F480165

General Info

Members Datasets Scaffolds Average Seq Length
773 383 1546 155

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10073786|Ga0182008_100737862
Length 180
Sequence MTTARGRSRRSAHGRLASLFLSFGRFDLMNHSLQLKLLDSRYGGEWPLPAYATEASAGLDLRAALDQSLVLHPGDAALVPSGLAIHLGDPSLCAVILPRSGLGHKHGIVLGNGTGLIDADYQGPLLISLWNRGRETFTIQPGDRIAQLVVLPIVRASLQVVDQFEASHRGDGGFGHTGLR

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
78 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
79 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
80 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
81 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
94 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
168 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
169 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
170 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
171 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
195 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
200 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
201 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
202 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
210 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
223 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
224 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
225 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
226 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
227 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
286 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
305 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
306 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
307 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
308 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
313 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
314 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
315 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
316 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
317 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
318 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
324 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
325 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
326 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
327 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
328 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
329 2643221559 Lysobacter sp. Root559 Isolate Unclassified
330 2643221573 Lysobacter sp. Root604 Isolate Unclassified
331 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
332 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
333 2643221586 Lysobacter sp. Root667 Isolate Unclassified
334 2643221593 Lysobacter sp. Root690 Isolate Unclassified
335 2643221612 Lysobacter sp. Root76 Isolate Unclassified
336 2643221695 Lysobacter sp. Root494 Isolate Unclassified
337 2643221720 Lysobacter sp. Root916 Isolate Unclassified
338 2643221727 Lysobacter sp. Root96 Isolate Unclassified
339 2643221728 Lysobacter sp. Root983 Isolate Unclassified
340 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
341 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
342 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
343 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
344 2818991457 Xanthomonas translucens 569 Isolate Unclassified
345 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
346 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
347 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
348 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
349 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
350 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
351 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
352 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
353 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
354 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
355 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
356 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
357 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
358 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
359 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
360 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
361 2919513703 Luteimonas sp. 3794 Isolate Unclassified
362 2919675420 Luteimonas terrae 4099 Isolate Unclassified
363 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
364 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
365 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
366 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
367 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
368 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
369 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
370 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
371 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
372 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
373 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
374 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
375 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
376 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
377 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
378 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
379 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
380 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
381 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
382 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
383 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 1.16
Isolates 7.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0.26
Rhizoplane 5.56
Rhizosphere 66.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10073786 3300014497 Bacteria 1678
2 SwRhRL2b_contig_1735385 2162886007 Bacteria 4183
3 SwRhRL2b_contig_3057749 2162886007 Bacteria 1191
4 JGI24736J21556_1006444 3300001904 Bacteria 1975
5 JGI24741J21665_1000902 3300001915 Bacteria 8943
6 JGI24740J21852_10013378 3300001979 Bacteria 3062
7 JGI25152J39213_1000076 3300002773 Bacteria 66295
8 JGI25150J39212_1000530 3300002774 Bacteria 15563
9 JGI25151J46595_10000231 3300003187 Bacteria 66295
10 JGI25151J46595_10013068 3300003187 Bacteria 3747
11 JGI25153J46596_10000166 3300003215 Bacteria 66295
12 rootH2_10011547 3300003320 Bacteria 6663
13 Ga0055526_1000107 3300003771 Bacteria 72819
14 Ga0055526_1006559 3300003771 Bacteria 6279
15 Ga0055526_1006992 3300003771 Bacteria 5985
16 Ga0055537_1000147 3300003773 Bacteria 52610
17 Ga0055537_1000299 3300003773 Bacteria 34588
18 Ga0055524_1000176 3300003775 Bacteria 72819
19 Ga0055524_1015049 3300003775 Bacteria 2838
20 Ga0055536_1001750 3300003781 Bacteria 12809
21 Ga0055536_1002416 3300003781 Bacteria 10502
22 Ga0055536_1004645 3300003781 Bacteria 6946
23 Ga0055536_1012468 3300003781 Bacteria 3152
24 Ga0055536_1022961 3300003781 Bacteria 1846
25 Ga0055534_1000090 3300003784 Bacteria 71465
26 Ga0055534_1000322 3300003784 Bacteria 31844
27 Ga0055534_1000837 3300003784 Bacteria 14168
28 Ga0055528_1000088 3300003790 Bacteria 72819
29 Ga0055528_1000194 3300003790 Bacteria 51826
30 Ga0055530_10001839 3300003791 Bacteria 14615
31 Ga0055530_10002248 3300003791 Bacteria 12723
32 Ga0055530_10002449 3300003791 Bacteria 11933
33 Ga0055540_1016642 3300003792 Bacteria 2083
34 Ga0055531_10003516 3300003794 Bacteria 9962
35 Ga0055531_10008428 3300003794 Bacteria 5438
36 Ga0058692_1000005 3300003856 Bacteria 398815
37 Ga0058692_1000021 3300003856 Bacteria 240308
38 Ga0065714_10108158 3300005288 Bacteria 1519
39 Ga0065704_10071322 3300005289 Bacteria 11740
40 Ga0065704_10187846 3300005289 Bacteria 1204
41 Ga0065715_10031725 3300005293 Bacteria 1420
42 Ga0065715_10111242 3300005293 Bacteria 2580
43 Ga0065715_10218496 3300005293 Bacteria 1282
44 Ga0065715_10260000 3300005293 Bacteria 1139
45 Ga0065715_10392576 3300005293 Bacteria 892
46 Ga0070658_10065811 3300005327 Bacteria 2959
47 Ga0070683_100765709 3300005329 Bacteria 925
48 Ga0070683_100833271 3300005329 Bacteria 884
49 Ga0070670_100032140 3300005331 Bacteria 4520
50 Ga0070670_100579330 3300005331 Bacteria 1003
51 Ga0070670_100835604 3300005331 Bacteria 833
52 Ga0070677_10229757 3300005333 Bacteria 911
53 Ga0070677_10729348 3300005333 Bacteria 560
54 Ga0070666_10800520 3300005335 Bacteria 694
55 Ga0070680_100844357 3300005336 Bacteria 789
56 Ga0070680_100965773 3300005336 Bacteria 735
57 Ga0070682_100091334 3300005337 Bacteria 1993
58 Ga0070660_100017200 3300005339 Bacteria 5267
59 Ga0070660_100213612 3300005339 Bacteria 1566
60 Ga0070689_101464279 3300005340 Bacteria 618
61 Ga0070661_100192569 3300005344 Bacteria 1556
62 Ga0070661_100830832 3300005344 Bacteria 759
63 Ga0070668_100017205 3300005347 Bacteria 5411
64 Ga0070668_100082220 3300005347 Bacteria 2526
65 Ga0070668_100559441 3300005347 Bacteria 996
66 Ga0070669_100374018 3300005353 Bacteria 1161
67 Ga0070675_100222296 3300005354 Bacteria 1645
68 Ga0070671_100061411 3300005355 Bacteria 3130
69 Ga0070671_100116693 3300005355 Bacteria 2244
70 Ga0070671_100753266 3300005355 Bacteria 846
71 Ga0070674_100245789 3300005356 Bacteria 1403
72 Ga0070674_100987612 3300005356 Bacteria 738
73 Ga0070673_100102802 3300005364 Bacteria 2356
74 Ga0070659_100081947 3300005366 Bacteria 2577
75 Ga0070659_100740290 3300005366 Bacteria 852
76 Ga0070667_100314501 3300005367 Bacteria 1412
77 Ga0070667_101376530 3300005367 Bacteria 662
78 Ga0070701_10378711 3300005438 Bacteria 891
79 Ga0070663_100113960 3300005455 Bacteria 2035
80 Ga0070663_100673681 3300005455 Bacteria 877
81 Ga0070678_100040771 3300005456 Bacteria 3287
82 Ga0070681_10398300 3300005458 Bacteria 1288
83 Ga0070681_10886440 3300005458 Bacteria 810
84 Ga0068867_100051053 3300005459 Bacteria 3049
85 Ga0070679_100193708 3300005530 Bacteria 2001
86 Ga0068853_100395029 3300005539 Bacteria 1293
87 Ga0070672_100171919 3300005543 Bacteria 1802
88 Ga0070696_100093329 3300005546 Bacteria 2146
89 Ga0070693_100001019 3300005547 Bacteria 12488
90 Ga0070665_100238917 3300005548 Bacteria 1817
91 Ga0068855_101532279 3300005563 Bacteria 684
92 Ga0070664_100007922 3300005564 Bacteria 8580
93 Ga0070664_100065343 3300005564 Bacteria 3104
94 Ga0068857_101036706 3300005577 Bacteria 790
95 Ga0068854_100823886 3300005578 Bacteria 810
96 Ga0068852_100012784 3300005616 Bacteria 6394
97 Ga0068852_101215047 3300005616 Bacteria 775
98 Ga0068859_100618195 3300005617 Bacteria 1176
99 Ga0068861_100237731 3300005719 Bacteria 1548
100 Ga0068861_100289575 3300005719 Bacteria 1414
101 Ga0068851_10134654 3300005834 Bacteria 1339
102 Ga0068870_10944277 3300005840 Bacteria 612
103 Ga0068863_101294799 3300005841 Bacteria 736
104 Ga0068862_101251349 3300005844 Bacteria 742
105 Ga0081539_10016629 3300005985 Bacteria 5234
106 Ga0075364_10173314 3300006051 Bacteria 1458
107 Ga0075364_10300602 3300006051 Bacteria 1092
108 Ga0075362_10222707 3300006177 Bacteria 922
109 Ga0097620_100618191 3300006931 Bacteria 1176
110 Ga0079104_1111531 3300006946 Bacteria 541
111 Ga0105251_10000014 3300009011 Bacteria 150347
112 Ga0105251_10002449 3300009011 Bacteria 14578
113 Ga0105244_10065862 3300009036 Bacteria 1814
114 Ga0105240_10072642 3300009093 Bacteria 4252
115 Ga0105240_10208081 3300009093 Bacteria 2288
116 Ga0105243_10003907 3300009148 Bacteria 11896
117 Ga0105243_10022428 3300009148 Bacteria 4799
118 Ga0105243_10037668 3300009148 Bacteria 3761
119 Ga0105242_10108908 3300009176 Bacteria 2358
120 Ga0105248_10407810 3300009177 Bacteria 1530
121 Ga0105248_10919564 3300009177 Bacteria 988
122 Ga0105248_13353722 3300009177 Bacteria 509
123 Ga0105032_102531 3300009979 Bacteria 1628
124 Ga0105246_10280278 3300011119 Bacteria 1337
125 Ga0157318_1000725 3300012482 Bacteria 1511
126 Ga0157322_1011021 3300012490 Bacteria 739
127 Ga0157316_1000454 3300012510 Bacteria 2150
128 Ga0157327_1000792 3300012512 Bacteria 1809
129 Ga0157327_1019029 3300012512 Bacteria 755
130 Ga0154019_129338 3300013044 Bacteria 699
131 Ga0157373_10022336 3300013100 Bacteria 4589
132 Ga0157373_10268713 3300013100 Bacteria 1207
133 Ga0157373_10800651 3300013100 Bacteria 695
134 Ga0157371_10003036 3300013102 Bacteria 15589
135 Ga0157371_10018618 3300013102 Bacteria 5131
136 Ga0157371_10117669 3300013102 Bacteria 1889
137 Ga0157371_11033775 3300013102 Bacteria 628
138 Ga0157371_11034349 3300013102 Bacteria 628
139 Ga0157370_10090271 3300013104 Bacteria 2877
140 Ga0157370_10110821 3300013104 Bacteria 2565
141 Ga0157370_10147983 3300013104 Bacteria 2186
142 Ga0157369_10165624 3300013105 Bacteria 2331
143 Ga0157369_10314518 3300013105 Bacteria 1628
144 Ga0163162_10875449 3300013306 Bacteria 1012
145 Ga0163162_10930318 3300013306 Bacteria 981
146 Ga0157372_10074997 3300013307 Bacteria 3815
147 Ga0157372_10351287 3300013307 Bacteria 1718
148 Ga0157375_10619585 3300013308 Bacteria 1240
149 Ga0157380_10355758 3300014326 Bacteria 1372
150 Ga0157380_10397465 3300014326 Bacteria 1306
151 Ga0157380_10418061 3300014326 Bacteria 1278
152 Ga0182008_10004347 3300014497 Bacteria 8287
153 Ga0182008_10116459 3300014497 Bacteria 1326
154 Ga0182008_10204165 3300014497 Bacteria 1007
155 Ga0182006_1023345 3300015261 Bacteria 2562
156 Ga0182006_1029292 3300015261 Bacteria 2231
157 Ga0182006_1035632 3300015261 Bacteria 1982
158 Ga0182006_1046573 3300015261 Bacteria 1684
159 Ga0182006_1057926 3300015261 Bacteria 1471
160 Ga0182007_10000500 3300015262 Bacteria 23316
161 Ga0182005_1000186 3300015265 Bacteria 42690
162 Ga0182005_1028194 3300015265 Bacteria 1531
163 Ga0183360_10004 3300015689 Bacteria 289992
164 Ga0183361_10143 3300016635 Bacteria 2422
165 Ga0163161_10309616 3300017792 Bacteria 1246
166 Ga0163161_10380784 3300017792 Bacteria 1128
167 Ga0163161_10602251 3300017792 Bacteria 906
168 Ga0206356_11710452 3300020070 Bacteria 7545
169 Ga0206351_10226310 3300020077 Bacteria 5919
170 Ga0206350_11473204 3300020080 Bacteria 2927
171 Ga0206354_10337747 3300020081 Bacteria 3089
172 Ga0206353_10206423 3300020082 Bacteria 709
173 Ga0206353_10721119 3300020082 Bacteria 896
174 Ga0206353_10726987 3300020082 Bacteria 2174
175 Ga0154015_1073503 3300020610 Bacteria 8676
176 Ga0207425_1000029 3300025245 Bacteria 268521
177 Ga0209129_1000216 3300025258 Bacteria 66352
178 Ga0209565_1000002 3300025263 Bacteria 1423083
179 Ga0209565_1000071 3300025263 Bacteria 166213
180 Ga0209565_1006967 3300025263 Bacteria 3102
181 Ga0209673_1000002 3300025273 Bacteria 1423083
182 Ga0209673_1001159 3300025273 Bacteria 28752
183 Ga0209673_1005118 3300025273 Bacteria 6717
184 Ga0209130_1023919 3300025284 Bacteria 1340
185 Ga0209130_1024273 3300025284 Bacteria 1325
186 Ga0209675_1000002 3300025291 Bacteria 1423083
187 Ga0209675_1000018 3300025291 Bacteria 377481
188 Ga0209675_1003998 3300025291 Bacteria 6729
189 Ga0209675_1004010 3300025291 Bacteria 6718
190 Ga0209676_1000035 3300025292 Bacteria 459284
191 Ga0209676_1000185 3300025292 Bacteria 142505
192 Ga0209676_1000248 3300025292 Bacteria 115456
193 Ga0209676_1001632 3300025292 Bacteria 19793
194 Ga0209676_1002505 3300025292 Bacteria 12861
195 Ga0209676_1003269 3300025292 Bacteria 10188
196 Ga0209676_1004137 3300025292 Bacteria 8260
197 Ga0209676_1004879 3300025292 Bacteria 7244
198 Ga0209676_1015746 3300025292 Bacteria 2767
199 Ga0209025_1000076 3300025294 Bacteria 273934
200 Ga0209025_1002264 3300025294 Bacteria 21076
201 Ga0209025_1003682 3300025294 Bacteria 14145
202 Ga0209025_1046408 3300025294 Bacteria 1787
203 Ga0209564_1000004 3300025295 Bacteria 1424639
204 Ga0209564_1000148 3300025295 Bacteria 172177
205 Ga0209564_1016519 3300025295 Bacteria 2932
206 Ga0209758_1000473 3300025297 Bacteria 66352
207 Ga0209758_1029718 3300025297 Bacteria 2277
208 Ga0209050_1000182 3300025298 Bacteria 142435
209 Ga0209050_1000865 3300025298 Bacteria 40908
210 Ga0209050_1000896 3300025298 Bacteria 39492
211 Ga0209050_1006684 3300025298 Bacteria 6750
212 Ga0209050_1021068 3300025298 Bacteria 2394
213 Ga0209256_1000004 3300025299 Bacteria 1424643
214 Ga0209256_1002608 3300025299 Bacteria 14282
215 Ga0209256_1004525 3300025299 Bacteria 8674
216 Ga0209256_1004737 3300025299 Bacteria 8317
217 Ga0209256_1008272 3300025299 Bacteria 4864
218 Ga0209256_1020379 3300025299 Bacteria 2071
219 Ga0207426_1063551 3300025302 Bacteria 1053
220 Ga0209051_1001212 3300025303 Bacteria 23226
221 Ga0209051_1023573 3300025303 Bacteria 2554
222 Ga0209257_1000154 3300025304 Bacteria 185887
223 Ga0209257_1000348 3300025304 Bacteria 95101
224 Ga0209257_1000470 3300025304 Bacteria 73603
225 Ga0209257_1000611 3300025304 Bacteria 58189
226 Ga0209257_1001025 3300025304 Bacteria 37552
227 Ga0209257_1002151 3300025304 Bacteria 20504
228 Ga0209257_1002742 3300025304 Bacteria 16697
229 Ga0209257_1002838 3300025304 Bacteria 16251
230 Ga0209257_1003916 3300025304 Bacteria 12102
231 Ga0209257_1021017 3300025304 Bacteria 2387
232 Ga0207656_10048365 3300025321 Bacteria 1831
233 Ga0207655_1088582 3300025728 Bacteria 1095
234 Ga0207713_1000290 3300025735 Bacteria 58238
235 Ga0207713_1007313 3300025735 Bacteria 6540
236 Ga0207682_10105183 3300025893 Bacteria 1238
237 Ga0207682_10122292 3300025893 Bacteria 1155
238 Ga0207647_10000890 3300025904 Bacteria 23143
239 Ga0207643_10185001 3300025908 Bacteria 1262
240 Ga0207705_10002475 3300025909 Bacteria 14229
241 Ga0207705_10010051 3300025909 Bacteria 6887
242 Ga0207705_10161744 3300025909 Bacteria 1682
243 Ga0207707_10001264 3300025912 Bacteria 23623
244 Ga0207707_10003347 3300025912 Bacteria 14229
245 Ga0207707_10453110 3300025912 Bacteria 1098
246 Ga0207695_10006903 3300025913 Bacteria 14602
247 Ga0207695_10011668 3300025913 Bacteria 10620
248 Ga0207660_10009796 3300025917 Bacteria 6205
249 Ga0207660_10010767 3300025917 Bacteria 5943
250 Ga0207660_10562083 3300025917 Bacteria 928
251 Ga0207662_10290782 3300025918 Bacteria 1084
252 Ga0207657_10051651 3300025919 Bacteria 3573
253 Ga0207657_10699508 3300025919 Bacteria 787
254 Ga0207649_10003122 3300025920 Bacteria 9089
255 Ga0207652_10001254 3300025921 Bacteria 22591
256 Ga0207652_10003823 3300025921 Bacteria 12344
257 Ga0207681_10028705 3300025923 Bacteria 3606
258 Ga0207681_10144850 3300025923 Bacteria 1774
259 Ga0207650_10325159 3300025925 Bacteria 1260
260 Ga0207659_10122478 3300025926 Bacteria 1995
261 Ga0207644_10036484 3300025931 Bacteria 3452
262 Ga0207644_10042516 3300025931 Bacteria 3220
263 Ga0207644_10218122 3300025931 Bacteria 1511
264 Ga0207644_10323305 3300025931 Bacteria 1248
265 Ga0207690_10036274 3300025932 Bacteria 3191
266 Ga0207709_10001022 3300025935 Bacteria 20703
267 Ga0207709_10002288 3300025935 Bacteria 12152
268 Ga0207709_10161677 3300025935 Bacteria 1562
269 Ga0207669_10245256 3300025937 Bacteria 1330
270 Ga0207669_10611396 3300025937 Bacteria 887
271 Ga0207691_10007261 3300025940 Bacteria 10684
272 Ga0207691_10128498 3300025940 Bacteria 2240
273 Ga0207711_11017361 3300025941 Bacteria 768
274 Ga0207711_11269628 3300025941 Bacteria 678
275 Ga0207661_10011573 3300025944 Bacteria 6399
276 Ga0207679_10034352 3300025945 Bacteria 3576
277 Ga0207679_10367417 3300025945 Bacteria 1258
278 Ga0207679_10974384 3300025945 Bacteria 777
279 Ga0207679_11410404 3300025945 Bacteria 639
280 Ga0207667_10036564 3300025949 Bacteria 5262
281 Ga0207667_10435844 3300025949 Bacteria 1333
282 Ga0207651_10150870 3300025960 Bacteria 1809
283 Ga0207651_11039770 3300025960 Bacteria 733
284 Ga0207668_10002517 3300025972 Bacteria 10702
285 Ga0207668_10589693 3300025972 Bacteria 967
286 Ga0207640_10476289 3300025981 Bacteria 1034
287 Ga0207658_10159626 3300025986 Bacteria 1847
288 Ga0207639_10001300 3300026041 Bacteria 16879
289 Ga0207678_10778947 3300026067 Bacteria 844
290 Ga0207702_10004226 3300026078 Bacteria 12830
291 Ga0207648_10048102 3300026089 Bacteria 3735
292 Ga0207676_11025218 3300026095 Bacteria 814
293 Ga0207674_10933704 3300026116 Bacteria 836
294 Ga0207675_100178501 3300026118 Bacteria 2033
295 Ga0207675_100193144 3300026118 Bacteria 1953
296 Ga0207675_100269526 3300026118 Bacteria 1652
297 Ga0207683_10053759 3300026121 Bacteria 3531
298 Ga0207683_10183061 3300026121 Bacteria 1900
299 Ga0207698_10000835 3300026142 Bacteria 17845
300 Ga0207698_10328092 3300026142 Bacteria 1436
301 Ga0209371_1000031 3300027312 Bacteria 399263
302 Ga0209371_1000045 3300027312 Bacteria 316174
303 Ga0209999_1031017 3300027543 Bacteria 992
304 Ga0209982_1002311 3300027552 Bacteria 2672
305 Ga0210002_1027152 3300027617 Bacteria 942
306 Ga0209983_1001352 3300027665 Bacteria 5460
307 Ga0209971_1000880 3300027682 Bacteria 7709
308 Ga0209974_10117793 3300027876 Bacteria 939
309 Ga0209974_10278191 3300027876 Bacteria 636
310 Ga0268266_10015106 3300028379 Bacteria 6631
311 Ga0268266_10065663 3300028379 Bacteria 3137
312 Ga0268266_10153289 3300028379 Bacteria 2079
313 Ga0268265_11349322 3300028380 Bacteria 714
314 Ga0307515_10306778 3300028794 Bacteria 1266
315 Ga0268256_1000034 3300030500 Bacteria 398909
316 Ga0268256_1000047 3300030500 Bacteria 316174
317 Ga0316177_1065610 3300030731 Bacteria 6788
318 Ga0316176_1173906 3300030732 Bacteria 3511
319 Ga0314311_1089126 3300030733 Bacteria 6400
320 Ga0316181_1125246 3300030744 Bacteria 714
321 Ga0316182_1011388 3300030745 Bacteria 2188
322 Ga0307513_10008176 3300031456 Bacteria 13424
323 Ga0307513_10114462 3300031456 Bacteria 2682
324 Ga0307513_10233009 3300031456 Bacteria 1653
325 Ga0307509_10000566 3300031507 Bacteria 63345
326 Ga0307408_100025339 3300031548 Bacteria 4062
327 Ga0307408_100129644 3300031548 Bacteria 1966
328 Ga0307408_100577117 3300031548 Bacteria 996
329 Ga0307408_100794203 3300031548 Bacteria 858
330 Ga0307408_101096401 3300031548 Bacteria 738
331 Ga0307405_10109363 3300031731 Bacteria 1870
332 Ga0307405_10357418 3300031731 Bacteria 1129
333 Ga0307405_10554793 3300031731 Bacteria 930
334 Ga0307413_10012467 3300031824 Bacteria 4234
335 Ga0307413_10173591 3300031824 Bacteria 1528
336 Ga0307413_10233368 3300031824 Bacteria 1353
337 Ga0307413_10496821 3300031824 Bacteria 979
338 Ga0307413_10673485 3300031824 Bacteria 856
339 Ga0307413_10679676 3300031824 Bacteria 853
340 Ga0307410_10056716 3300031852 Bacteria 2665
341 Ga0307410_10576654 3300031852 Bacteria 936
342 Ga0307410_10867676 3300031852 Bacteria 771
343 Ga0307410_10916808 3300031852 Bacteria 751
344 Ga0307406_10016668 3300031901 Bacteria 4276
345 Ga0307406_10017565 3300031901 Bacteria 4167
346 Ga0307406_10088204 3300031901 Bacteria 2081
347 Ga0307407_10278344 3300031903 Bacteria 1158
348 Ga0307407_10641623 3300031903 Bacteria 795
349 Ga0307412_10001099 3300031911 Bacteria 15496
350 Ga0307412_10213123 3300031911 Bacteria 1475
351 Ga0307412_10978919 3300031911 Bacteria 746
352 Ga0307412_11944044 3300031911 Bacteria 543
353 Ga0307409_100273287 3300031995 Bacteria 1557
354 Ga0307416_100519871 3300032002 Bacteria 1258
355 Ga0307416_100586486 3300032002 Bacteria 1193
356 Ga0307414_10004133 3300032004 Bacteria 7838
357 Ga0307414_10007643 3300032004 Bacteria 6084
358 Ga0307414_10018313 3300032004 Bacteria 4307
359 Ga0307414_10061238 3300032004 Bacteria 2665
360 Ga0307414_10064446 3300032004 Bacteria 2609
361 Ga0307414_10099940 3300032004 Bacteria 2181
362 Ga0307414_10101031 3300032004 Bacteria 2170
363 Ga0307414_10143525 3300032004 Bacteria 1872
364 Ga0307414_10167432 3300032004 Bacteria 1753
365 Ga0307414_10169330 3300032004 Bacteria 1744
366 Ga0307414_10208240 3300032004 Bacteria 1596
367 Ga0307414_10247937 3300032004 Bacteria 1478
368 Ga0307414_10277569 3300032004 Bacteria 1406
369 Ga0307414_10284792 3300032004 Bacteria 1390
370 Ga0307414_10306313 3300032004 Bacteria 1346
371 Ga0307414_10385489 3300032004 Bacteria 1213
372 Ga0307414_10425236 3300032004 Bacteria 1159
373 Ga0307414_11415311 3300032004 Bacteria 646
374 Ga0307411_10103182 3300032005 Bacteria 2022
375 Ga0307411_10139037 3300032005 Bacteria 1788
376 Ga0307411_10142218 3300032005 Bacteria 1771
377 Ga0307411_10221821 3300032005 Bacteria 1467
378 Ga0307411_10234605 3300032005 Bacteria 1432
379 Ga0307411_10498920 3300032005 Bacteria 1028
380 Ga0307411_11402249 3300032005 Bacteria 639
381 Ga0307411_12043738 3300032005 Bacteria 535
382 Ga0307415_100455479 3300032126 Bacteria 1107
383 Ga0307415_100580651 3300032126 Bacteria 994
384 Ga0307415_101277245 3300032126 Bacteria 694
385 Ga0307415_101745220 3300032126 Bacteria 601
386 Ga0316584_0202741 3300036712 Bacteria 1463
387 Ga0395899_0034263 3300037312 Bacteria 3812
388 Ga0395899_0338679 3300037312 Bacteria 1009
389 Ga0395900_0158839 3300037418 Bacteria 2307
390 Ga0395898_0177422 3300037466 Bacteria 2036
391 Ga0395905_0002323 3300037471 Bacteria 21279
392 Ga0395905_0126074 3300037471 Bacteria 2407
393 Ga0395905_0130312 3300037471 Bacteria 2365
394 Ga0395905_0256919 3300037471 Bacteria 1632
395 Ga0395905_0709179 3300037471 Bacteria 908
396 Ga0395901_0142130 3300038443 Bacteria 2522
397 Ga0237819_01020 3300038705 Bacteria 8403
398 Ga0439436_0005257 3300041404 Bacteria 3964
399 Ga0439436_0006797 3300041404 Bacteria 3516
400 Ga0439436_0014468 3300041404 Bacteria 2379
401 Ga0439436_0027328 3300041404 Bacteria 1669
402 Ga0439436_0028860 3300041404 Bacteria 1618
403 Ga0439436_0036701 3300041404 Bacteria 1413
404 Ga0439439_0001752 3300041406 Bacteria 4433
405 Ga0439439_0114542 3300041406 Bacteria 749
406 Ga0439447_002949 3300041407 Bacteria 6096
407 Ga0439461_0003662 3300041410 Bacteria 2535
408 Ga0439466_0086037 3300041411 Bacteria 988
409 Ga0439465_0003842 3300041413 Bacteria 4902
410 Ga0439465_0004300 3300041413 Bacteria 4621
411 Ga0439465_0088744 3300041413 Bacteria 1056
412 Ga0451789_0367235 3300041443 Bacteria 1109
413 Ga0451789_0389000 3300041443 Bacteria 1032
414 Ga0451791_0110578 3300041451 Bacteria 986
415 Ga0451791_0632881 3300041451 Bacteria 3186
416 Ga0451791_0885769 3300041451 Bacteria 804
417 Ga0451793_0890414 3300041452 Bacteria 1320
418 Ga0451793_1101108 3300041452 Bacteria 915
419 Ga0451793_1895117 3300041452 Bacteria 1979
420 Ga0451797_0247115 3300041453 Bacteria 1866
421 Ga0451797_0262733 3300041453 Bacteria 616
422 Ga0451797_0426620 3300041453 Bacteria 2006
423 Ga0451797_1530440 3300041453 Bacteria 1607
424 Ga0451795_0392750 3300041456 Bacteria 578
425 Ga0451798_0529292 3300041458 Bacteria 1179
426 Ga0451800_0938602 3300041459 Bacteria 1329
427 Ga0451802_0958836 3300041460 Bacteria 1075
428 Ga0451802_1048206 3300041460 Bacteria 1506
429 Ga0451802_1116100 3300041460 Bacteria 885
430 Ga0451806_374272 3300041462 Bacteria 968
431 Ga0451807_0122575 3300041486 Bacteria 1668
432 Ga0451807_0838424 3300041486 Bacteria 1096
433 Ga0451807_1303316 3300041486 Bacteria 1347
434 Ga0451833_0129506 3300041491 Bacteria 934
435 Ga0451833_0262464 3300041491 Bacteria 622
436 Ga0451833_0948954 3300041491 Bacteria 957
437 Ga0451837_0080165 3300041494 Bacteria 1241
438 Ga0451837_0404346 3300041494 Bacteria 912
439 Ga0451837_1000932 3300041494 Bacteria 2892
440 Ga0451837_1144477 3300041494 Bacteria 816
441 Ga0451837_1541278 3300041494 Bacteria 660
442 Ga0451841_0575958 3300041498 Bacteria 700
443 Ga0451847_0598769 3300041503 Bacteria 578
444 Ga0451843_0033527 3300041509 Bacteria 2351
445 Ga0451843_0818476 3300041509 Bacteria 2380
446 Ga0451843_1251261 3300041509 Bacteria 2245
447 Ga0451853_0966211 3300041512 Bacteria 755
448 Ga0451853_1206899 3300041512 Bacteria 702
449 Ga0439433_0064466 3300041999 Bacteria 877
450 Ga0439433_0109546 3300041999 Bacteria 690
451 Ga0439445_0001427 3300042004 Bacteria 5189
452 Ga0439445_0042401 3300042004 Bacteria 1212
453 Ga0439432_009347 3300042006 Bacteria 3421
454 Ga0439432_031207 3300042006 Bacteria 1724
455 Ga0439432_033157 3300042006 Bacteria 1663
456 Ga0439432_169007 3300042006 Bacteria 638
457 Ga0439449_0000397 3300042007 Bacteria 16116
458 Ga0439449_0002795 3300042007 Bacteria 6781
459 Ga0439449_0003184 3300042007 Bacteria 6395
460 Ga0439449_0007071 3300042007 Bacteria 4274
461 Ga0439449_0031507 3300042007 Bacteria 1976
462 Ga0439449_0059119 3300042007 Bacteria 1415
463 Ga0439449_0101197 3300042007 Bacteria 1065
464 Ga0439449_0103698 3300042007 Bacteria 1052
465 Ga0439449_0284787 3300042007 Bacteria 623
466 Ga0439452_035451 3300042010 Bacteria 1201
467 Ga0439457_064934 3300042014 Bacteria 829
468 Ga0439462_0011239 3300042015 Bacteria 2277
469 Ga0450911_001313 3300042115 Bacteria 5872
470 Ga0450894_008310 3300042131 Bacteria 1342
471 Ga0450898_051691 3300042134 Bacteria 795
472 Ga0450898_079098 3300042134 Bacteria 667
473 Ga0450905_001592 3300042142 Bacteria 2894
474 Ga0450918_065583 3300042531 Bacteria 676
475 Ga0450901_004821 3300042533 Bacteria 1389
476 Ga0451577_0005595 3300042876 Bacteria 12786
477 Ga0439440_0019513 3300042993 Bacteria 1513
478 Ga0466972_0315316 3300044658 Bacteria 731
479 Ga0453684_0333386 3300044712 Bacteria 1715
480 Ga0466967_0369552 3300045976 Bacteria 1391
481 Ga0495627_002530 3300046453 Bacteria 8703
482 Ga0495627_126379 3300046453 Bacteria 720
483 Ga0495638_0000231 3300046460 Bacteria 76477
484 Ga0495638_0019350 3300046460 Bacteria 4504
485 Ga0495638_0181314 3300046460 Bacteria 1201
486 Ga0495638_0183314 3300046460 Bacteria 1193
487 Ga0495650_0132018 3300046471 Bacteria 910
488 Ga0495605_0011245 3300046474 Bacteria 4997
489 Ga0495607_0093207 3300046501 Bacteria 1627
490 Ga0495606_0041634 3300046507 Bacteria 3079
491 Ga0495610_0000242 3300046512 Bacteria 57692
492 Ga0495610_0022452 3300046512 Bacteria 3452
493 Ga0495631_0001336 3300046518 Bacteria 15073
494 Ga0495631_0234769 3300046518 Bacteria 782
495 Ga0495632_0066337 3300046519 Bacteria 1742
496 Ga0495643_0000701 3300046522 Bacteria 38480
497 Ga0495663_0001362 3300046525 Bacteria 7702
498 Ga0495663_0003977 3300046525 Bacteria 4200
499 Ga0495663_0007413 3300046525 Bacteria 3033
500 Ga0495663_0010786 3300046525 Bacteria 2543
501 Ga0495663_0015525 3300046525 Bacteria 2146
502 Ga0495663_0020927 3300046525 Bacteria 1880
503 Ga0495663_0066880 3300046525 Bacteria 1138
504 Ga0495663_0090240 3300046525 Bacteria 998
505 Ga0495663_0220489 3300046525 Bacteria 666
506 Ga0495654_0141416 3300046530 Bacteria 1072
507 Ga0495609_0040483 3300046538 Bacteria 2097
508 Ga0495609_0141699 3300046538 Bacteria 1026
509 Ga0495621_0064087 3300046539 Bacteria 1340
510 Ga0495633_0002603 3300046558 Bacteria 12621
511 Ga0495633_0007084 3300046558 Bacteria 6521
512 Ga0495633_0114800 3300046558 Bacteria 1248
513 Ga0495656_0000725 3300046615 Bacteria 10653
514 Ga0495656_0003229 3300046615 Bacteria 5498
515 Ga0495656_0057305 3300046615 Bacteria 1686
516 Ga0495656_0064229 3300046615 Bacteria 1611
517 Ga0495668_0001500 3300046616 Bacteria 22305
518 Ga0495668_0061339 3300046616 Bacteria 2074
519 Ga0495625_0174766 3300046660 Bacteria 1431
520 Ga0495625_0499185 3300046660 Bacteria 744
521 Ga0495659_0018838 3300046664 Bacteria 2304
522 Ga0495659_0024353 3300046664 Bacteria 2064
523 Ga0495659_0182379 3300046664 Bacteria 855
524 Ga0495670_0072717 3300046691 Bacteria 1742
525 Ga0495670_0200281 3300046691 Bacteria 1057
526 Ga0495670_0740530 3300046691 Bacteria 536
527 Ga0495671_0002713 3300046692 Bacteria 11086
528 Ga0495660_0151864 3300046810 Bacteria 1143
529 Ga0495636_0000850 3300047318 Bacteria 11263
530 Ga0495636_0054635 3300047318 Bacteria 1678
531 Ga0495636_0080216 3300047318 Bacteria 1404
532 Ga0495636_0094429 3300047318 Bacteria 1301
533 Ga0495636_0149047 3300047318 Bacteria 1048
534 Ga0495672_0000092 3300047320 Bacteria 146431
535 Ga0495677_0056861 3300047445 Bacteria 1446
536 Ga0495685_027545 3300047447 Bacteria 1955
537 Ga0495681_0201398 3300047470 Bacteria 807
538 Ga0495681_0364037 3300047470 Bacteria 547
539 Ga0495686_0002273 3300047472 Bacteria 18497
540 Ga0495686_0024577 3300047472 Bacteria 3956
541 Ga0495686_0249485 3300047472 Bacteria 998
542 Ga0495615_0014537 3300048090 Bacteria 1666
543 Ga0496100_0136465 3300048903 Bacteria 1734
544 Ga0496100_0142363 3300048903 Bacteria 1701
545 Ga0496100_0332157 3300048903 Bacteria 1144
546 Ga0496101_0115545 3300048904 Bacteria 2024
547 Ga0496101_0304176 3300048904 Bacteria 1249
548 Ga0496102_0233461 3300048905 Bacteria 1734
549 Ga0496104_0143547 3300048907 Bacteria 2293
550 Ga0496106_0018879 3300048909 Bacteria 5110
551 Ga0496106_0796300 3300048909 Bacteria 750
552 Ga0496107_0024397 3300048910 Bacteria 4278
553 Ga0496108_0138026 3300048911 Bacteria 2099
554 Ga0496108_0253319 3300048911 Bacteria 1532
555 Ga0496109_0084181 3300048912 Bacteria 2933
556 Ga0496109_0309026 3300048912 Bacteria 1491
557 Ga0496109_0749390 3300048912 Bacteria 914
558 Ga0496110_0194140 3300048913 Bacteria 1843
559 Ga0496110_0265740 3300048913 Bacteria 1562
560 Ga0496112_0858063 3300048915 Bacteria 831
561 Ga0496113_0033885 3300048916 Bacteria 3722
562 Ga0496113_0092392 3300048916 Bacteria 2334
563 Ga0496114_0004682 3300048917 Bacteria 10640
564 Ga0496116_0003037 3300048919 Bacteria 16975
565 Ga0496116_0047167 3300048919 Bacteria 2901
566 Ga0496117_0002348 3300048920 Bacteria 24193
567 Ga0496117_0004119 3300048920 Bacteria 16288
568 Ga0496117_0004182 3300048920 Bacteria 16142
569 Ga0496117_0008480 3300048920 Bacteria 9755
570 Ga0496117_0129021 3300048920 Bacteria 1536
571 Ga0496117_0303502 3300048920 Bacteria 844
572 Ga0496118_0003159 3300048921 Bacteria 21056
573 Ga0496118_0004490 3300048921 Bacteria 16520
574 Ga0496118_0004569 3300048921 Bacteria 16301
575 Ga0496118_0025445 3300048921 Bacteria 5075
576 Ga0496118_0027373 3300048921 Bacteria 4826
577 Ga0496118_0031274 3300048921 Bacteria 4417
578 Ga0496118_0032518 3300048921 Bacteria 4295
579 Ga0496118_0093093 3300048921 Bacteria 2066
580 Ga0496118_0136849 3300048921 Bacteria 1561
581 Ga0496119_0000176 3300048922 Bacteria 89501
582 Ga0496119_0001471 3300048922 Bacteria 28191
583 Ga0496119_0066333 3300048922 Bacteria 2133
584 Ga0496120_0000277 3300048923 Bacteria 85951
585 Ga0496120_0003247 3300048923 Bacteria 15046
586 Ga0496121_0008895 3300048924 Bacteria 11667
587 Ga0496121_0010562 3300048924 Bacteria 10384
588 Ga0496121_0046062 3300048924 Bacteria 3737
589 Ga0496121_0060547 3300048924 Bacteria 3113
590 Ga0496122_0000144 3300048925 Bacteria 166503
591 Ga0496122_0003749 3300048925 Bacteria 19606
592 Ga0496122_0008640 3300048925 Bacteria 10930
593 Ga0496122_0009056 3300048925 Bacteria 10565
594 Ga0496122_0014795 3300048925 Bacteria 7517
595 Ga0496122_0020337 3300048925 Bacteria 6003
596 Ga0496122_0073409 3300048925 Bacteria 2425
597 Ga0496122_0076587 3300048925 Bacteria 2353
598 Ga0496122_0241953 3300048925 Bacteria 1016
599 Ga0496123_0000665 3300048926 Bacteria 56849
600 Ga0496123_0001387 3300048926 Bacteria 33973
601 Ga0496123_0010195 3300048926 Bacteria 8339
602 Ga0496123_0023413 3300048926 Bacteria 4727
603 Ga0496123_0046011 3300048926 Bacteria 2964
604 Ga0496123_0060932 3300048926 Bacteria 2429
605 Ga0496123_0195517 3300048926 Bacteria 1042
606 Ga0496124_0000020 3300048927 Bacteria 434107
607 Ga0496124_0001413 3300048927 Bacteria 35745
608 Ga0496124_0001960 3300048927 Bacteria 28118
609 Ga0496124_0005910 3300048927 Bacteria 13543
610 Ga0496124_0015555 3300048927 Bacteria 7285
611 Ga0496124_0020487 3300048927 Bacteria 6108
612 Ga0496124_0021623 3300048927 Bacteria 5925
613 Ga0496124_0116272 3300048927 Bacteria 2144
614 Ga0496124_0188697 3300048927 Bacteria 1579
615 Ga0496124_0228072 3300048927 Bacteria 1395
616 Ga0496124_0371223 3300048927 Bacteria 1004
617 Ga0496125_0001174 3300048928 Bacteria 39666
618 Ga0496125_0006187 3300048928 Bacteria 13037
619 Ga0496125_0012715 3300048928 Bacteria 8328
620 Ga0496125_0030967 3300048928 Bacteria 4777
621 Ga0496125_0079723 3300048928 Bacteria 2510
622 Ga0496125_0105459 3300048928 Bacteria 2060
623 Ga0496125_0299195 3300048928 Bacteria 986
624 Ga0496125_0437111 3300048928 Bacteria 753
625 Ga0496126_0008940 3300048929 Bacteria 10727
626 Ga0496126_0048096 3300048929 Bacteria 3901
627 Ga0496126_0059449 3300048929 Bacteria 3442
628 Ga0496126_0145910 3300048929 Bacteria 2032
629 Ga0496126_0229726 3300048929 Bacteria 1555
630 Ga0496126_0231035 3300048929 Bacteria 1550
631 Ga0496126_0817728 3300048929 Bacteria 713
632 Ga0496126_0817785 3300048929 Bacteria 713
633 Ga0501290_004964 3300049513 Bacteria 1661
634 Ga0501300_005594 3300049523 Bacteria 1850
635 Ga0501031_0007657 3300049568 Bacteria 7028
636 Ga0501031_0074716 3300049568 Bacteria 2207
637 Ga0501031_0232126 3300049568 Bacteria 1200
638 Ga0501032_0019427 3300049569 Bacteria 4754
639 Ga0501032_0134917 3300049569 Bacteria 1627
640 Ga0501033_0001420 3300049570 Bacteria 21266
641 Ga0501033_0029300 3300049570 Bacteria 4137
642 Ga0501033_0154439 3300049570 Bacteria 1654
643 Ga0501033_0302562 3300049570 Bacteria 1125
644 Ga0501034_0000367 3300049571 Bacteria 76895
645 Ga0501034_0000798 3300049571 Bacteria 46906
646 Ga0501034_0002483 3300049571 Bacteria 22159
647 Ga0501034_0014196 3300049571 Bacteria 8210
648 Ga0501034_0034412 3300049571 Bacteria 5135
649 Ga0501034_0485734 3300049571 Bacteria 1150
650 Ga0501034_0586523 3300049571 Bacteria 1021
651 Ga0501034_0616366 3300049571 Bacteria 989
652 Ga0501036_0003765 3300049572 Bacteria 12156
653 Ga0501036_0378351 3300049572 Bacteria 1182
654 Ga0501036_0561336 3300049572 Bacteria 948
655 Ga0501037_0003115 3300049573 Bacteria 12021
656 Ga0501037_0118874 3300049573 Bacteria 1901
657 Ga0501037_0180287 3300049573 Bacteria 1499
658 Ga0501037_0193849 3300049573 Bacteria 1438
659 Ga0501038_0000610 3300049574 Bacteria 31817
660 Ga0501038_0022312 3300049574 Bacteria 5675
661 Ga0501039_0015127 3300049575 Bacteria 5903
662 Ga0501039_0327895 3300049575 Bacteria 1203
663 Ga0501043_0003950 3300049579 Bacteria 12160
664 Ga0501043_0005273 3300049579 Bacteria 10448
665 Ga0501046_0596660 3300049580 Bacteria 784
666 Ga0501047_0032812 3300049581 Bacteria 5013
667 Ga0501047_0070906 3300049581 Bacteria 3354
668 Ga0501047_0503870 3300049581 Bacteria 1037
669 Ga0501067_0492754 3300049583 Bacteria 685
670 Ga0501069_0048200 3300049585 Bacteria 2365
671 Ga0501069_0067919 3300049585 Bacteria 1994
672 Ga0501069_0478980 3300049585 Bacteria 741
673 Ga0501070_0015328 3300049586 Bacteria 6449
674 Ga0501070_0018010 3300049586 Bacteria 5926
675 Ga0501070_0051642 3300049586 Bacteria 3413
676 Ga0501070_0171477 3300049586 Bacteria 1787
677 Ga0501071_0015686 3300049587 Bacteria 5203
678 Ga0501073_0008696 3300049589 Bacteria 7518
679 Ga0501073_0139904 3300049589 Bacteria 1677
680 Ga0501074_0009659 3300049590 Bacteria 7002
681 Ga0501074_0032514 3300049590 Bacteria 3779
682 Ga0501202_027857 3300049652 Bacteria 1163
683 Ga0501202_063332 3300049652 Bacteria 840
684 Ga0501238_032312 3300049671 Bacteria 759
685 Ga0501240_068913 3300049673 Bacteria 637
686 Ga0501257_083595 3300049686 Bacteria 825
687 Ga0501258_054904 3300049687 Bacteria 564
688 Ga0501225_0008942 3300049705 Bacteria 2866
689 Ga0501079_0118427 3300049741 Bacteria 2059
690 Ga0501079_0148072 3300049741 Bacteria 1830
691 Ga0501080_0005331 3300049742 Bacteria 11457
692 Ga0501080_0005548 3300049742 Bacteria 11267
693 Ga0501080_0024487 3300049742 Bacteria 5594
694 Ga0501263_018100 3300049760 Bacteria 930
695 Ga0501266_014097 3300049763 Bacteria 1045
696 Ga0501270_014135 3300049767 Bacteria 1118
697 Ga0501270_030383 3300049767 Bacteria 888
698 Ga0501274_032573 3300049771 Bacteria 595
699 Ga0501275_000092 3300049772 Bacteria 9192
700 Ga0501279_040058 3300049775 Bacteria 717
701 Ga0501280_055492 3300049776 Bacteria 677
702 Ga0501035_0000992 3300049822 Bacteria 29984
703 Ga0501035_0002406 3300049822 Bacteria 18342
704 Ga0501035_0064630 3300049822 Bacteria 3251
705 Ga0501035_0356685 3300049822 Bacteria 1222
706 Ga0501044_0002382 3300049823 Bacteria 21418
707 Ga0501044_0003326 3300049823 Bacteria 18120
708 Ga0501044_0101121 3300049823 Bacteria 2900
709 Ga0501044_0191042 3300049823 Bacteria 2010
710 Ga0501044_1547779 3300049823 Bacteria 528
711 nmdc:mga03683_194673_c1 3300050489 Bacteria 928
712 nmdc:mga00v17_680_c1 3300050491 Bacteria 18694
713 Ga0500577_0041736 3300053142 Bacteria 1675
714 Ga0500634_0000117 3300053161 Bacteria 29635
715 Ga0500609_018035 3300053731 Bacteria 960
716 2572255764 2571042365 Bacteria 3289345
717 2574429127 2574179768 Bacteria 4907129
718 2578459988 2576861471 Bacteria 4648976
719 2643817083 2643221559 Bacteria 4424915
720 2643879649 2643221573 Bacteria 4784121
721 2643906531 2643221579 Bacteria 4443405
722 2643913961 2643221581 Bacteria 3893603
723 2643939599 2643221586 Bacteria 4446529
724 2643976527 2643221593 Bacteria 6296053
725 2644080469 2643221612 Bacteria 4361984
726 2644530869 2643221695 Bacteria 3441323
727 2644663311 2643221720 Bacteria 4694283
728 2644696577 2643221727 Bacteria 4415595
729 2644701190 2643221728 Bacteria 4797149
730 2747950168 2747842428 Bacteria 4689383
731 2748019908 2747842501 Bacteria 5293829
732 2765577276 2765235840 Bacteria 4663337
733 2816519917 2816332141 Bacteria 4436036
734 2819663216 2818991457 Bacteria 5323295
735 2842394658 2842391507 Bacteria 4486072
736 2842760819 2842757796 Bacteria 3981385
737 2842784493 2842780639 Bacteria 4337790
738 2848699904 2848694841 Bacteria 9205737
739 2852652559 2852649853 Bacteria 4036942
740 2852689210 2852684882 Bacteria 5463342
741 2857445574 2857442823 Bacteria 4562550
742 2874223810 2874220319 Bacteria 4594709
743 2894417591 2894414249 Bacteria 4405451
744 2895502940 2895498888 Bacteria 5283788
745 2895512979 2895511927 Bacteria 6802080
746 2895522991 2895522137 Bacteria 3284416
747 2895526886 2895525241 Bacteria 3388457
748 2919090268 2919089067 Bacteria 4560942
749 2919133045 2919130084 Bacteria 5301837
750 2919138422 2919134579 Bacteria 4480386
751 2919513869 2919513703 Bacteria 3844312
752 2919678696 2919675420 Bacteria 3969095
753 2923516428 2923516293 Bacteria 3716336
754 2928498219 2928496128 Bacteria 4631123
755 2929195905 2929195423 Bacteria 5325372
756 2931382436 2931380184 Bacteria 4455911
757 2937613718 2937610967 Bacteria 4618818
758 2939593066 2939589442 Bacteria 4214238
759 2939626215 2939622612 Bacteria 4698046
760 2939627834 2939626828 Bacteria 4695272
761 2941479648 2941475908 Bacteria 4145589
762 2941493950 2941489479 Bacteria 6313767
763 2961050574 2961047084 Bacteria 4594415
764 2961065751 2961064222 Bacteria 4749990
765 2974310418 2974307012 Bacteria 4172388
766 2977251150 2977247770 Bacteria 4160543
767 2987605785 2987605356 Bacteria 4187822
768 2995953818 2995948881 Bacteria 6358104
769 8002870874 8002869464 Bacteria 3588529
770 8003017378 8003014200 Bacteria 4059994
771 8021623163 8021622325 Bacteria 4844743
772 8021629731 8021626552 Bacteria 4665214
773 8021648984 8021648035 Bacteria 4772378
774 Ga0182008_10073786
775 SwRhRL2b_contig_1735385
776 SwRhRL2b_contig_3057749
777 JGI24736J21556_1006444
778 JGI24741J21665_1000902
779 JGI24740J21852_10013378
780 JGI25152J39213_1000076
781 JGI25150J39212_1000530
782 JGI25151J46595_10000231
783 JGI25151J46595_10013068
784 JGI25153J46596_10000166
785 rootH2_10011547
786 Ga0055526_1000107
787 Ga0055526_1006559
788 Ga0055526_1006992
789 Ga0055537_1000147
790 Ga0055537_1000299
791 Ga0055524_1000176
792 Ga0055524_1015049
793 Ga0055536_1001750
794 Ga0055536_1002416
795 Ga0055536_1004645
796 Ga0055536_1012468
797 Ga0055536_1022961
798 Ga0055534_1000090
799 Ga0055534_1000322
800 Ga0055534_1000837
801 Ga0055528_1000088
802 Ga0055528_1000194
803 Ga0055530_10001839
804 Ga0055530_10002248
805 Ga0055530_10002449
806 Ga0055540_1016642
807 Ga0055531_10003516
808 Ga0055531_10008428
809 Ga0058692_1000005
810 Ga0058692_1000021
811 Ga0065714_10108158
812 Ga0065704_10071322
813 Ga0065704_10187846
814 Ga0065715_10031725
815 Ga0065715_10111242
816 Ga0065715_10218496
817 Ga0065715_10260000
818 Ga0065715_10392576
819 Ga0070658_10065811
820 Ga0070683_100765709
821 Ga0070683_100833271
822 Ga0070670_100032140
823 Ga0070670_100579330
824 Ga0070670_100835604
825 Ga0070677_10229757
826 Ga0070677_10729348
827 Ga0070666_10800520
828 Ga0070680_100844357
829 Ga0070680_100965773
830 Ga0070682_100091334
831 Ga0070660_100017200
832 Ga0070660_100213612
833 Ga0070689_101464279
834 Ga0070661_100192569
835 Ga0070661_100830832
836 Ga0070668_100017205
837 Ga0070668_100082220
838 Ga0070668_100559441
839 Ga0070669_100374018
840 Ga0070675_100222296
841 Ga0070671_100061411
842 Ga0070671_100116693
843 Ga0070671_100753266
844 Ga0070674_100245789
845 Ga0070674_100987612
846 Ga0070673_100102802
847 Ga0070659_100081947
848 Ga0070659_100740290
849 Ga0070667_100314501
850 Ga0070667_101376530
851 Ga0070701_10378711
852 Ga0070663_100113960
853 Ga0070663_100673681
854 Ga0070678_100040771
855 Ga0070681_10398300
856 Ga0070681_10886440
857 Ga0068867_100051053
858 Ga0070679_100193708
859 Ga0068853_100395029
860 Ga0070672_100171919
861 Ga0070696_100093329
862 Ga0070693_100001019
863 Ga0070665_100238917
864 Ga0068855_101532279
865 Ga0070664_100007922
866 Ga0070664_100065343
867 Ga0068857_101036706
868 Ga0068854_100823886
869 Ga0068852_100012784
870 Ga0068852_101215047
871 Ga0068859_100618195
872 Ga0068861_100237731
873 Ga0068861_100289575
874 Ga0068851_10134654
875 Ga0068870_10944277
876 Ga0068863_101294799
877 Ga0068862_101251349
878 Ga0081539_10016629
879 Ga0075364_10173314
880 Ga0075364_10300602
881 Ga0075362_10222707
882 Ga0097620_100618191
883 Ga0079104_1111531
884 Ga0105251_10000014
885 Ga0105251_10002449
886 Ga0105244_10065862
887 Ga0105240_10072642
888 Ga0105240_10208081
889 Ga0105243_10003907
890 Ga0105243_10022428
891 Ga0105243_10037668
892 Ga0105242_10108908
893 Ga0105248_10407810
894 Ga0105248_10919564
895 Ga0105248_13353722
896 Ga0105032_102531
897 Ga0105246_10280278
898 Ga0157318_1000725
899 Ga0157322_1011021
900 Ga0157316_1000454
901 Ga0157327_1000792
902 Ga0157327_1019029
903 Ga0154019_129338
904 Ga0157373_10022336
905 Ga0157373_10268713
906 Ga0157373_10800651
907 Ga0157371_10003036
908 Ga0157371_10018618
909 Ga0157371_10117669
910 Ga0157371_11033775
911 Ga0157371_11034349
912 Ga0157370_10090271
913 Ga0157370_10110821
914 Ga0157370_10147983
915 Ga0157369_10165624
916 Ga0157369_10314518
917 Ga0163162_10875449
918 Ga0163162_10930318
919 Ga0157372_10074997
920 Ga0157372_10351287
921 Ga0157375_10619585
922 Ga0157380_10355758
923 Ga0157380_10397465
924 Ga0157380_10418061
925 Ga0182008_10004347
926 Ga0182008_10116459
927 Ga0182008_10204165
928 Ga0182006_1023345
929 Ga0182006_1029292
930 Ga0182006_1035632
931 Ga0182006_1046573
932 Ga0182006_1057926
933 Ga0182007_10000500
934 Ga0182005_1000186
935 Ga0182005_1028194
936 Ga0183360_10004
937 Ga0183361_10143
938 Ga0163161_10309616
939 Ga0163161_10380784
940 Ga0163161_10602251
941 Ga0206356_11710452
942 Ga0206351_10226310
943 Ga0206350_11473204
944 Ga0206354_10337747
945 Ga0206353_10206423
946 Ga0206353_10721119
947 Ga0206353_10726987
948 Ga0154015_1073503
949 Ga0207425_1000029
950 Ga0209129_1000216
951 Ga0209565_1000002
952 Ga0209565_1000071
953 Ga0209565_1006967
954 Ga0209673_1000002
955 Ga0209673_1001159
956 Ga0209673_1005118
957 Ga0209130_1023919
958 Ga0209130_1024273
959 Ga0209675_1000002
960 Ga0209675_1000018
961 Ga0209675_1003998
962 Ga0209675_1004010
963 Ga0209676_1000035
964 Ga0209676_1000185
965 Ga0209676_1000248
966 Ga0209676_1001632
967 Ga0209676_1002505
968 Ga0209676_1003269
969 Ga0209676_1004137
970 Ga0209676_1004879
971 Ga0209676_1015746
972 Ga0209025_1000076
973 Ga0209025_1002264
974 Ga0209025_1003682
975 Ga0209025_1046408
976 Ga0209564_1000004
977 Ga0209564_1000148
978 Ga0209564_1016519
979 Ga0209758_1000473
980 Ga0209758_1029718
981 Ga0209050_1000182
982 Ga0209050_1000865
983 Ga0209050_1000896
984 Ga0209050_1006684
985 Ga0209050_1021068
986 Ga0209256_1000004
987 Ga0209256_1002608
988 Ga0209256_1004525
989 Ga0209256_1004737
990 Ga0209256_1008272
991 Ga0209256_1020379
992 Ga0207426_1063551
993 Ga0209051_1001212
994 Ga0209051_1023573
995 Ga0209257_1000154
996 Ga0209257_1000348
997 Ga0209257_1000470
998 Ga0209257_1000611
999 Ga0209257_1001025
1000 Ga0209257_1002151
1001 Ga0209257_1002742
1002 Ga0209257_1002838
1003 Ga0209257_1003916
1004 Ga0209257_1021017
1005 Ga0207656_10048365
1006 Ga0207655_1088582
1007 Ga0207713_1000290
1008 Ga0207713_1007313
1009 Ga0207682_10105183
1010 Ga0207682_10122292
1011 Ga0207647_10000890
1012 Ga0207643_10185001
1013 Ga0207705_10002475
1014 Ga0207705_10010051
1015 Ga0207705_10161744
1016 Ga0207707_10001264
1017 Ga0207707_10003347
1018 Ga0207707_10453110
1019 Ga0207695_10006903
1020 Ga0207695_10011668
1021 Ga0207660_10009796
1022 Ga0207660_10010767
1023 Ga0207660_10562083
1024 Ga0207662_10290782
1025 Ga0207657_10051651
1026 Ga0207657_10699508
1027 Ga0207649_10003122
1028 Ga0207652_10001254
1029 Ga0207652_10003823
1030 Ga0207681_10028705
1031 Ga0207681_10144850
1032 Ga0207650_10325159
1033 Ga0207659_10122478
1034 Ga0207644_10036484
1035 Ga0207644_10042516
1036 Ga0207644_10218122
1037 Ga0207644_10323305
1038 Ga0207690_10036274
1039 Ga0207709_10001022
1040 Ga0207709_10002288
1041 Ga0207709_10161677
1042 Ga0207669_10245256
1043 Ga0207669_10611396
1044 Ga0207691_10007261
1045 Ga0207691_10128498
1046 Ga0207711_11017361
1047 Ga0207711_11269628
1048 Ga0207661_10011573
1049 Ga0207679_10034352
1050 Ga0207679_10367417
1051 Ga0207679_10974384
1052 Ga0207679_11410404
1053 Ga0207667_10036564
1054 Ga0207667_10435844
1055 Ga0207651_10150870
1056 Ga0207651_11039770
1057 Ga0207668_10002517
1058 Ga0207668_10589693
1059 Ga0207640_10476289
1060 Ga0207658_10159626
1061 Ga0207639_10001300
1062 Ga0207678_10778947
1063 Ga0207702_10004226
1064 Ga0207648_10048102
1065 Ga0207676_11025218
1066 Ga0207674_10933704
1067 Ga0207675_100178501
1068 Ga0207675_100193144
1069 Ga0207675_100269526
1070 Ga0207683_10053759
1071 Ga0207683_10183061
1072 Ga0207698_10000835
1073 Ga0207698_10328092
1074 Ga0209371_1000031
1075 Ga0209371_1000045
1076 Ga0209999_1031017
1077 Ga0209982_1002311
1078 Ga0210002_1027152
1079 Ga0209983_1001352
1080 Ga0209971_1000880
1081 Ga0209974_10117793
1082 Ga0209974_10278191
1083 Ga0268266_10015106
1084 Ga0268266_10065663
1085 Ga0268266_10153289
1086 Ga0268265_11349322
1087 Ga0307515_10306778
1088 Ga0268256_1000034
1089 Ga0268256_1000047
1090 Ga0316177_1065610
1091 Ga0316176_1173906
1092 Ga0314311_1089126
1093 Ga0316181_1125246
1094 Ga0316182_1011388
1095 Ga0307513_10008176
1096 Ga0307513_10114462
1097 Ga0307513_10233009
1098 Ga0307509_10000566
1099 Ga0307408_100025339
1100 Ga0307408_100129644
1101 Ga0307408_100577117
1102 Ga0307408_100794203
1103 Ga0307408_101096401
1104 Ga0307405_10109363
1105 Ga0307405_10357418
1106 Ga0307405_10554793
1107 Ga0307413_10012467
1108 Ga0307413_10173591
1109 Ga0307413_10233368
1110 Ga0307413_10496821
1111 Ga0307413_10673485
1112 Ga0307413_10679676
1113 Ga0307410_10056716
1114 Ga0307410_10576654
1115 Ga0307410_10867676
1116 Ga0307410_10916808
1117 Ga0307406_10016668
1118 Ga0307406_10017565
1119 Ga0307406_10088204
1120 Ga0307407_10278344
1121 Ga0307407_10641623
1122 Ga0307412_10001099
1123 Ga0307412_10213123
1124 Ga0307412_10978919
1125 Ga0307412_11944044
1126 Ga0307409_100273287
1127 Ga0307416_100519871
1128 Ga0307416_100586486
1129 Ga0307414_10004133
1130 Ga0307414_10007643
1131 Ga0307414_10018313
1132 Ga0307414_10061238
1133 Ga0307414_10064446
1134 Ga0307414_10099940
1135 Ga0307414_10101031
1136 Ga0307414_10143525
1137 Ga0307414_10167432
1138 Ga0307414_10169330
1139 Ga0307414_10208240
1140 Ga0307414_10247937
1141 Ga0307414_10277569
1142 Ga0307414_10284792
1143 Ga0307414_10306313
1144 Ga0307414_10385489
1145 Ga0307414_10425236
1146 Ga0307414_11415311
1147 Ga0307411_10103182
1148 Ga0307411_10139037
1149 Ga0307411_10142218
1150 Ga0307411_10221821
1151 Ga0307411_10234605
1152 Ga0307411_10498920
1153 Ga0307411_11402249
1154 Ga0307411_12043738
1155 Ga0307415_100455479
1156 Ga0307415_100580651
1157 Ga0307415_101277245
1158 Ga0307415_101745220
1159 Ga0316584_0202741
1160 Ga0395899_0034263
1161 Ga0395899_0338679
1162 Ga0395900_0158839
1163 Ga0395898_0177422
1164 Ga0395905_0002323
1165 Ga0395905_0126074
1166 Ga0395905_0130312
1167 Ga0395905_0256919
1168 Ga0395905_0709179
1169 Ga0395901_0142130
1170 Ga0237819_01020
1171 Ga0439436_0005257
1172 Ga0439436_0006797
1173 Ga0439436_0014468
1174 Ga0439436_0027328
1175 Ga0439436_0028860
1176 Ga0439436_0036701
1177 Ga0439439_0001752
1178 Ga0439439_0114542
1179 Ga0439447_002949
1180 Ga0439461_0003662
1181 Ga0439466_0086037
1182 Ga0439465_0003842
1183 Ga0439465_0004300
1184 Ga0439465_0088744
1185 Ga0451789_0367235
1186 Ga0451789_0389000
1187 Ga0451791_0110578
1188 Ga0451791_0632881
1189 Ga0451791_0885769
1190 Ga0451793_0890414
1191 Ga0451793_1101108
1192 Ga0451793_1895117
1193 Ga0451797_0247115
1194 Ga0451797_0262733
1195 Ga0451797_0426620
1196 Ga0451797_1530440
1197 Ga0451795_0392750
1198 Ga0451798_0529292
1199 Ga0451800_0938602
1200 Ga0451802_0958836
1201 Ga0451802_1048206
1202 Ga0451802_1116100
1203 Ga0451806_374272
1204 Ga0451807_0122575
1205 Ga0451807_0838424
1206 Ga0451807_1303316
1207 Ga0451833_0129506
1208 Ga0451833_0262464
1209 Ga0451833_0948954
1210 Ga0451837_0080165
1211 Ga0451837_0404346
1212 Ga0451837_1000932
1213 Ga0451837_1144477
1214 Ga0451837_1541278
1215 Ga0451841_0575958
1216 Ga0451847_0598769
1217 Ga0451843_0033527
1218 Ga0451843_0818476
1219 Ga0451843_1251261
1220 Ga0451853_0966211
1221 Ga0451853_1206899
1222 Ga0439433_0064466
1223 Ga0439433_0109546
1224 Ga0439445_0001427
1225 Ga0439445_0042401
1226 Ga0439432_009347
1227 Ga0439432_031207
1228 Ga0439432_033157
1229 Ga0439432_169007
1230 Ga0439449_0000397
1231 Ga0439449_0002795
1232 Ga0439449_0003184
1233 Ga0439449_0007071
1234 Ga0439449_0031507
1235 Ga0439449_0059119
1236 Ga0439449_0101197
1237 Ga0439449_0103698
1238 Ga0439449_0284787
1239 Ga0439452_035451
1240 Ga0439457_064934
1241 Ga0439462_0011239
1242 Ga0450911_001313
1243 Ga0450894_008310
1244 Ga0450898_051691
1245 Ga0450898_079098
1246 Ga0450905_001592
1247 Ga0450918_065583
1248 Ga0450901_004821
1249 Ga0451577_0005595
1250 Ga0439440_0019513
1251 Ga0466972_0315316
1252 Ga0453684_0333386
1253 Ga0466967_0369552
1254 Ga0495627_002530
1255 Ga0495627_126379
1256 Ga0495638_0000231
1257 Ga0495638_0019350
1258 Ga0495638_0181314
1259 Ga0495638_0183314
1260 Ga0495650_0132018
1261 Ga0495605_0011245
1262 Ga0495607_0093207
1263 Ga0495606_0041634
1264 Ga0495610_0000242
1265 Ga0495610_0022452
1266 Ga0495631_0001336
1267 Ga0495631_0234769
1268 Ga0495632_0066337
1269 Ga0495643_0000701
1270 Ga0495663_0001362
1271 Ga0495663_0003977
1272 Ga0495663_0007413
1273 Ga0495663_0010786
1274 Ga0495663_0015525
1275 Ga0495663_0020927
1276 Ga0495663_0066880
1277 Ga0495663_0090240
1278 Ga0495663_0220489
1279 Ga0495654_0141416
1280 Ga0495609_0040483
1281 Ga0495609_0141699
1282 Ga0495621_0064087
1283 Ga0495633_0002603
1284 Ga0495633_0007084
1285 Ga0495633_0114800
1286 Ga0495656_0000725
1287 Ga0495656_0003229
1288 Ga0495656_0057305
1289 Ga0495656_0064229
1290 Ga0495668_0001500
1291 Ga0495668_0061339
1292 Ga0495625_0174766
1293 Ga0495625_0499185
1294 Ga0495659_0018838
1295 Ga0495659_0024353
1296 Ga0495659_0182379
1297 Ga0495670_0072717
1298 Ga0495670_0200281
1299 Ga0495670_0740530
1300 Ga0495671_0002713
1301 Ga0495660_0151864
1302 Ga0495636_0000850
1303 Ga0495636_0054635
1304 Ga0495636_0080216
1305 Ga0495636_0094429
1306 Ga0495636_0149047
1307 Ga0495672_0000092
1308 Ga0495677_0056861
1309 Ga0495685_027545
1310 Ga0495681_0201398
1311 Ga0495681_0364037
1312 Ga0495686_0002273
1313 Ga0495686_0024577
1314 Ga0495686_0249485
1315 Ga0495615_0014537
1316 Ga0496100_0136465
1317 Ga0496100_0142363
1318 Ga0496100_0332157
1319 Ga0496101_0115545
1320 Ga0496101_0304176
1321 Ga0496102_0233461
1322 Ga0496104_0143547
1323 Ga0496106_0018879
1324 Ga0496106_0796300
1325 Ga0496107_0024397
1326 Ga0496108_0138026
1327 Ga0496108_0253319
1328 Ga0496109_0084181
1329 Ga0496109_0309026
1330 Ga0496109_0749390
1331 Ga0496110_0194140
1332 Ga0496110_0265740
1333 Ga0496112_0858063
1334 Ga0496113_0033885
1335 Ga0496113_0092392
1336 Ga0496114_0004682
1337 Ga0496116_0003037
1338 Ga0496116_0047167
1339 Ga0496117_0002348
1340 Ga0496117_0004119
1341 Ga0496117_0004182
1342 Ga0496117_0008480
1343 Ga0496117_0129021
1344 Ga0496117_0303502
1345 Ga0496118_0003159
1346 Ga0496118_0004490
1347 Ga0496118_0004569
1348 Ga0496118_0025445
1349 Ga0496118_0027373
1350 Ga0496118_0031274
1351 Ga0496118_0032518
1352 Ga0496118_0093093
1353 Ga0496118_0136849
1354 Ga0496119_0000176
1355 Ga0496119_0001471
1356 Ga0496119_0066333
1357 Ga0496120_0000277
1358 Ga0496120_0003247
1359 Ga0496121_0008895
1360 Ga0496121_0010562
1361 Ga0496121_0046062
1362 Ga0496121_0060547
1363 Ga0496122_0000144
1364 Ga0496122_0003749
1365 Ga0496122_0008640
1366 Ga0496122_0009056
1367 Ga0496122_0014795
1368 Ga0496122_0020337
1369 Ga0496122_0073409
1370 Ga0496122_0076587
1371 Ga0496122_0241953
1372 Ga0496123_0000665
1373 Ga0496123_0001387
1374 Ga0496123_0010195
1375 Ga0496123_0023413
1376 Ga0496123_0046011
1377 Ga0496123_0060932
1378 Ga0496123_0195517
1379 Ga0496124_0000020
1380 Ga0496124_0001413
1381 Ga0496124_0001960
1382 Ga0496124_0005910
1383 Ga0496124_0015555
1384 Ga0496124_0020487
1385 Ga0496124_0021623
1386 Ga0496124_0116272
1387 Ga0496124_0188697
1388 Ga0496124_0228072
1389 Ga0496124_0371223
1390 Ga0496125_0001174
1391 Ga0496125_0006187
1392 Ga0496125_0012715
1393 Ga0496125_0030967
1394 Ga0496125_0079723
1395 Ga0496125_0105459
1396 Ga0496125_0299195
1397 Ga0496125_0437111
1398 Ga0496126_0008940
1399 Ga0496126_0048096
1400 Ga0496126_0059449
1401 Ga0496126_0145910
1402 Ga0496126_0229726
1403 Ga0496126_0231035
1404 Ga0496126_0817728
1405 Ga0496126_0817785
1406 Ga0501290_004964
1407 Ga0501300_005594
1408 Ga0501031_0007657
1409 Ga0501031_0074716
1410 Ga0501031_0232126
1411 Ga0501032_0019427
1412 Ga0501032_0134917
1413 Ga0501033_0001420
1414 Ga0501033_0029300
1415 Ga0501033_0154439
1416 Ga0501033_0302562
1417 Ga0501034_0000367
1418 Ga0501034_0000798
1419 Ga0501034_0002483
1420 Ga0501034_0014196
1421 Ga0501034_0034412
1422 Ga0501034_0485734
1423 Ga0501034_0586523
1424 Ga0501034_0616366
1425 Ga0501036_0003765
1426 Ga0501036_0378351
1427 Ga0501036_0561336
1428 Ga0501037_0003115
1429 Ga0501037_0118874
1430 Ga0501037_0180287
1431 Ga0501037_0193849
1432 Ga0501038_0000610
1433 Ga0501038_0022312
1434 Ga0501039_0015127
1435 Ga0501039_0327895
1436 Ga0501043_0003950
1437 Ga0501043_0005273
1438 Ga0501046_0596660
1439 Ga0501047_0032812
1440 Ga0501047_0070906
1441 Ga0501047_0503870
1442 Ga0501067_0492754
1443 Ga0501069_0048200
1444 Ga0501069_0067919
1445 Ga0501069_0478980
1446 Ga0501070_0015328
1447 Ga0501070_0018010
1448 Ga0501070_0051642
1449 Ga0501070_0171477
1450 Ga0501071_0015686
1451 Ga0501073_0008696
1452 Ga0501073_0139904
1453 Ga0501074_0009659
1454 Ga0501074_0032514
1455 Ga0501202_027857
1456 Ga0501202_063332
1457 Ga0501238_032312
1458 Ga0501240_068913
1459 Ga0501257_083595
1460 Ga0501258_054904
1461 Ga0501225_0008942
1462 Ga0501079_0118427
1463 Ga0501079_0148072
1464 Ga0501080_0005331
1465 Ga0501080_0005548
1466 Ga0501080_0024487
1467 Ga0501263_018100
1468 Ga0501266_014097
1469 Ga0501270_014135
1470 Ga0501270_030383
1471 Ga0501274_032573
1472 Ga0501275_000092
1473 Ga0501279_040058
1474 Ga0501280_055492
1475 Ga0501035_0000992
1476 Ga0501035_0002406
1477 Ga0501035_0064630
1478 Ga0501035_0356685
1479 Ga0501044_0002382
1480 Ga0501044_0003326
1481 Ga0501044_0101121
1482 Ga0501044_0191042
1483 Ga0501044_1547779
1484 nmdc:mga03683_194673_c1
1485 nmdc:mga00v17_680_c1
1486 Ga0500577_0041736
1487 Ga0500634_0000117
1488 Ga0500609_018035
1489 2572255764
1490 2574429127
1491 2578459988
1492 2643817083
1493 2643879649
1494 2643906531
1495 2643913961
1496 2643939599
1497 2643976527
1498 2644080469
1499 2644530869
1500 2644663311
1501 2644696577
1502 2644701190
1503 2747950168
1504 2748019908
1505 2765577276
1506 2816519917
1507 2819663216
1508 2842394658
1509 2842760819
1510 2842784493
1511 2848699904
1512 2852652559
1513 2852689210
1514 2857445574
1515 2874223810
1516 2894417591
1517 2895502940
1518 2895512979
1519 2895522991
1520 2895526886
1521 2919090268
1522 2919133045
1523 2919138422
1524 2919513869
1525 2919678696
1526 2923516428
1527 2928498219
1528 2929195905
1529 2931382436
1530 2937613718
1531 2939593066
1532 2939626215
1533 2939627834
1534 2941479648
1535 2941493950
1536 2961050574
1537 2961065751
1538 2974310418
1539 2977251150
1540 2987605785
1541 2995953818
1542 8002870874
1543 8003017378
1544 8021623163
1545 8021629731
1546 8021648984

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

44

178

0.95

PF22769

DCD

dCTP deaminase-like

59

152

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dup-assembly1.cif.gz_A deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) 0.9518 3 138
3tqz-assembly1.cif.gz_A structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii 0.9497 3 139
1rnj-assembly1.cif.gz_A crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp 0.9464 3 138
6mai-assembly1.cif.gz_A crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 0.9455 5 140
1dup-assembly1.cif.gz_A deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) 0.9451 3 138
ID Description Score Start End Superfamily
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9522 4 139 2.70.40.10
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9388 4 139 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9168 4 138 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9101 4 138 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9043 6 139 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A447QL67-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9832 3 125 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A534E2N6-F1-model_v4 deleted 0.9819 16 121
AF-A0A659QLR3-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9815 5 109 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A661CKF5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9813 6 129 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A259EVG0-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9807 5 121 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map