | Ga0496100_0142363 | |||
| 1318 | Ga0496100_0332157 | |||
| 1319 | Ga0496101_0115545 | |||
| 1320 | Ga0496101_0304176 | |||
| 1321 | Ga0496102_0233461 | |||
| 1322 | Ga0496104_0143547 | |||
| 1323 | Ga0496106_0018879 | |||
| 1324 | Ga0496106_0796300 | |||
| 1325 | Ga0496107_0024397 | |||
| 1326 | Ga0496108_0138026 | |||
| 1327 | Ga0496108_0253319 | |||
| 1328 | Ga0496109_0084181 | |||
| 1329 | Ga0496109_0309026 | |||
| 1330 | Ga0496109_0749390 | |||
| 1331 | Ga0496110_0194140 | |||
| 1332 | Ga0496110_0265740 | |||
| 1333 | Ga0496112_0858063 | |||
| 1334 | Ga0496113_0033885 | |||
| 1335 | Ga0496113_0092392 | |||
| 1336 | Ga0496114_0004682 | |||
| 1337 | Ga0496116_0003037 | |||
| 1338 | Ga0496116_0047167 | |||
| 1339 | Ga0496117_0002348 | |||
| 1340 | Ga0496117_0004119 | |||
| 1341 | Ga0496117_0004182 | |||
| 1342 | Ga0496117_0008480 | |||
| 1343 | Ga0496117_0129021 | |||
| 1344 | Ga0496117_0303502 | |||
| 1345 | Ga0496118_0003159 | |||
| 1346 | Ga0496118_0004490 | |||
| 1347 | Ga0496118_0004569 | |||
| 1348 | Ga0496118_0025445 | |||
| 1349 | Ga0496118_0027373 | |||
| 1350 | Ga0496118_0031274 | |||
| 1351 | Ga0496118_0032518 | |||
| 1352 | Ga0496118_0093093 | |||
| 1353 | Ga0496118_0136849 | |||
| 1354 | Ga0496119_0000176 | |||
| 1355 | Ga0496119_0001471 | |||
| 1356 | Ga0496119_0066333 | |||
| 1357 | Ga0496120_0000277 | |||
| 1358 | Ga0496120_0003247 | |||
| 1359 | Ga0496121_0008895 | |||
| 1360 | Ga0496121_0010562 | |||
| 1361 | Ga0496121_0046062 | |||
| 1362 | Ga0496121_0060547 | |||
| 1363 | Ga0496122_0000144 | |||
| 1364 | Ga0496122_0003749 | |||
| 1365 | Ga0496122_0008640 | |||
| 1366 | Ga0496122_0009056 | |||
| 1367 | Ga0496122_0014795 | |||
| 1368 | Ga0496122_0020337 | |||
| 1369 | Ga0496122_0073409 | |||
| 1370 | Ga0496122_0076587 | |||
| 1371 | Ga0496122_0241953 | |||
| 1372 | Ga0496123_0000665 | |||
| 1373 | Ga0496123_0001387 | |||
| 1374 | Ga0496123_0010195 | |||
| 1375 | Ga0496123_0023413 | |||
| 1376 | Ga0496123_0046011 | |||
| 1377 | Ga0496123_0060932 | |||
| 1378 | Ga0496123_0195517 | |||
| 1379 | Ga0496124_0000020 | |||
| 1380 | Ga0496124_0001413 | |||
| 1381 | Ga0496124_0001960 | |||
| 1382 | Ga0496124_0005910 | |||
| 1383 | Ga0496124_0015555 | |||
| 1384 | Ga0496124_0020487 | |||
| 1385 | Ga0496124_0021623 | |||
| 1386 | Ga0496124_0116272 | |||
| 1387 | Ga0496124_0188697 | |||
| 1388 | Ga0496124_0228072 | |||
| 1389 | Ga0496124_0371223 | |||
| 1390 | Ga0496125_0001174 | |||
| 1391 | Ga0496125_0006187 | |||
| 1392 | Ga0496125_0012715 | |||
| 1393 | Ga0496125_0030967 | |||
| 1394 | Ga0496125_0079723 | |||
| 1395 | Ga0496125_0105459 | |||
| 1396 | Ga0496125_0299195 | |||
| 1397 | Ga0496125_0437111 | |||
| 1398 | Ga0496126_0008940 | |||
| 1399 | Ga0496126_0048096 | |||
| 1400 | Ga0496126_0059449 | |||
| 1401 | Ga0496126_0145910 | |||
| 1402 | Ga0496126_0229726 | |||
| 1403 | Ga0496126_0231035 | |||
| 1404 | Ga0496126_0817728 | |||
| 1405 | Ga0496126_0817785 | |||
| 1406 | Ga0501290_004964 | |||
| 1407 | Ga0501300_005594 | |||
| 1408 | Ga0501031_0007657 | |||
| 1409 | Ga0501031_0074716 | |||
| 1410 | Ga0501031_0232126 | |||
| 1411 | Ga0501032_0019427 | |||
| 1412 | Ga0501032_0134917 | |||
| 1413 | Ga0501033_0001420 | |||
| 1414 | Ga0501033_0029300 | |||
| 1415 | Ga0501033_0154439 | |||
| 1416 | Ga0501033_0302562 | |||
| 1417 | Ga0501034_0000367 | |||
| 1418 | Ga0501034_0000798 | |||
| 1419 | Ga0501034_0002483 | |||
| 1420 | Ga0501034_0014196 | |||
| 1421 | Ga0501034_0034412 | |||
| 1422 | Ga0501034_0485734 | |||
| 1423 | Ga0501034_0586523 | |||
| 1424 | Ga0501034_0616366 | |||
| 1425 | Ga0501036_0003765 | |||
| 1426 | Ga0501036_0378351 | |||
| 1427 | Ga0501036_0561336 | |||
| 1428 | Ga0501037_0003115 | |||
| 1429 | Ga0501037_0118874 | |||
| 1430 | Ga0501037_0180287 | |||
| 1431 | Ga0501037_0193849 | |||
| 1432 | Ga0501038_0000610 | |||
| 1433 | Ga0501038_0022312 | |||
| 1434 | Ga0501039_0015127 | |||
| 1435 | Ga0501039_0327895 | |||
| 1436 | Ga0501043_0003950 | |||
| 1437 | Ga0501043_0005273 | |||
| 1438 | Ga0501046_0596660 | |||
| 1439 | Ga0501047_0032812 | |||
| 1440 | Ga0501047_0070906 | |||
| 1441 | Ga0501047_0503870 | |||
| 1442 | Ga0501067_0492754 | |||
| 1443 | Ga0501069_0048200 | |||
| 1444 | Ga0501069_0067919 | |||
| 1445 | Ga0501069_0478980 | |||
| 1446 | Ga0501070_0015328 | |||
| 1447 | Ga0501070_0018010 | |||
| 1448 | Ga0501070_0051642 | |||
| 1449 | Ga0501070_0171477 | |||
| 1450 | Ga0501071_0015686 | |||
| 1451 | Ga0501073_0008696 | |||
| 1452 | Ga0501073_0139904 | |||
| 1453 | Ga0501074_0009659 | |||
| 1454 | Ga0501074_0032514 | |||
| 1455 | Ga0501202_027857 | |||
| 1456 | Ga0501202_063332 | |||
| 1457 | Ga0501238_032312 | |||
| 1458 | Ga0501240_068913 | |||
| 1459 | Ga0501257_083595 | |||
| 1460 | Ga0501258_054904 | |||
| 1461 | Ga0501225_0008942 | |||
| 1462 | Ga0501079_0118427 | |||
| 1463 | Ga0501079_0148072 | |||
| 1464 | Ga0501080_0005331 | |||
| 1465 | Ga0501080_0005548 | |||
| 1466 | Ga0501080_0024487 | |||
| 1467 | Ga0501263_018100 | |||
| 1468 | Ga0501266_014097 | |||
| 1469 | Ga0501270_014135 | |||
| 1470 | Ga0501270_030383 | |||
| 1471 | Ga0501274_032573 | |||
| 1472 | Ga0501275_000092 | |||
| 1473 | Ga0501279_040058 | |||
| 1474 | Ga0501280_055492 | |||
| 1475 | Ga0501035_0000992 | |||
| 1476 | Ga0501035_0002406 | |||
| 1477 | Ga0501035_0064630 | |||
| 1478 | Ga0501035_0356685 | |||
| 1479 | Ga0501044_0002382 | |||
| 1480 | Ga0501044_0003326 | |||
| 1481 | Ga0501044_0101121 | |||
| 1482 | Ga0501044_0191042 | |||
| 1483 | Ga0501044_1547779 | |||
| 1484 | nmdc:mga03683_194673_c1 | |||
| 1485 | nmdc:mga00v17_680_c1 | |||
| 1486 | Ga0500577_0041736 | |||
| 1487 | Ga0500634_0000117 | |||
| 1488 | Ga0500609_018035 | |||
| 1489 | 2572255764 | |||
| 1490 | 2574429127 | |||
| 1491 | 2578459988 | |||
| 1492 | 2643817083 | |||
| 1493 | 2643879649 | |||
| 1494 | 2643906531 | |||
| 1495 | 2643913961 | |||
| 1496 | 2643939599 | |||
| 1497 | 2643976527 | |||
| 1498 | 2644080469 | |||
| 1499 | 2644530869 | |||
| 1500 | 2644663311 | |||
| 1501 | 2644696577 | |||
| 1502 | 2644701190 | |||
| 1503 | 2747950168 | |||
| 1504 | 2748019908 | |||
| 1505 | 2765577276 | |||
| 1506 | 2816519917 | |||
| 1507 | 2819663216 | |||
| 1508 | 2842394658 | |||
| 1509 | 2842760819 | |||
| 1510 | 2842784493 | |||
| 1511 | 2848699904 | |||
| 1512 | 2852652559 | |||
| 1513 | 2852689210 | |||
| 1514 | 2857445574 | |||
| 1515 | 2874223810 | |||
| 1516 | 2894417591 | |||
| 1517 | 2895502940 | |||
| 1518 | 2895512979 | |||
| 1519 | 2895522991 | |||
| 1520 | 2895526886 | |||
| 1521 | 2919090268 | |||
| 1522 | 2919133045 | |||
| 1523 | 2919138422 | |||
| 1524 | 2919513869 | |||
| 1525 | 2919678696 | |||
| 1526 | 2923516428 | |||
| 1527 | 2928498219 | |||
| 1528 | 2929195905 | |||
| 1529 | 2931382436 | |||
| 1530 | 2937613718 | |||
| 1531 | 2939593066 | |||
| 1532 | 2939626215 | |||
| 1533 | 2939627834 | |||
| 1534 | 2941479648 | |||
| 1535 | 2941493950 | |||
| 1536 | 2961050574 | |||
| 1537 | 2961065751 | |||
| 1538 | 2974310418 | |||
| 1539 | 2977251150 | |||
| 1540 | 2987605785 | |||
| 1541 | 2995953818 | |||
| 1542 | 8002870874 | |||
| 1543 | 8003017378 | |||
| 1544 | 8021623163 | |||
| 1545 | 8021629731 | |||
| 1546 | 8021648984 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dup-assembly1.cif.gz_A | deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) | 0.9518 | 3 | 138 |
| 3tqz-assembly1.cif.gz_A | structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii | 0.9497 | 3 | 139 |
| 1rnj-assembly1.cif.gz_A | crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp | 0.9464 | 3 | 138 |
| 6mai-assembly1.cif.gz_A | crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 | 0.9455 | 5 | 140 |
| 1dup-assembly1.cif.gz_A | deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) | 0.9451 | 3 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9522 | 4 | 139 | 2.70.40.10 |
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9388 | 4 | 139 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9168 | 4 | 138 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9101 | 4 | 138 | 2.70.40.10 |
| 3mbqA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9043 | 6 | 139 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447QL67-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9832 | 3 | 125 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A534E2N6-F1-model_v4 | deleted | 0.9819 | 16 | 121 |
|
| AF-A0A659QLR3-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9815 | 5 | 109 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A661CKF5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9813 | 6 | 129 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A259EVG0-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9807 | 5 | 121 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |