F480076

General Info

Members Datasets Scaffolds Average Seq Length
771 265 1542 166

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10635690|Ga0114129_106356901
Length 182
Sequence MSVLSVTPVTHSQVELAVQQKRFQIIGLILTMVYAAAIVWLYGTEPRSFEEMATGAQVAAGTYQVDQEKFNAALALFRREQFRAARDEWQRADPAQKDPTTQFYIAYAFYREGWGRLYNDQNLFKQGLEPVNRAIALAPGSLTIPDENLQLHTATELKAELEQGTERTWSDLNPFKVFRTRK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
217 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
220 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
227 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
228 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
229 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
235 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
241 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
242 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
243 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
244 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
247 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
250 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
251 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
254 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 29.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10635690 3300009147 Bacteria 1379
2 JGI24748J21848_1000009 3300002074 Bacteria 178563
3 JGI24034J26672_10000002 3300002239 Bacteria 925353
4 Ga0065704_10291397 3300005289 Unclassified 890
5 Ga0065712_10000115 3300005290 Bacteria 144502
6 Ga0065712_10006628 3300005290 Bacteria 3332
7 Ga0065712_10071716 3300005290 Bacteria 5099
8 Ga0065712_10083433 3300005290 Bacteria 2837
9 Ga0065715_10002551 3300005293 Bacteria 8696
10 Ga0065715_10089398 3300005293 Bacteria 10529
11 Ga0065715_10094481 3300005293 Bacteria 4325
12 Ga0065715_10209776 3300005293 Unclassified 1320
13 Ga0065715_10266707 3300005293 Unclassified 1115
14 Ga0065715_10351604 3300005293 Unclassified 950
15 Ga0065707_10012381 3300005295 Unclassified 2166
16 Ga0065707_10012506 3300005295 Bacteria 1918
17 Ga0065707_10027777 3300005295 Unclassified 1386
18 Ga0065707_10142514 3300005295 Bacteria 1730
19 Ga0065707_10223968 3300005295 Unclassified 1214
20 Ga0070676_10105013 3300005328 Bacteria 1751
21 Ga0070676_10226304 3300005328 Unclassified 1238
22 Ga0070676_10399130 3300005328 Unclassified 956
23 Ga0070690_100001848 3300005330 Bacteria 11237
24 Ga0070690_100094299 3300005330 Bacteria 1975
25 Ga0070670_100001896 3300005331 Bacteria 17088
26 Ga0070670_100005655 3300005331 Bacteria 10548
27 Ga0070670_100081386 3300005331 Bacteria 2783
28 Ga0070670_100363943 3300005331 Bacteria 1272
29 Ga0070670_101146314 3300005331 Bacteria 710
30 Ga0068869_100005578 3300005334 Bacteria 7920
31 Ga0068869_100242457 3300005334 Bacteria 1436
32 Ga0068869_100262641 3300005334 Bacteria 1382
33 Ga0068869_100330434 3300005334 Unclassified 1238
34 Ga0068869_100632438 3300005334 Unclassified 907
35 Ga0070666_10163003 3300005335 Bacteria 1559
36 Ga0070666_10218350 3300005335 Unclassified 1344
37 Ga0070666_10686804 3300005335 Bacteria 750
38 Ga0070680_100362556 3300005336 Unclassified 1233
39 Ga0070682_100022934 3300005337 Bacteria 3704
40 Ga0068868_100155043 3300005338 Bacteria 1888
41 Ga0068868_100352812 3300005338 Bacteria 1260
42 Ga0068868_100836041 3300005338 Bacteria 833
43 Ga0068868_100970505 3300005338 Bacteria 776
44 Ga0070660_100084001 3300005339 Unclassified 2502
45 Ga0070660_100842535 3300005339 Unclassified 772
46 Ga0070689_100000365 3300005340 Bacteria 26567
47 Ga0070689_100046155 3300005340 Bacteria 3356
48 Ga0070687_100015326 3300005343 Plasmid 3464
49 Ga0070687_100056571 3300005343 Bacteria 2053
50 Ga0070687_100162319 3300005343 Bacteria 1322
51 Ga0070687_100323718 3300005343 Unclassified 986
52 Ga0070687_100326824 3300005343 Bacteria 982
53 Ga0070687_100742263 3300005343 Unclassified 690
54 Ga0070661_100458422 3300005344 Bacteria 1015
55 Ga0070692_10062414 3300005345 Bacteria 1967
56 Ga0070692_10608886 3300005345 Unclassified 724
57 Ga0070669_100085746 3300005353 Unclassified 2352
58 Ga0070669_100194881 3300005353 Bacteria 1591
59 Ga0070669_100746546 3300005353 Bacteria 829
60 Ga0070675_100872127 3300005354 Unclassified 824
61 Ga0070675_102022989 3300005354 Unclassified 531
62 Ga0070671_100001619 3300005355 Bacteria 16966
63 Ga0070671_100020490 3300005355 Bacteria 5393
64 Ga0070671_100718760 3300005355 Unclassified 867
65 Ga0070673_100117163 3300005364 Bacteria 2216
66 Ga0070673_100205041 3300005364 Bacteria 1700
67 Ga0070673_100223758 3300005364 Bacteria 1630
68 Ga0070673_100393031 3300005364 Unclassified 1238
69 Ga0070673_100408945 3300005364 Bacteria 1215
70 Ga0070673_100470786 3300005364 Bacteria 1133
71 Ga0070673_100821192 3300005364 Unclassified 859
72 Ga0070688_100540817 3300005365 Bacteria 884
73 Ga0070688_100544425 3300005365 Unclassified 881
74 Ga0070688_101072712 3300005365 Bacteria 643
75 Ga0070659_100011023 3300005366 Bacteria 6676
76 Ga0070659_100044743 3300005366 Bacteria 3467
77 Ga0070703_10078535 3300005406 Bacteria 1119
78 Ga0070709_10464811 3300005434 Bacteria 955
79 Ga0070701_10052259 3300005438 Bacteria 2122
80 Ga0070701_10137271 3300005438 Bacteria 1395
81 Ga0070701_10144471 3300005438 Bacteria 1364
82 Ga0070701_10308669 3300005438 Unclassified 975
83 Ga0070701_10406820 3300005438 Unclassified 864
84 Ga0070705_100024210 3300005440 Bacteria 3274
85 Ga0070705_100399891 3300005440 Unclassified 1017
86 Ga0070705_100674630 3300005440 Bacteria 809
87 Ga0070705_101209633 3300005440 Bacteria 623
88 Ga0070705_101254464 3300005440 Unclassified 613
89 Ga0070705_101359007 3300005440 Unclassified 591
90 Ga0070700_100008536 3300005441 Bacteria 5578
91 Ga0070700_100055863 3300005441 Bacteria 2473
92 Ga0070700_100141331 3300005441 Bacteria 1636
93 Ga0070700_100275263 3300005441 Bacteria 1218
94 Ga0070700_100304929 3300005441 Bacteria 1164
95 Ga0070700_100736083 3300005441 Unclassified 788
96 Ga0070694_100010705 3300005444 Bacteria 5669
97 Ga0070694_100022379 3300005444 Bacteria 4049
98 Ga0070694_100040157 3300005444 Unclassified 3119
99 Ga0070694_100080507 3300005444 Bacteria 2263
100 Ga0070694_100118583 3300005444 Bacteria 1896
101 Ga0070694_100316055 3300005444 Unclassified 1201
102 Ga0070694_100756140 3300005444 Unclassified 794
103 Ga0070694_100883639 3300005444 Unclassified 737
104 Ga0070694_101009776 3300005444 Bacteria 691
105 Ga0070694_101452257 3300005444 Unclassified 580
106 Ga0070708_100005329 3300005445 Bacteria 10197
107 Ga0070708_100218854 3300005445 Bacteria 1785
108 Ga0070708_100708678 3300005445 Bacteria 947
109 Ga0070708_101155241 3300005445 Bacteria 725
110 Ga0070663_100464536 3300005455 Unclassified 1045
111 Ga0070678_100538914 3300005456 Bacteria 1035
112 Ga0070662_100330033 3300005457 Bacteria 1246
113 Ga0070662_100670361 3300005457 Bacteria 876
114 Ga0070681_10032618 3300005458 Bacteria 5228
115 Ga0068867_100014420 3300005459 Bacteria 5600
116 Ga0068867_100198532 3300005459 Bacteria 1605
117 Ga0070685_10553196 3300005466 Bacteria 822
118 Ga0070706_100000259 3300005467 Bacteria 64455
119 Ga0070706_100008408 3300005467 Bacteria 9615
120 Ga0070706_100019190 3300005467 Bacteria 6309
121 Ga0070706_100142919 3300005467 Bacteria 2234
122 Ga0070707_100006162 3300005468 Bacteria 11172
123 Ga0070707_100027508 3300005468 Bacteria 5410
124 Ga0070707_100030544 3300005468 Bacteria 5131
125 Ga0070707_100218768 3300005468 Bacteria 1855
126 Ga0070707_100378158 3300005468 Bacteria 1376
127 Ga0070707_100447706 3300005468 Unclassified 1252
128 Ga0070707_101018164 3300005468 Bacteria 794
129 Ga0070698_100000329 3300005471 Bacteria 48648
130 Ga0070698_100030054 3300005471 Bacteria 5637
131 Ga0070698_100093546 3300005471 Bacteria 2986
132 Ga0070698_100109854 3300005471 Unclassified 2723
133 Ga0070698_100550921 3300005471 Unclassified 1093
134 Ga0070699_100001495 3300005518 Bacteria 21436
135 Ga0070699_100174829 3300005518 Bacteria 1904
136 Ga0070699_100215078 3300005518 Bacteria 1712
137 Ga0070699_100586047 3300005518 Bacteria 1016
138 Ga0070699_100606958 3300005518 Bacteria 998
139 Ga0070679_100596709 3300005530 Bacteria 1048
140 Ga0070684_100114315 3300005535 Unclassified 2423
141 Ga0070697_100000067 3300005536 Bacteria 83699
142 Ga0070697_100000382 3300005536 Bacteria 34577
143 Ga0070697_100027649 3300005536 Bacteria 4539
144 Ga0070697_100254820 3300005536 Unclassified 1501
145 Ga0070697_100370685 3300005536 Unclassified 1239
146 Ga0070697_100403431 3300005536 Bacteria 1186
147 Ga0068853_100035027 3300005539 Bacteria 4263
148 Ga0068853_100075818 3300005539 Bacteria 2935
149 Ga0068853_101059335 3300005539 Unclassified 781
150 Ga0070672_100389446 3300005543 Bacteria 1193
151 Ga0070672_101141513 3300005543 Bacteria 693
152 Ga0070686_100014381 3300005544 Bacteria 4562
153 Ga0070686_100154779 3300005544 Unclassified 1609
154 Ga0070686_100209321 3300005544 Bacteria 1403
155 Ga0070686_100222797 3300005544 Bacteria 1364
156 Ga0070695_100086570 3300005545 Bacteria 2082
157 Ga0070695_100107966 3300005545 Unclassified 1884
158 Ga0070695_100133744 3300005545 Bacteria 1712
159 Ga0070695_100162341 3300005545 Bacteria 1569
160 Ga0070695_100170047 3300005545 Bacteria 1537
161 Ga0070695_100179683 3300005545 Bacteria 1499
162 Ga0070695_100262821 3300005545 Unclassified 1261
163 Ga0070696_100154709 3300005546 Bacteria 1685
164 Ga0070696_100194657 3300005546 Bacteria 1510
165 Ga0070696_100631034 3300005546 Bacteria 867
166 Ga0070696_100762578 3300005546 Unclassified 794
167 Ga0070693_100407953 3300005547 Bacteria 944
168 Ga0070693_100412652 3300005547 Unclassified 939
169 Ga0070693_100934280 3300005547 Unclassified 652
170 Ga0070704_100025914 3300005549 Bacteria 3866
171 Ga0070704_100091942 3300005549 Unclassified 2264
172 Ga0070704_100261548 3300005549 Unclassified 1426
173 Ga0070704_100505784 3300005549 Bacteria 1049
174 Ga0070704_100565308 3300005549 Bacteria 995
175 Ga0070704_100599520 3300005549 Bacteria 968
176 Ga0070704_100852750 3300005549 Bacteria 817
177 Ga0070664_100046789 3300005564 Bacteria 3655
178 Ga0070664_100060678 3300005564 Bacteria 3221
179 Ga0070664_100349687 3300005564 Unclassified 1344
180 Ga0070664_100386186 3300005564 Bacteria 1279
181 Ga0070664_100636663 3300005564 Bacteria 990
182 Ga0070664_100946117 3300005564 Unclassified 809
183 Ga0068857_100092544 3300005577 Bacteria 2707
184 Ga0068857_100428237 3300005577 Unclassified 1234
185 Ga0068857_100428950 3300005577 Unclassified 1233
186 Ga0068857_100479187 3300005577 Bacteria 1166
187 Ga0068857_101082311 3300005577 Unclassified 774
188 Ga0068854_100715041 3300005578 Bacteria 866
189 Ga0068854_100757122 3300005578 Bacteria 843
190 Ga0068856_100017050 3300005614 Bacteria 7041
191 Ga0070702_100016427 3300005615 Bacteria 3797
192 Ga0070702_100058810 3300005615 Bacteria 2229
193 Ga0070702_100092093 3300005615 Bacteria 1840
194 Ga0070702_100109379 3300005615 Bacteria 1711
195 Ga0068852_100232747 3300005616 Bacteria 1757
196 Ga0068852_101512227 3300005616 Unclassified 694
197 Ga0068852_101815174 3300005616 Bacteria 632
198 Ga0068859_100000244 3300005617 Bacteria 53533
199 Ga0068859_100009777 3300005617 Bacteria 9687
200 Ga0068859_100014183 3300005617 Bacteria 7991
201 Ga0068859_100022044 3300005617 Bacteria 6387
202 Ga0068859_100030303 3300005617 Bacteria 5428
203 Ga0068859_100085743 3300005617 Bacteria 3195
204 Ga0068859_100153944 3300005617 Bacteria 2375
205 Ga0068859_100185027 3300005617 Bacteria 2167
206 Ga0068859_100238116 3300005617 Unclassified 1909
207 Ga0068859_100329273 3300005617 Bacteria 1621
208 Ga0068859_100381243 3300005617 Unclassified 1505
209 Ga0068859_100496541 3300005617 Bacteria 1315
210 Ga0068859_100893087 3300005617 Bacteria 973
211 Ga0068859_101018982 3300005617 Bacteria 909
212 Ga0068864_100000909 3300005618 Bacteria 24863
213 Ga0068864_100064647 3300005618 Unclassified 3173
214 Ga0068864_100100036 3300005618 Unclassified 2570
215 Ga0068864_100149914 3300005618 Bacteria 2112
216 Ga0068864_100158269 3300005618 Unclassified 2057
217 Ga0068864_100594306 3300005618 Unclassified 1073
218 Ga0068864_100684597 3300005618 Unclassified 1001
219 Ga0068866_10015012 3300005718 Bacteria 3433
220 Ga0068866_10449392 3300005718 Bacteria 842
221 Ga0068861_100034482 3300005719 Bacteria 3743
222 Ga0068861_100106738 3300005719 Bacteria 2238
223 Ga0068861_100691515 3300005719 Unclassified 947
224 Ga0068861_100830109 3300005719 Unclassified 870
225 Ga0068861_100920165 3300005719 Bacteria 830
226 Ga0068861_100969898 3300005719 Bacteria 810
227 Ga0068861_101914151 3300005719 Unclassified 590
228 Ga0068851_10364640 3300005834 Unclassified 843
229 Ga0068870_10225706 3300005840 Bacteria 1149
230 Ga0068863_100177410 3300005841 Bacteria 2045
231 Ga0068863_100210070 3300005841 Bacteria 1874
232 Ga0068863_100290900 3300005841 Bacteria 1583
233 Ga0068863_100444639 3300005841 Unclassified 1271
234 Ga0068863_100683907 3300005841 Unclassified 1019
235 Ga0068863_100806237 3300005841 Bacteria 937
236 Ga0068858_100010270 3300005842 Bacteria 8879
237 Ga0068858_100065558 3300005842 Bacteria 3361
238 Ga0068858_100093212 3300005842 Unclassified 2804
239 Ga0068858_100114618 3300005842 Bacteria 2518
240 Ga0068858_100246287 3300005842 Bacteria 1697
241 Ga0068858_100253942 3300005842 Bacteria 1670
242 Ga0068858_100382472 3300005842 Bacteria 1351
243 Ga0068858_100437145 3300005842 Bacteria 1260
244 Ga0068860_100168360 3300005843 Unclassified 2116
245 Ga0068860_100182778 3300005843 Bacteria 2027
246 Ga0068860_100710034 3300005843 Unclassified 1015
247 Ga0068860_101288203 3300005843 Unclassified 751
248 Ga0068860_101346906 3300005843 Bacteria 735
249 Ga0068862_100022886 3300005844 Bacteria 5231
250 Ga0068862_100064329 3300005844 Unclassified 3157
251 Ga0068862_100136652 3300005844 Unclassified 2173
252 Ga0068862_100347310 3300005844 Unclassified 1376
253 Ga0068862_100379178 3300005844 Bacteria 1319
254 Ga0068862_101412629 3300005844 Bacteria 699
255 Ga0068862_101420855 3300005844 Bacteria 698
256 Ga0081539_10018276 3300005985 Unclassified 4873
257 Ga0081539_10042804 3300005985 Unclassified 2633
258 Ga0097621_100007440 3300006237 Bacteria 7834
259 Ga0097621_100022900 3300006237 Bacteria 4854
260 Ga0097621_100948675 3300006237 Bacteria 803
261 Ga0097621_101666269 3300006237 Bacteria 607
262 Ga0068871_100007211 3300006358 Bacteria 7927
263 Ga0068871_100011100 3300006358 Bacteria 6603
264 Ga0068871_100018410 3300006358 Bacteria 5307
265 Ga0068871_100039001 3300006358 Bacteria 3798
266 Ga0068871_100770212 3300006358 Bacteria 886
267 Ga0075428_100113401 3300006844 Bacteria 2953
268 Ga0075428_100915481 3300006844 Bacteria 930
269 Ga0075428_101036391 3300006844 Bacteria 868
270 Ga0075430_100632580 3300006846 Bacteria 883
271 Ga0075431_100337097 3300006847 Unclassified 1518
272 Ga0075433_10045393 3300006852 Bacteria 3820
273 Ga0075433_10194435 3300006852 Bacteria 1804
274 Ga0075433_10396452 3300006852 Bacteria 1218
275 Ga0075433_10485644 3300006852 Unclassified 1088
276 Ga0075434_100081225 3300006871 Bacteria 3239
277 Ga0075434_100095695 3300006871 Unclassified 2975
278 Ga0075434_100131979 3300006871 Unclassified 2517
279 Ga0075434_100152751 3300006871 Bacteria 2329
280 Ga0075434_100163038 3300006871 Bacteria 2249
281 Ga0075434_100919572 3300006871 Bacteria 889
282 Ga0075429_100278143 3300006880 Bacteria 1466
283 Ga0075429_100538070 3300006880 Bacteria 1024
284 Ga0075429_101410587 3300006880 Unclassified 606
285 Ga0068865_100221730 3300006881 Bacteria 1479
286 Ga0068865_100795769 3300006881 Unclassified 815
287 Ga0075436_100000051 3300006914 Bacteria 70811
288 Ga0075436_100283373 3300006914 Bacteria 1185
289 Ga0097620_100000244 3300006931 Bacteria 53533
290 Ga0097620_100009778 3300006931 Bacteria 9687
291 Ga0097620_100014182 3300006931 Bacteria 7991
292 Ga0097620_100022045 3300006931 Bacteria 6387
293 Ga0097620_100030303 3300006931 Bacteria 5428
294 Ga0097620_100085736 3300006931 Bacteria 3195
295 Ga0097620_100153951 3300006931 Bacteria 2375
296 Ga0097620_100185041 3300006931 Bacteria 2167
297 Ga0097620_100238101 3300006931 Unclassified 1909
298 Ga0097620_100329272 3300006931 Bacteria 1621
299 Ga0097620_100381259 3300006931 Unclassified 1505
300 Ga0097620_100496519 3300006931 Bacteria 1315
301 Ga0097620_100658866 3300006931 Bacteria 1139
302 Ga0097620_100893093 3300006931 Bacteria 973
303 Ga0097620_101019005 3300006931 Bacteria 909
304 Ga0075435_100001157 3300007076 Bacteria 16832
305 Ga0075435_100338303 3300007076 Bacteria 1290
306 Ga0075435_100494963 3300007076 Bacteria 1057
307 Ga0099794_10057302 3300007265 Bacteria 1888
308 Ga0099795_10077305 3300007788 Bacteria 1267
309 Ga0105240_10041967 3300009093 Bacteria 5833
310 Ga0111539_10015341 3300009094 Bacteria 9538
311 Ga0111539_10050543 3300009094 Bacteria 4953
312 Ga0111539_10079984 3300009094 Bacteria 3845
313 Ga0111539_10092222 3300009094 Bacteria 3559
314 Ga0105245_10096543 3300009098 Bacteria 2728
315 Ga0105245_10217826 3300009098 Unclassified 1840
316 Ga0105245_10255340 3300009098 Unclassified 1704
317 Ga0105245_10621347 3300009098 Bacteria 1109
318 Ga0105245_11212772 3300009098 Bacteria 802
319 Ga0105245_11766496 3300009098 Unclassified 671
320 Ga0105247_10000031 3300009101 Bacteria 185793
321 Ga0105247_10000439 3300009101 Bacteria 35349
322 Ga0105247_10052305 3300009101 Bacteria 2518
323 Ga0105247_10080948 3300009101 Bacteria 2047
324 Ga0114129_10037001 3300009147 Bacteria 6891
325 Ga0114129_10075385 3300009147 Bacteria 4697
326 Ga0114129_10210166 3300009147 Bacteria 2631
327 Ga0114129_10240082 3300009147 Bacteria 2436
328 Ga0114129_10259190 3300009147 Unclassified 2331
329 Ga0114129_10640997 3300009147 Bacteria 1372
330 Ga0114129_10653254 3300009147 Unclassified 1357
331 Ga0114129_11401287 3300009147 Bacteria 862
332 Ga0105243_10000245 3300009148 Bacteria 62285
333 Ga0105243_10011028 3300009148 Bacteria 6835
334 Ga0105243_10214692 3300009148 Bacteria 1696
335 Ga0105243_11027120 3300009148 Bacteria 829
336 Ga0105243_11143951 3300009148 Bacteria 789
337 Ga0105241_10155540 3300009174 Unclassified 1874
338 Ga0105241_10176228 3300009174 Bacteria 1770
339 Ga0105241_10186960 3300009174 Bacteria 1722
340 Ga0105241_10209433 3300009174 Bacteria 1633
341 Ga0105241_10505255 3300009174 Unclassified 1079
342 Ga0105241_11638480 3300009174 Bacteria 623
343 Ga0105242_10000095 3300009176 Bacteria 62254
344 Ga0105242_10001963 3300009176 Bacteria 16187
345 Ga0105242_10025417 3300009176 Bacteria 4687
346 Ga0105242_10040360 3300009176 Bacteria 3761
347 Ga0105242_10172206 3300009176 Unclassified 1903
348 Ga0105242_10240228 3300009176 Bacteria 1628
349 Ga0105242_12153489 3300009176 Unclassified 602
350 Ga0105248_10002613 3300009177 Bacteria 20045
351 Ga0105248_10014258 3300009177 Bacteria 8749
352 Ga0105248_10156790 3300009177 Unclassified 2569
353 Ga0105248_10216760 3300009177 Bacteria 2156
354 Ga0105248_10248840 3300009177 Bacteria 2001
355 Ga0105248_10331410 3300009177 Bacteria 1714
356 Ga0105248_10408746 3300009177 Bacteria 1528
357 Ga0105248_10634700 3300009177 Bacteria 1205
358 Ga0105248_10682625 3300009177 Bacteria 1159
359 Ga0105248_10800580 3300009177 Bacteria 1064
360 Ga0105248_10865066 3300009177 Bacteria 1020
361 Ga0105248_10970656 3300009177 Bacteria 960
362 Ga0105248_11519841 3300009177 Unclassified 758
363 Ga0105248_12544580 3300009177 Unclassified 583
364 Ga0105237_10315418 3300009545 Unclassified 1567
365 Ga0105237_11749185 3300009545 Bacteria 629
366 Ga0105238_10001402 3300009551 Bacteria 24176
367 Ga0105249_10000030 3300009553 Bacteria 221992
368 Ga0105249_10098930 3300009553 Bacteria 2741
369 Ga0105249_10100079 3300009553 Bacteria 2725
370 Ga0105249_10136102 3300009553 Bacteria 2351
371 Ga0105249_10137928 3300009553 Bacteria 2336
372 Ga0105249_10276157 3300009553 Unclassified 1676
373 Ga0105249_10320085 3300009553 Bacteria 1562
374 Ga0105249_10700640 3300009553 Bacteria 1073
375 Ga0099796_10246453 3300010159 Unclassified 740
376 Ga0105239_10160805 3300010375 Bacteria 2509
377 Ga0105239_10768983 3300010375 Bacteria 1103
378 Ga0105246_10054526 3300011119 Unclassified 2755
379 Ga0105246_10059783 3300011119 Bacteria 2645
380 Ga0105246_10192600 3300011119 Unclassified 1579
381 Ga0105246_10507271 3300011119 Bacteria 1025
382 Ga0157371_10526103 3300013102 Bacteria 875
383 Ga0157374_10253340 3300013296 Bacteria 1733
384 Ga0157374_10318994 3300013296 Bacteria 1540
385 Ga0157374_11181383 3300013296 Bacteria 786
386 Ga0157378_10003126 3300013297 Bacteria 14717
387 Ga0157378_10004927 3300013297 Bacteria 11699
388 Ga0157378_10034902 3300013297 Bacteria 4447
389 Ga0157378_10081136 3300013297 Bacteria 2931
390 Ga0157378_10111635 3300013297 Bacteria 2507
391 Ga0157378_10140961 3300013297 Bacteria 2238
392 Ga0157378_10145639 3300013297 Bacteria 2203
393 Ga0157378_10317687 3300013297 Bacteria 1512
394 Ga0157378_10342782 3300013297 Bacteria 1458
395 Ga0157378_10702630 3300013297 Bacteria 1031
396 Ga0157378_10806169 3300013297 Bacteria 965
397 Ga0157378_10911752 3300013297 Unclassified 910
398 Ga0157378_10934788 3300013297 Unclassified 899
399 Ga0157378_10999712 3300013297 Bacteria 871
400 Ga0157378_11295269 3300013297 Bacteria 770
401 Ga0163162_10000002 3300013306 Bacteria 717331
402 Ga0163162_10029036 3300013306 Bacteria 5473
403 Ga0163162_10086416 3300013306 Unclassified 3214
404 Ga0163162_10111398 3300013306 Bacteria 2834
405 Ga0163162_10176583 3300013306 Bacteria 2261
406 Ga0163162_10386259 3300013306 Unclassified 1533
407 Ga0163162_10570637 3300013306 Bacteria 1259
408 Ga0163162_10786747 3300013306 Bacteria 1069
409 Ga0163162_11273997 3300013306 Unclassified 835
410 Ga0163162_12165041 3300013306 Unclassified 638
411 Ga0157372_10056272 3300013307 Bacteria 4394
412 Ga0157372_10094611 3300013307 Bacteria 3403
413 Ga0157372_10751536 3300013307 Bacteria 1134
414 Ga0157372_10777802 3300013307 Bacteria 1113
415 Ga0157375_10006611 3300013308 Bacteria 10088
416 Ga0157375_10049685 3300013308 Unclassified 4111
417 Ga0157375_10166948 3300013308 Bacteria 2346
418 Ga0157375_10285181 3300013308 Bacteria 1815
419 Ga0157375_10318616 3300013308 Bacteria 1719
420 Ga0157375_10518456 3300013308 Unclassified 1355
421 Ga0157375_10642887 3300013308 Bacteria 1217
422 Ga0157375_11950963 3300013308 Bacteria 697
423 Ga0163163_10000382 3300014325 Bacteria 42215
424 Ga0163163_10029205 3300014325 Bacteria 5303
425 Ga0163163_10477843 3300014325 Bacteria 1307
426 Ga0163163_10607818 3300014325 Unclassified 1157
427 Ga0163163_10648072 3300014325 Bacteria 1120
428 Ga0163163_10850380 3300014325 Bacteria 976
429 Ga0163163_10872466 3300014325 Bacteria 963
430 Ga0157380_10003354 3300014326 Bacteria 10985
431 Ga0157380_10156534 3300014326 Unclassified 1975
432 Ga0157380_10215551 3300014326 Bacteria 1714
433 Ga0157380_10485188 3300014326 Bacteria 1196
434 Ga0157380_10541153 3300014326 Unclassified 1140
435 Ga0157380_11244389 3300014326 Bacteria 789
436 Ga0157377_10029501 3300014745 Bacteria 2962
437 Ga0157377_10116123 3300014745 Unclassified 1616
438 Ga0157377_10413443 3300014745 Bacteria 922
439 Ga0157377_10484669 3300014745 Unclassified 861
440 Ga0157379_10071150 3300014968 Unclassified 3112
441 Ga0157379_10094631 3300014968 Bacteria 2681
442 Ga0157379_10338082 3300014968 Bacteria 1377
443 Ga0157376_10010782 3300014969 Bacteria 6707
444 Ga0157376_10315306 3300014969 Bacteria 1485
445 Ga0163161_10040108 3300017792 Bacteria 3362
446 Ga0163161_10417991 3300017792 Bacteria 1078
447 Ga0163161_10655563 3300017792 Bacteria 870
448 Ga0213876_10000006 3300021384 Bacteria 700803
449 Ga0213876_10001003 3300021384 Bacteria 18424
450 Ga0207672_1000119 3300025223 Bacteria 10595
451 Ga0207653_10000164 3300025885 Bacteria 47024
452 Ga0207642_10196863 3300025899 Unclassified 1110
453 Ga0207642_10353038 3300025899 Bacteria 868
454 Ga0207710_10000003 3300025900 Bacteria 1071597
455 Ga0207710_10001421 3300025900 Bacteria 11972
456 Ga0207710_10014635 3300025900 Unclassified 3311
457 Ga0207710_10240078 3300025900 Bacteria 904
458 Ga0207647_10021627 3300025904 Bacteria 4292
459 Ga0207647_10064600 3300025904 Bacteria 2224
460 Ga0207643_10152348 3300025908 Unclassified 1387
461 Ga0207643_10324130 3300025908 Bacteria 963
462 Ga0207643_10555340 3300025908 Unclassified 737
463 Ga0207684_10001105 3300025910 Bacteria 30176
464 Ga0207684_10006931 3300025910 Bacteria 10252
465 Ga0207684_10103193 3300025910 Bacteria 2438
466 Ga0207684_10123832 3300025910 Unclassified 2217
467 Ga0207684_10647217 3300025910 Bacteria 901
468 Ga0207684_11177719 3300025910 Bacteria 635
469 Ga0207654_10037149 3300025911 Bacteria 2725
470 Ga0207654_10038801 3300025911 Bacteria 2675
471 Ga0207654_10422549 3300025911 Bacteria 930
472 Ga0207707_10620834 3300025912 Unclassified 913
473 Ga0207695_10016042 3300025913 Bacteria 8791
474 Ga0207671_10200912 3300025914 Unclassified 1557
475 Ga0207660_10344824 3300025917 Unclassified 1193
476 Ga0207662_10036841 3300025918 Bacteria 2860
477 Ga0207662_10071580 3300025918 Bacteria 2100
478 Ga0207662_10072497 3300025918 Bacteria 2087
479 Ga0207662_10104087 3300025918 Unclassified 1762
480 Ga0207662_10233106 3300025918 Bacteria 1203
481 Ga0207662_10921656 3300025918 Unclassified 619
482 Ga0207657_10061974 3300025919 Bacteria 3204
483 Ga0207649_10093316 3300025920 Bacteria 1975
484 Ga0207649_11266454 3300025920 Unclassified 583
485 Ga0207652_10604602 3300025921 Bacteria 983
486 Ga0207646_10004046 3300025922 Bacteria 16198
487 Ga0207646_10037628 3300025922 Bacteria 4362
488 Ga0207646_10115919 3300025922 Unclassified 2406
489 Ga0207646_10239246 3300025922 Unclassified 1640
490 Ga0207646_10484973 3300025922 Bacteria 1114
491 Ga0207646_10494721 3300025922 Bacteria 1102
492 Ga0207646_10495856 3300025922 Bacteria 1100
493 Ga0207646_10631516 3300025922 Unclassified 960
494 Ga0207646_10831598 3300025922 Unclassified 821
495 Ga0207681_10004016 3300025923 Bacteria 9133
496 Ga0207681_10047369 3300025923 Bacteria 2896
497 Ga0207681_10358177 3300025923 Bacteria 1169
498 Ga0207694_10005083 3300025924 Bacteria 10168
499 Ga0207694_10329696 3300025924 Bacteria 1261
500 Ga0207650_10000374 3300025925 Bacteria 42233
501 Ga0207650_10001930 3300025925 Bacteria 14601
502 Ga0207650_10133643 3300025925 Unclassified 1944
503 Ga0207650_10210354 3300025925 Bacteria 1562
504 Ga0207644_10212584 3300025931 Bacteria 1530
505 Ga0207644_10746184 3300025931 Bacteria 817
506 Ga0207690_10029654 3300025932 Bacteria 3482
507 Ga0207690_10128464 3300025932 Unclassified 1851
508 Ga0207706_10173662 3300025933 Bacteria 1893
509 Ga0207706_10212621 3300025933 Bacteria 1695
510 Ga0207686_10000126 3300025934 Bacteria 61970
511 Ga0207686_10310781 3300025934 Bacteria 1174
512 Ga0207686_10455826 3300025934 Unclassified 984
513 Ga0207709_10000258 3300025935 Bacteria 63271
514 Ga0207709_10035658 3300025935 Unclassified 2942
515 Ga0207709_10096475 3300025935 Unclassified 1945
516 Ga0207709_10182822 3300025935 Unclassified 1482
517 Ga0207709_10282923 3300025935 Unclassified 1226
518 Ga0207709_10405364 3300025935 Bacteria 1043
519 Ga0207709_10620347 3300025935 Bacteria 858
520 Ga0207709_10699820 3300025935 Unclassified 811
521 Ga0207670_10001852 3300025936 Bacteria 11051
522 Ga0207670_10039291 3300025936 Bacteria 3098
523 Ga0207670_10469276 3300025936 Unclassified 1017
524 Ga0207670_11119067 3300025936 Bacteria 665
525 Ga0207704_10028003 3300025938 Bacteria 3119
526 Ga0207704_10164937 3300025938 Bacteria 1581
527 Ga0207704_10245731 3300025938 Bacteria 1340
528 Ga0207665_10338400 3300025939 Bacteria 1133
529 Ga0207691_10064005 3300025940 Bacteria 3333
530 Ga0207691_11190489 3300025940 Bacteria 632
531 Ga0207711_10005891 3300025941 Bacteria 10349
532 Ga0207711_10052395 3300025941 Bacteria 3497
533 Ga0207711_10203868 3300025941 Unclassified 1805
534 Ga0207711_10207215 3300025941 Unclassified 1790
535 Ga0207711_10431174 3300025941 Unclassified 1227
536 Ga0207711_10538531 3300025941 Bacteria 1089
537 Ga0207711_10646277 3300025941 Bacteria 987
538 Ga0207711_10703321 3300025941 Bacteria 943
539 Ga0207689_10004044 3300025942 Bacteria 13326
540 Ga0207689_10004842 3300025942 Bacteria 12134
541 Ga0207689_10007067 3300025942 Bacteria 9870
542 Ga0207689_10102908 3300025942 Bacteria 2346
543 Ga0207689_10240999 3300025942 Bacteria 1495
544 Ga0207689_10778425 3300025942 Unclassified 808
545 Ga0207661_10952662 3300025944 Unclassified 791
546 Ga0207679_10147041 3300025945 Bacteria 1913
547 Ga0207679_10747721 3300025945 Bacteria 889
548 Ga0207651_10001634 3300025960 Bacteria 10289
549 Ga0207651_10043834 3300025960 Bacteria 2989
550 Ga0207651_11188580 3300025960 Unclassified 685
551 Ga0207712_10000041 3300025961 Bacteria 180000
552 Ga0207712_10083623 3300025961 Bacteria 2330
553 Ga0207712_10311762 3300025961 Unclassified 1295
554 Ga0207712_10590171 3300025961 Bacteria 960
555 Ga0207712_11049880 3300025961 Bacteria 724
556 Ga0207668_10002076 3300025972 Bacteria 11677
557 Ga0207640_10625576 3300025981 Bacteria 914
558 Ga0207677_10138526 3300026023 Bacteria 1859
559 Ga0207677_10778298 3300026023 Unclassified 855
560 Ga0207677_10888435 3300026023 Bacteria 803
561 Ga0207703_10000056 3300026035 Bacteria 142103
562 Ga0207703_10277243 3300026035 Bacteria 1521
563 Ga0207703_10281028 3300026035 Bacteria 1512
564 Ga0207703_10309117 3300026035 Bacteria 1444
565 Ga0207639_10190023 3300026041 Bacteria 1753
566 Ga0207639_10370840 3300026041 Bacteria 1283
567 Ga0207639_10958907 3300026041 Bacteria 800
568 Ga0207708_10000174 3300026075 Bacteria 51063
569 Ga0207708_10005657 3300026075 Bacteria 9229
570 Ga0207708_10035008 3300026075 Bacteria 3821
571 Ga0207708_10096336 3300026075 Bacteria 2286
572 Ga0207708_10226115 3300026075 Unclassified 1501
573 Ga0207702_11538538 3300026078 Bacteria 658
574 Ga0207641_10058217 3300026088 Bacteria 3288
575 Ga0207641_10191180 3300026088 Unclassified 1882
576 Ga0207641_10312033 3300026088 Bacteria 1489
577 Ga0207641_10386540 3300026088 Bacteria 1341
578 Ga0207641_10843351 3300026088 Unclassified 908
579 Ga0207641_10906264 3300026088 Unclassified 876
580 Ga0207641_11347032 3300026088 Bacteria 714
581 Ga0207648_10047903 3300026089 Bacteria 3744
582 Ga0207648_10048640 3300026089 Bacteria 3712
583 Ga0207648_10473588 3300026089 Bacteria 1143
584 Ga0207676_10093941 3300026095 Unclassified 2470
585 Ga0207676_10149381 3300026095 Bacteria 2010
586 Ga0207676_10422059 3300026095 Unclassified 1251
587 Ga0207676_10734598 3300026095 Unclassified 959
588 Ga0207674_10015940 3300026116 Bacteria 8233
589 Ga0207674_10048970 3300026116 Archaea 4323
590 Ga0207674_10074923 3300026116 Bacteria 3395
591 Ga0207674_10087829 3300026116 Bacteria 3102
592 Ga0207674_10149003 3300026116 Bacteria 2297
593 Ga0207675_100063265 3300026118 Bacteria 3457
594 Ga0207675_100144887 3300026118 Bacteria 2258
595 Ga0207675_100164149 3300026118 Bacteria 2120
596 Ga0207675_100644233 3300026118 Unclassified 1065
597 Ga0207675_100834573 3300026118 Unclassified 936
598 Ga0207675_100980641 3300026118 Bacteria 863
599 Ga0207675_101018356 3300026118 Bacteria 847
600 Ga0207698_10043245 3300026142 Bacteria 3373
601 Ga0207698_11766851 3300026142 Bacteria 634
602 Ga0209588_1073050 3300027671 Bacteria 1108
603 Ga0207428_10002967 3300027907 Bacteria 16785
604 Ga0207428_10012680 3300027907 Bacteria 7392
605 Ga0207428_10088031 3300027907 Bacteria 2415
606 Ga0268265_10043433 3300028380 Unclassified 3342
607 Ga0268265_10070449 3300028380 Bacteria 2719
608 Ga0268265_10127052 3300028380 Bacteria 2112
609 Ga0268265_10328831 3300028380 Unclassified 1387
610 Ga0268265_11006685 3300028380 Bacteria 823
611 Ga0268264_10017959 3300028381 Bacteria 5786
612 Ga0268264_10146317 3300028381 Bacteria 2113
613 Ga0268264_10155102 3300028381 Bacteria 2057
614 Ga0268264_10282627 3300028381 Bacteria 1555
615 Ga0268264_10618503 3300028381 Unclassified 1069
616 Ga0268264_10838513 3300028381 Bacteria 920
617 Ga0316183_1181047 3300030742 Bacteria 630
618 Ga0307513_10061040 3300031456 Bacteria 3993
619 Ga0307408_100149208 3300031548 Bacteria 1844
620 Ga0307408_100250161 3300031548 Bacteria 1461
621 Ga0307405_10010993 3300031731 Bacteria 4720
622 Ga0307410_10025142 3300031852 Unclassified 3731
623 Ga0307406_10016799 3300031901 Unclassified 4257
624 Ga0307407_10316864 3300031903 Bacteria 1093
625 Ga0307407_10554990 3300031903 Unclassified 850
626 Ga0307412_10185770 3300031911 Bacteria 1567
627 Ga0307416_100022791 3300032002 Unclassified 4529
628 Ga0307416_100031806 3300032002 Unclassified 3978
629 Ga0307416_100226369 3300032002 Unclassified 1799
630 Ga0307414_10008915 3300032004 Bacteria 5730
631 Ga0307414_10364579 3300032004 Bacteria 1244
632 Ga0307411_10034193 3300032005 Unclassified 3160
633 Ga0307411_10092057 3300032005 Bacteria 2120
634 Ga0307415_100012397 3300032126 Unclassified 4927
635 Ga0373948_0087158 3300034817 Unclassified 720
636 Ga0373928_0092389 3300035084 Bacteria 779
637 Ga0373949_0121404 3300035090 Unclassified 734
638 Ga0373951_0011743 3300035091 Unclassified 1969
639 Ga0373952_0039503 3300035092 Bacteria 1085
640 Ga0373941_0033588 3300035115 Unclassified 1543
641 Ga0373941_0141774 3300035115 Bacteria 875
642 Ga0373960_0194230 3300035121 Unclassified 715
643 Ga0373961_0048666 3300035241 Bacteria 1250
644 Ga0373931_0715008 3300035691 Unclassified 662
645 Ga0373937_0056407 3300036401 Bacteria 3608
646 Ga0373937_0327941 3300036401 Unclassified 1449
647 Ga0395898_0462520 3300037466 Bacteria 1208
648 Ga0395901_0319542 3300038443 Bacteria 1607
649 Ga0242420_086087 3300038996 Bacteria 655
650 Ga0436365_1753418 3300039437 Bacteria 95553
651 Ga0439439_0108727 3300041406 Bacteria 767
652 Ga0439434_0029753 3300042435 Bacteria 1656
653 Ga0451577_0545610 3300042876 Bacteria 1053
654 Ga0453683_0915857 3300044673 Unclassified 580
655 Ga0453684_0501522 3300044712 Bacteria 1344
656 Ga0451576_0248334 3300045051 Bacteria 1859
657 Ga0451576_1040773 3300045051 Unclassified 858
658 Ga0451576_1647041 3300045051 Unclassified 665
659 Ga0495639_0366570 3300046475 Unclassified 725
660 Ga0495586_0271227 3300046535 Unclassified 970
661 Ga0495621_0086171 3300046539 Bacteria 1178
662 Ga0495656_0053047 3300046615 Bacteria 1741
663 Ga0495659_0052885 3300046664 Unclassified 1483
664 Ga0495613_0527182 3300046689 Unclassified 793
665 Ga0495600_0271325 3300046809 Unclassified 1076
666 Ga0495636_0040188 3300047318 Bacteria 1939
667 Ga0495672_0129424 3300047320 Bacteria 1330
668 Ga0495680_0176272 3300047322 Unclassified 1546
669 Ga0495684_0149835 3300047471 Unclassified 1745
670 Ga0496102_0098368 3300048905 Bacteria 2715
671 Ga0496103_0447682 3300048906 Bacteria 828
672 Ga0496104_0224168 3300048907 Bacteria 1792
673 Ga0496106_0047393 3300048909 Bacteria 3234
674 Ga0496106_0119387 3300048909 Unclassified 2060
675 Ga0496106_0416580 3300048909 Unclassified 1080
676 Ga0496107_0659634 3300048910 Bacteria 771
677 Ga0496108_1131431 3300048911 Bacteria 664
678 Ga0496109_0344370 3300048912 Bacteria 1408
679 Ga0496110_0440301 3300048913 Unclassified 1188
680 Ga0496112_0317288 3300048915 Bacteria 1503
681 Ga0496112_0399066 3300048915 Bacteria 1315
682 Ga0496112_0713899 3300048915 Bacteria 930
683 Ga0501290_011882 3300049513 Unclassified 1125
684 Ga0501296_001108 3300049519 Bacteria 2694
685 Ga0501296_057368 3300049519 Unclassified 582
686 Ga0501298_011976 3300049521 Unclassified 1514
687 Ga0501298_012381 3300049521 Bacteria 1495
688 Ga0501298_023776 3300049521 Unclassified 1163
689 Ga0501299_000862 3300049522 Bacteria 3717
690 Ga0501302_017074 3300049525 Unclassified 593
691 Ga0501040_0602467 3300049576 Unclassified 794
692 Ga0501041_0366658 3300049577 Bacteria 911
693 Ga0501048_0255529 3300049582 Bacteria 1245
694 Ga0501048_1233371 3300049582 Unclassified 538
695 Ga0501198_014731 3300049649 Bacteria 1194
696 Ga0501202_004443 3300049652 Bacteria 2456
697 Ga0501206_009860 3300049653 Bacteria 1273
698 Ga0501207_000793 3300049654 Unclassified 3744
699 Ga0501207_000806 3300049654 Bacteria 3710
700 Ga0501207_002587 3300049654 Bacteria 2353
701 Ga0501209_002628 3300049656 Unclassified 2810
702 Ga0501216_019180 3300049660 Bacteria 1184
703 Ga0501217_008635 3300049661 Unclassified 2204
704 Ga0501217_009534 3300049661 Bacteria 2113
705 Ga0501217_174855 3300049661 Unclassified 656
706 Ga0501223_009977 3300049663 Bacteria 1916
707 Ga0501224_000720 3300049664 Bacteria 4156
708 Ga0501227_003134 3300049665 Bacteria 3594
709 Ga0501228_005337 3300049666 Bacteria 1137
710 Ga0501230_003676 3300049667 Bacteria 2055
711 Ga0501233_005796 3300049668 Bacteria 2298
712 Ga0501233_021229 3300049668 Bacteria 1392
713 Ga0501233_051606 3300049668 Unclassified 998
714 Ga0501235_002829 3300049669 Bacteria 3733
715 Ga0501235_026483 3300049669 Unclassified 1299
716 Ga0501243_003102 3300049675 Bacteria 2454
717 Ga0501249_023139 3300049679 Unclassified 1363
718 Ga0501252_023696 3300049682 Bacteria 817
719 Ga0501253_128711 3300049683 Bacteria 620
720 Ga0501253_134077 3300049683 Unclassified 611
721 Ga0501259_013102 3300049688 Bacteria 1389
722 Ga0501261_027687 3300049690 Unclassified 844
723 Ga0501219_004765 3300049703 Bacteria 966
724 Ga0501221_005933 3300049704 Bacteria 2053
725 Ga0501225_0002041 3300049705 Bacteria 6280
726 Ga0501225_0004903 3300049705 Unclassified 3956
727 Ga0501234_003375 3300049707 Unclassified 2512
728 Ga0501234_006265 3300049707 Bacteria 1862
729 Ga0501234_022564 3300049707 Bacteria 1005
730 Ga0501079_0101721 3300049741 Bacteria 2229
731 Ga0501263_001644 3300049760 Bacteria 2151
732 Ga0501267_004329 3300049764 Bacteria 1316
733 Ga0501273_010157 3300049770 Bacteria 1153
734 Ga0501273_060476 3300049770 Unclassified 596
735 Ga0501283_000691 3300049779 Bacteria 4457
736 Ga0501283_010763 3300049779 Bacteria 1350
737 Ga0501212_032969 3300049851 Unclassified 840
738 Ga0501226_002087 3300049853 Bacteria 2483
739 Ga0501226_013425 3300049853 Bacteria 905
740 nmdc:mga05p37_1064907_c1 3300050507 Unclassified 851
741 nmdc:mga05p37_130459_c1 3300050507 Bacteria 3084
742 nmdc:mga05p37_1598037_c1 3300050507 Unclassified 642
743 nmdc:mga05p37_2052365_c1 3300050507 Unclassified 538
744 nmdc:mga05p37_228385_c1 3300050507 Bacteria 2243
745 nmdc:mga05p37_442400_c1 3300050507 Unclassified 1507
746 nmdc:mga05p37_619142_c1 3300050507 Unclassified 1218
747 nmdc:mga05p37_73844_c1 3300050507 Bacteria 4197
748 nmdc:mga05p37_790282_c1 3300050507 Unclassified 1040
749 nmdc:mga09592_322621_c1 3300050508 Bacteria 1338
750 nmdc:mga09592_67641_c1 3300050508 Unclassified 3030
751 nmdc:mga09592_696263_c1 3300050508 Unclassified 865
752 nmdc:mga06r32_595747_c1 3300050510 Unclassified 1076
753 nmdc:mga08y16_5605_c1 3300050511 Bacteria 13149
754 nmdc:mga0n895_406719_c1 3300050512 Bacteria 1376
755 nmdc:mga0n895_528979_c1 3300050512 Bacteria 1186
756 nmdc:mga0n895_570136_c1 3300050512 Unclassified 1137
757 nmdc:mga0n895_98729_c1 3300050512 Bacteria 2927
758 nmdc:mga0rr50_444659_c1 3300050513 Bacteria 1098
759 nmdc:mga0rr50_863_c1 3300050513 Bacteria 16350
760 nmdc:mga08x19_116_c1 3300050514 Bacteria 70950
761 nmdc:mga0a205_1018059_c1 3300050515 Unclassified 675
762 nmdc:mga0a205_129134_c1 3300050515 Unclassified 2428
763 nmdc:mga0a205_174959_c1 3300050515 Bacteria 2042
764 nmdc:mga0a205_238075_c1 3300050515 Bacteria 1702
765 nmdc:mga0a205_542540_c1 3300050515 Unclassified 1018
766 nmdc:mga0a205_577642_c1 3300050515 Unclassified 978
767 nmdc:mga0a205_782360_c1 3300050515 Unclassified 802
768 nmdc:mga0a205_810753_c1 3300050515 Bacteria 784
769 Ga0501084_0386346 3300054114 Bacteria 1183
770 Ga0501082_1141349 3300060353 Unclassified 681
771 Ga0530510_0053830 3300061734 Bacteria 2908
772 Ga0114129_10635690
773 JGI24748J21848_1000009
774 JGI24034J26672_10000002
775 Ga0065704_10291397
776 Ga0065712_10000115
777 Ga0065712_10006628
778 Ga0065712_10071716
779 Ga0065712_10083433
780 Ga0065715_10002551
781 Ga0065715_10089398
782 Ga0065715_10094481
783 Ga0065715_10209776
784 Ga0065715_10266707
785 Ga0065715_10351604
786 Ga0065707_10012381
787 Ga0065707_10012506
788 Ga0065707_10027777
789 Ga0065707_10142514
790 Ga0065707_10223968
791 Ga0070676_10105013
792 Ga0070676_10226304
793 Ga0070676_10399130
794 Ga0070690_100001848
795 Ga0070690_100094299
796 Ga0070670_100001896
797 Ga0070670_100005655
798 Ga0070670_100081386
799 Ga0070670_100363943
800 Ga0070670_101146314
801 Ga0068869_100005578
802 Ga0068869_100242457
803 Ga0068869_100262641
804 Ga0068869_100330434
805 Ga0068869_100632438
806 Ga0070666_10163003
807 Ga0070666_10218350
808 Ga0070666_10686804
809 Ga0070680_100362556
810 Ga0070682_100022934
811 Ga0068868_100155043
812 Ga0068868_100352812
813 Ga0068868_100836041
814 Ga0068868_100970505
815 Ga0070660_100084001
816 Ga0070660_100842535
817 Ga0070689_100000365
818 Ga0070689_100046155
819 Ga0070687_100015326
820 Ga0070687_100056571
821 Ga0070687_100162319
822 Ga0070687_100323718
823 Ga0070687_100326824
824 Ga0070687_100742263
825 Ga0070661_100458422
826 Ga0070692_10062414
827 Ga0070692_10608886
828 Ga0070669_100085746
829 Ga0070669_100194881
830 Ga0070669_100746546
831 Ga0070675_100872127
832 Ga0070675_102022989
833 Ga0070671_100001619
834 Ga0070671_100020490
835 Ga0070671_100718760
836 Ga0070673_100117163
837 Ga0070673_100205041
838 Ga0070673_100223758
839 Ga0070673_100393031
840 Ga0070673_100408945
841 Ga0070673_100470786
842 Ga0070673_100821192
843 Ga0070688_100540817
844 Ga0070688_100544425
845 Ga0070688_101072712
846 Ga0070659_100011023
847 Ga0070659_100044743
848 Ga0070703_10078535
849 Ga0070709_10464811
850 Ga0070701_10052259
851 Ga0070701_10137271
852 Ga0070701_10144471
853 Ga0070701_10308669
854 Ga0070701_10406820
855 Ga0070705_100024210
856 Ga0070705_100399891
857 Ga0070705_100674630
858 Ga0070705_101209633
859 Ga0070705_101254464
860 Ga0070705_101359007
861 Ga0070700_100008536
862 Ga0070700_100055863
863 Ga0070700_100141331
864 Ga0070700_100275263
865 Ga0070700_100304929
866 Ga0070700_100736083
867 Ga0070694_100010705
868 Ga0070694_100022379
869 Ga0070694_100040157
870 Ga0070694_100080507
871 Ga0070694_100118583
872 Ga0070694_100316055
873 Ga0070694_100756140
874 Ga0070694_100883639
875 Ga0070694_101009776
876 Ga0070694_101452257
877 Ga0070708_100005329
878 Ga0070708_100218854
879 Ga0070708_100708678
880 Ga0070708_101155241
881 Ga0070663_100464536
882 Ga0070678_100538914
883 Ga0070662_100330033
884 Ga0070662_100670361
885 Ga0070681_10032618
886 Ga0068867_100014420
887 Ga0068867_100198532
888 Ga0070685_10553196
889 Ga0070706_100000259
890 Ga0070706_100008408
891 Ga0070706_100019190
892 Ga0070706_100142919
893 Ga0070707_100006162
894 Ga0070707_100027508
895 Ga0070707_100030544
896 Ga0070707_100218768
897 Ga0070707_100378158
898 Ga0070707_100447706
899 Ga0070707_101018164
900 Ga0070698_100000329
901 Ga0070698_100030054
902 Ga0070698_100093546
903 Ga0070698_100109854
904 Ga0070698_100550921
905 Ga0070699_100001495
906 Ga0070699_100174829
907 Ga0070699_100215078
908 Ga0070699_100586047
909 Ga0070699_100606958
910 Ga0070679_100596709
911 Ga0070684_100114315
912 Ga0070697_100000067
913 Ga0070697_100000382
914 Ga0070697_100027649
915 Ga0070697_100254820
916 Ga0070697_100370685
917 Ga0070697_100403431
918 Ga0068853_100035027
919 Ga0068853_100075818
920 Ga0068853_101059335
921 Ga0070672_100389446
922 Ga0070672_101141513
923 Ga0070686_100014381
924 Ga0070686_100154779
925 Ga0070686_100209321
926 Ga0070686_100222797
927 Ga0070695_100086570
928 Ga0070695_100107966
929 Ga0070695_100133744
930 Ga0070695_100162341
931 Ga0070695_100170047
932 Ga0070695_100179683
933 Ga0070695_100262821
934 Ga0070696_100154709
935 Ga0070696_100194657
936 Ga0070696_100631034
937 Ga0070696_100762578
938 Ga0070693_100407953
939 Ga0070693_100412652
940 Ga0070693_100934280
941 Ga0070704_100025914
942 Ga0070704_100091942
943 Ga0070704_100261548
944 Ga0070704_100505784
945 Ga0070704_100565308
946 Ga0070704_100599520
947 Ga0070704_100852750
948 Ga0070664_100046789
949 Ga0070664_100060678
950 Ga0070664_100349687
951 Ga0070664_100386186
952 Ga0070664_100636663
953 Ga0070664_100946117
954 Ga0068857_100092544
955 Ga0068857_100428237
956 Ga0068857_100428950
957 Ga0068857_100479187
958 Ga0068857_101082311
959 Ga0068854_100715041
960 Ga0068854_100757122
961 Ga0068856_100017050
962 Ga0070702_100016427
963 Ga0070702_100058810
964 Ga0070702_100092093
965 Ga0070702_100109379
966 Ga0068852_100232747
967 Ga0068852_101512227
968 Ga0068852_101815174
969 Ga0068859_100000244
970 Ga0068859_100009777
971 Ga0068859_100014183
972 Ga0068859_100022044
973 Ga0068859_100030303
974 Ga0068859_100085743
975 Ga0068859_100153944
976 Ga0068859_100185027
977 Ga0068859_100238116
978 Ga0068859_100329273
979 Ga0068859_100381243
980 Ga0068859_100496541
981 Ga0068859_100893087
982 Ga0068859_101018982
983 Ga0068864_100000909
984 Ga0068864_100064647
985 Ga0068864_100100036
986 Ga0068864_100149914
987 Ga0068864_100158269
988 Ga0068864_100594306
989 Ga0068864_100684597
990 Ga0068866_10015012
991 Ga0068866_10449392
992 Ga0068861_100034482
993 Ga0068861_100106738
994 Ga0068861_100691515
995 Ga0068861_100830109
996 Ga0068861_100920165
997 Ga0068861_100969898
998 Ga0068861_101914151
999 Ga0068851_10364640
1000 Ga0068870_10225706
1001 Ga0068863_100177410
1002 Ga0068863_100210070
1003 Ga0068863_100290900
1004 Ga0068863_100444639
1005 Ga0068863_100683907
1006 Ga0068863_100806237
1007 Ga0068858_100010270
1008 Ga0068858_100065558
1009 Ga0068858_100093212
1010 Ga0068858_100114618
1011 Ga0068858_100246287
1012 Ga0068858_100253942
1013 Ga0068858_100382472
1014 Ga0068858_100437145
1015 Ga0068860_100168360
1016 Ga0068860_100182778
1017 Ga0068860_100710034
1018 Ga0068860_101288203
1019 Ga0068860_101346906
1020 Ga0068862_100022886
1021 Ga0068862_100064329
1022 Ga0068862_100136652
1023 Ga0068862_100347310
1024 Ga0068862_100379178
1025 Ga0068862_101412629
1026 Ga0068862_101420855
1027 Ga0081539_10018276
1028 Ga0081539_10042804
1029 Ga0097621_100007440
1030 Ga0097621_100022900
1031 Ga0097621_100948675
1032 Ga0097621_101666269
1033 Ga0068871_100007211
1034 Ga0068871_100011100
1035 Ga0068871_100018410
1036 Ga0068871_100039001
1037 Ga0068871_100770212
1038 Ga0075428_100113401
1039 Ga0075428_100915481
1040 Ga0075428_101036391
1041 Ga0075430_100632580
1042 Ga0075431_100337097
1043 Ga0075433_10045393
1044 Ga0075433_10194435
1045 Ga0075433_10396452
1046 Ga0075433_10485644
1047 Ga0075434_100081225
1048 Ga0075434_100095695
1049 Ga0075434_100131979
1050 Ga0075434_100152751
1051 Ga0075434_100163038
1052 Ga0075434_100919572
1053 Ga0075429_100278143
1054 Ga0075429_100538070
1055 Ga0075429_101410587
1056 Ga0068865_100221730
1057 Ga0068865_100795769
1058 Ga0075436_100000051
1059 Ga0075436_100283373
1060 Ga0097620_100000244
1061 Ga0097620_100009778
1062 Ga0097620_100014182
1063 Ga0097620_100022045
1064 Ga0097620_100030303
1065 Ga0097620_100085736
1066 Ga0097620_100153951
1067 Ga0097620_100185041
1068 Ga0097620_100238101
1069 Ga0097620_100329272
1070 Ga0097620_100381259
1071 Ga0097620_100496519
1072 Ga0097620_100658866
1073 Ga0097620_100893093
1074 Ga0097620_101019005
1075 Ga0075435_100001157
1076 Ga0075435_100338303
1077 Ga0075435_100494963
1078 Ga0099794_10057302
1079 Ga0099795_10077305
1080 Ga0105240_10041967
1081 Ga0111539_10015341
1082 Ga0111539_10050543
1083 Ga0111539_10079984
1084 Ga0111539_10092222
1085 Ga0105245_10096543
1086 Ga0105245_10217826
1087 Ga0105245_10255340
1088 Ga0105245_10621347
1089 Ga0105245_11212772
1090 Ga0105245_11766496
1091 Ga0105247_10000031
1092 Ga0105247_10000439
1093 Ga0105247_10052305
1094 Ga0105247_10080948
1095 Ga0114129_10037001
1096 Ga0114129_10075385
1097 Ga0114129_10210166
1098 Ga0114129_10240082
1099 Ga0114129_10259190
1100 Ga0114129_10640997
1101 Ga0114129_10653254
1102 Ga0114129_11401287
1103 Ga0105243_10000245
1104 Ga0105243_10011028
1105 Ga0105243_10214692
1106 Ga0105243_11027120
1107 Ga0105243_11143951
1108 Ga0105241_10155540
1109 Ga0105241_10176228
1110 Ga0105241_10186960
1111 Ga0105241_10209433
1112 Ga0105241_10505255
1113 Ga0105241_11638480
1114 Ga0105242_10000095
1115 Ga0105242_10001963
1116 Ga0105242_10025417
1117 Ga0105242_10040360
1118 Ga0105242_10172206
1119 Ga0105242_10240228
1120 Ga0105242_12153489
1121 Ga0105248_10002613
1122 Ga0105248_10014258
1123 Ga0105248_10156790
1124 Ga0105248_10216760
1125 Ga0105248_10248840
1126 Ga0105248_10331410
1127 Ga0105248_10408746
1128 Ga0105248_10634700
1129 Ga0105248_10682625
1130 Ga0105248_10800580
1131 Ga0105248_10865066
1132 Ga0105248_10970656
1133 Ga0105248_11519841
1134 Ga0105248_12544580
1135 Ga0105237_10315418
1136 Ga0105237_11749185
1137 Ga0105238_10001402
1138 Ga0105249_10000030
1139 Ga0105249_10098930
1140 Ga0105249_10100079
1141 Ga0105249_10136102
1142 Ga0105249_10137928
1143 Ga0105249_10276157
1144 Ga0105249_10320085
1145 Ga0105249_10700640
1146 Ga0099796_10246453
1147 Ga0105239_10160805
1148 Ga0105239_10768983
1149 Ga0105246_10054526
1150 Ga0105246_10059783
1151 Ga0105246_10192600
1152 Ga0105246_10507271
1153 Ga0157371_10526103
1154 Ga0157374_10253340
1155 Ga0157374_10318994
1156 Ga0157374_11181383
1157 Ga0157378_10003126
1158 Ga0157378_10004927
1159 Ga0157378_10034902
1160 Ga0157378_10081136
1161 Ga0157378_10111635
1162 Ga0157378_10140961
1163 Ga0157378_10145639
1164 Ga0157378_10317687
1165 Ga0157378_10342782
1166 Ga0157378_10702630
1167 Ga0157378_10806169
1168 Ga0157378_10911752
1169 Ga0157378_10934788
1170 Ga0157378_10999712
1171 Ga0157378_11295269
1172 Ga0163162_10000002
1173 Ga0163162_10029036
1174 Ga0163162_10086416
1175 Ga0163162_10111398
1176 Ga0163162_10176583
1177 Ga0163162_10386259
1178 Ga0163162_10570637
1179 Ga0163162_10786747
1180 Ga0163162_11273997
1181 Ga0163162_12165041
1182 Ga0157372_10056272
1183 Ga0157372_10094611
1184 Ga0157372_10751536
1185 Ga0157372_10777802
1186 Ga0157375_10006611
1187 Ga0157375_10049685
1188 Ga0157375_10166948
1189 Ga0157375_10285181
1190 Ga0157375_10318616
1191 Ga0157375_10518456
1192 Ga0157375_10642887
1193 Ga0157375_11950963
1194 Ga0163163_10000382
1195 Ga0163163_10029205
1196 Ga0163163_10477843
1197 Ga0163163_10607818
1198 Ga0163163_10648072
1199 Ga0163163_10850380
1200 Ga0163163_10872466
1201 Ga0157380_10003354
1202 Ga0157380_10156534
1203 Ga0157380_10215551
1204 Ga0157380_10485188
1205 Ga0157380_10541153
1206 Ga0157380_11244389
1207 Ga0157377_10029501
1208 Ga0157377_10116123
1209 Ga0157377_10413443
1210 Ga0157377_10484669
1211 Ga0157379_10071150
1212 Ga0157379_10094631
1213 Ga0157379_10338082
1214 Ga0157376_10010782
1215 Ga0157376_10315306
1216 Ga0163161_10040108
1217 Ga0163161_10417991
1218 Ga0163161_10655563
1219 Ga0213876_10000006
1220 Ga0213876_10001003
1221 Ga0207672_1000119
1222 Ga0207653_10000164
1223 Ga0207642_10196863
1224 Ga0207642_10353038
1225 Ga0207710_10000003
1226 Ga0207710_10001421
1227 Ga0207710_10014635
1228 Ga0207710_10240078
1229 Ga0207647_10021627
1230 Ga0207647_10064600
1231 Ga0207643_10152348
1232 Ga0207643_10324130
1233 Ga0207643_10555340
1234 Ga0207684_10001105
1235 Ga0207684_10006931
1236 Ga0207684_10103193
1237 Ga0207684_10123832
1238 Ga0207684_10647217
1239 Ga0207684_11177719
1240 Ga0207654_10037149
1241 Ga0207654_10038801
1242 Ga0207654_10422549
1243 Ga0207707_10620834
1244 Ga0207695_10016042
1245 Ga0207671_10200912
1246 Ga0207660_10344824
1247 Ga0207662_10036841
1248 Ga0207662_10071580
1249 Ga0207662_10072497
1250 Ga0207662_10104087
1251 Ga0207662_10233106
1252 Ga0207662_10921656
1253 Ga0207657_10061974
1254 Ga0207649_10093316
1255 Ga0207649_11266454
1256 Ga0207652_10604602
1257 Ga0207646_10004046
1258 Ga0207646_10037628
1259 Ga0207646_10115919
1260 Ga0207646_10239246
1261 Ga0207646_10484973
1262 Ga0207646_10494721
1263 Ga0207646_10495856
1264 Ga0207646_10631516
1265 Ga0207646_10831598
1266 Ga0207681_10004016
1267 Ga0207681_10047369
1268 Ga0207681_10358177
1269 Ga0207694_10005083
1270 Ga0207694_10329696
1271 Ga0207650_10000374
1272 Ga0207650_10001930
1273 Ga0207650_10133643
1274 Ga0207650_10210354
1275 Ga0207644_10212584
1276 Ga0207644_10746184
1277 Ga0207690_10029654
1278 Ga0207690_10128464
1279 Ga0207706_10173662
1280 Ga0207706_10212621
1281 Ga0207686_10000126
1282 Ga0207686_10310781
1283 Ga0207686_10455826
1284 Ga0207709_10000258
1285 Ga0207709_10035658
1286 Ga0207709_10096475
1287 Ga0207709_10182822
1288 Ga0207709_10282923
1289 Ga0207709_10405364
1290 Ga0207709_10620347
1291 Ga0207709_10699820
1292 Ga0207670_10001852
1293 Ga0207670_10039291
1294 Ga0207670_10469276
1295 Ga0207670_11119067
1296 Ga0207704_10028003
1297 Ga0207704_10164937
1298 Ga0207704_10245731
1299 Ga0207665_10338400
1300 Ga0207691_10064005
1301 Ga0207691_11190489
1302 Ga0207711_10005891
1303 Ga0207711_10052395
1304 Ga0207711_10203868
1305 Ga0207711_10207215
1306 Ga0207711_10431174
1307 Ga0207711_10538531
1308 Ga0207711_10646277
1309 Ga0207711_10703321
1310 Ga0207689_10004044
1311 Ga0207689_10004842
1312 Ga0207689_10007067
1313 Ga0207689_10102908
1314 Ga0207689_10240999
1315 Ga0207689_10778425
1316 Ga0207661_10952662
1317 Ga0207679_10147041
1318 Ga0207679_10747721
1319 Ga0207651_10001634
1320 Ga0207651_10043834
1321 Ga0207651_11188580
1322 Ga0207712_10000041
1323 Ga0207712_10083623
1324 Ga0207712_10311762
1325 Ga0207712_10590171
1326 Ga0207712_11049880
1327 Ga0207668_10002076
1328 Ga0207640_10625576
1329 Ga0207677_10138526
1330 Ga0207677_10778298
1331 Ga0207677_10888435
1332 Ga0207703_10000056
1333 Ga0207703_10277243
1334 Ga0207703_10281028
1335 Ga0207703_10309117
1336 Ga0207639_10190023
1337 Ga0207639_10370840
1338 Ga0207639_10958907
1339 Ga0207708_10000174
1340 Ga0207708_10005657
1341 Ga0207708_10035008
1342 Ga0207708_10096336
1343 Ga0207708_10226115
1344 Ga0207702_11538538
1345 Ga0207641_10058217
1346 Ga0207641_10191180
1347 Ga0207641_10312033
1348 Ga0207641_10386540
1349 Ga0207641_10843351
1350 Ga0207641_10906264
1351 Ga0207641_11347032
1352 Ga0207648_10047903
1353 Ga0207648_10048640
1354 Ga0207648_10473588
1355 Ga0207676_10093941
1356 Ga0207676_10149381
1357 Ga0207676_10422059
1358 Ga0207676_10734598
1359 Ga0207674_10015940
1360 Ga0207674_10048970
1361 Ga0207674_10074923
1362 Ga0207674_10087829
1363 Ga0207674_10149003
1364 Ga0207675_100063265
1365 Ga0207675_100144887
1366 Ga0207675_100164149
1367 Ga0207675_100644233
1368 Ga0207675_100834573
1369 Ga0207675_100980641
1370 Ga0207675_101018356
1371 Ga0207698_10043245
1372 Ga0207698_11766851
1373 Ga0209588_1073050
1374 Ga0207428_10002967
1375 Ga0207428_10012680
1376 Ga0207428_10088031
1377 Ga0268265_10043433
1378 Ga0268265_10070449
1379 Ga0268265_10127052
1380 Ga0268265_10328831
1381 Ga0268265_11006685
1382 Ga0268264_10017959
1383 Ga0268264_10146317
1384 Ga0268264_10155102
1385 Ga0268264_10282627
1386 Ga0268264_10618503
1387 Ga0268264_10838513
1388 Ga0316183_1181047
1389 Ga0307513_10061040
1390 Ga0307408_100149208
1391 Ga0307408_100250161
1392 Ga0307405_10010993
1393 Ga0307410_10025142
1394 Ga0307406_10016799
1395 Ga0307407_10316864
1396 Ga0307407_10554990
1397 Ga0307412_10185770
1398 Ga0307416_100022791
1399 Ga0307416_100031806
1400 Ga0307416_100226369
1401 Ga0307414_10008915
1402 Ga0307414_10364579
1403 Ga0307411_10034193
1404 Ga0307411_10092057
1405 Ga0307415_100012397
1406 Ga0373948_0087158
1407 Ga0373928_0092389
1408 Ga0373949_0121404
1409 Ga0373951_0011743
1410 Ga0373952_0039503
1411 Ga0373941_0033588
1412 Ga0373941_0141774
1413 Ga0373960_0194230
1414 Ga0373961_0048666
1415 Ga0373931_0715008
1416 Ga0373937_0056407
1417 Ga0373937_0327941
1418 Ga0395898_0462520
1419 Ga0395901_0319542
1420 Ga0242420_086087
1421 Ga0436365_1753418
1422 Ga0439439_0108727
1423 Ga0439434_0029753
1424 Ga0451577_0545610
1425 Ga0453683_0915857
1426 Ga0453684_0501522
1427 Ga0451576_0248334
1428 Ga0451576_1040773
1429 Ga0451576_1647041
1430 Ga0495639_0366570
1431 Ga0495586_0271227
1432 Ga0495621_0086171
1433 Ga0495656_0053047
1434 Ga0495659_0052885
1435 Ga0495613_0527182
1436 Ga0495600_0271325
1437 Ga0495636_0040188
1438 Ga0495672_0129424
1439 Ga0495680_0176272
1440 Ga0495684_0149835
1441 Ga0496102_0098368
1442 Ga0496103_0447682
1443 Ga0496104_0224168
1444 Ga0496106_0047393
1445 Ga0496106_0119387
1446 Ga0496106_0416580
1447 Ga0496107_0659634
1448 Ga0496108_1131431
1449 Ga0496109_0344370
1450 Ga0496110_0440301
1451 Ga0496112_0317288
1452 Ga0496112_0399066
1453 Ga0496112_0713899
1454 Ga0501290_011882
1455 Ga0501296_001108
1456 Ga0501296_057368
1457 Ga0501298_011976
1458 Ga0501298_012381
1459 Ga0501298_023776
1460 Ga0501299_000862
1461 Ga0501302_017074
1462 Ga0501040_0602467
1463 Ga0501041_0366658
1464 Ga0501048_0255529
1465 Ga0501048_1233371
1466 Ga0501198_014731
1467 Ga0501202_004443
1468 Ga0501206_009860
1469 Ga0501207_000793
1470 Ga0501207_000806
1471 Ga0501207_002587
1472 Ga0501209_002628
1473 Ga0501216_019180
1474 Ga0501217_008635
1475 Ga0501217_009534
1476 Ga0501217_174855
1477 Ga0501223_009977
1478 Ga0501224_000720
1479 Ga0501227_003134
1480 Ga0501228_005337
1481 Ga0501230_003676
1482 Ga0501233_005796
1483 Ga0501233_021229
1484 Ga0501233_051606
1485 Ga0501235_002829
1486 Ga0501235_026483
1487 Ga0501243_003102
1488 Ga0501249_023139
1489 Ga0501252_023696
1490 Ga0501253_128711
1491 Ga0501253_134077
1492 Ga0501259_013102
1493 Ga0501261_027687
1494 Ga0501219_004765
1495 Ga0501221_005933
1496 Ga0501225_0002041
1497 Ga0501225_0004903
1498 Ga0501234_003375
1499 Ga0501234_006265
1500 Ga0501234_022564
1501 Ga0501079_0101721
1502 Ga0501263_001644
1503 Ga0501267_004329
1504 Ga0501273_010157
1505 Ga0501273_060476
1506 Ga0501283_000691
1507 Ga0501283_010763
1508 Ga0501212_032969
1509 Ga0501226_002087
1510 Ga0501226_013425
1511 nmdc:mga05p37_1064907_c1
1512 nmdc:mga05p37_130459_c1
1513 nmdc:mga05p37_1598037_c1
1514 nmdc:mga05p37_2052365_c1
1515 nmdc:mga05p37_228385_c1
1516 nmdc:mga05p37_442400_c1
1517 nmdc:mga05p37_619142_c1
1518 nmdc:mga05p37_73844_c1
1519 nmdc:mga05p37_790282_c1
1520 nmdc:mga09592_322621_c1
1521 nmdc:mga09592_67641_c1
1522 nmdc:mga09592_696263_c1
1523 nmdc:mga06r32_595747_c1
1524 nmdc:mga08y16_5605_c1
1525 nmdc:mga0n895_406719_c1
1526 nmdc:mga0n895_528979_c1
1527 nmdc:mga0n895_570136_c1
1528 nmdc:mga0n895_98729_c1
1529 nmdc:mga0rr50_444659_c1
1530 nmdc:mga0rr50_863_c1
1531 nmdc:mga08x19_116_c1
1532 nmdc:mga0a205_1018059_c1
1533 nmdc:mga0a205_129134_c1
1534 nmdc:mga0a205_174959_c1
1535 nmdc:mga0a205_238075_c1
1536 nmdc:mga0a205_542540_c1
1537 nmdc:mga0a205_577642_c1
1538 nmdc:mga0a205_782360_c1
1539 nmdc:mga0a205_810753_c1
1540 Ga0501084_0386346
1541 Ga0501082_1141349
1542 Ga0530510_0053830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ly9-assembly1.cif.gz_A-2 crystal structure of mutant d471n of the periplasmic domain of cadc 0.893 56 122
4rg6-assembly1.cif.gz_A crystal structure of apc3-apc16 complex 0.8704 52 122
7xn7-assembly1.cif.gz_q rna polymerase ii elongation complex containing spt4/5, elf1, spt6, spn1 and paf1c 0.8563 46 121
5l9t-assembly1.cif.gz_H model of human anaphase-promoting complex/cyclosome (apc/c-cdh1) with e2 ube2s poised for polyubiquitination where ube2s, apc2, and apc11 are modeled into low resolution density 0.8443 52 151
8f15-assembly3.cif.gz_C structure of the stub1 tpr domain in complex with h202, an all-d helicon polypeptide 0.8377 44 151
ID Description Score Start End Superfamily
2gw1A01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8972 50 150 1.25.40.10
af_Q54RH6_40_172_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8816 50 151 1.25.40.10
af_E7F2R1_574_748_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8776 50 150 1.25.40.10
af_F1QE50_190_301_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8774 50 147 1.25.40.10
af_Q4E1W0_2_130_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.872 50 151 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0L0D5N3-F1-model_v4 Cell division cycle 16 0.896 52 153 GO:0005680
GO:0005737
GO:0016567
GO:0031145
GO:0045842
GO:0051301
AF-A0A1G2QDI3-F1-model_v4 Uncharacterized protein 0.882 52 123 GO:0016020
AF-A0A2E7M1N1-F1-model_v4 deleted 0.8658 64 120
AF-J8BF67-F1-model_v4 DAC domain-containing protein 0.8574 50 123 GO:0106408
AF-A0A3T1CG24-F1-model_v4 Uncharacterized protein 0.8571 65 124 GO:0008800

Map