F479973

General Info

Members Datasets Scaffolds Average Seq Length
768 401 1536 333

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0024776|Ga0501069_0024776_403_1599
Length 377
Sequence MDGLLRSAGTGPVVSRFTRPSALGCSSLLLRNVVGRQHMNAMTPLSVLDLSPVGAGMTGAQALRNSLDLAQLCDRLGYTRYWCAEHHNMPSIASSAPDIMIARIAGITEHIRIGSGGIMLPNHAPLMVAERFKVLEALFPGRIDLGLGRAPGTDPATSYMLRRRQGISEEDDFLGRFNELMLLEQRGFPAGHPFHNVRAMPAETNLPPIYLLGSSDYSAQLAAHIGAAFSFAHHFATFDAATAMRLYRDNFRPSQSHERPYAILGTAVVCAGTDAEADRLAATIDLNFVRRAKGQYLPLTLPDEALAYPYTPADRAKIAQNRTKLSFGSPAIVKAKLEALIEATQADEVMITTMIYDHQARRRSYELIAEAFDLTPR

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
128 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
231 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
270 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
271 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
390 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
391 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
392 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
397 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
398 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
399 2902330777 Methylobacterium sp. 2A Isolate Unclassified
400 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
401 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 6.51
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0024776 3300049585 Bacteria 3275
2 ARSoilYngRDRAFT_c00002 3300000042 Bacteria 45421
3 ARcpr5yngRDRAFT_c000018 3300000043 Bacteria 27234
4 ARCol0oldRDRAFT_c00089 3300000045 Bacteria 7810
5 ARCol0yngRDRAFT_1000001 3300000652 Bacteria 73871
6 JGI24032J14994_100067 3300001430 Bacteria 4339
7 JGI24746J21847_1001985 3300001977 Bacteria 3263
8 JGI24739J22299_10000440 3300001989 Bacteria 14450
9 JGI24737J22298_10001374 3300001990 Bacteria 8633
10 JGI24737J22298_10001997 3300001990 Bacteria 7283
11 JGI24743J22301_10001582 3300001991 Bacteria 3205
12 JGI24750J21931_1000246 3300002070 Bacteria 9263
13 JGI24750J21931_1000305 3300002070 Bacteria 8441
14 JGI24745J21846_1000197 3300002073 Bacteria 4909
15 JGI24748J21848_1000363 3300002074 Bacteria 5173
16 JGI24738J21930_10000248 3300002075 Bacteria 14733
17 JGI24749J21850_1003725 3300002076 Bacteria 2134
18 JGI24033J26618_1000456 3300002155 Bacteria 4037
19 JGI24034J26672_10000189 3300002239 Bacteria 8334
20 JGI24742J22300_10000074 3300002244 Bacteria 14130
21 JGI24751J29686_10008333 3300002459 Bacteria 2120
22 JGI25405J52794_10027540 3300003911 Bacteria 1171
23 Ga0065704_10079373 3300005289 Bacteria 4181
24 Ga0065712_10003989 3300005290 Bacteria 6204
25 Ga0065715_10013115 3300005293 Bacteria 6466
26 Ga0065715_10093751 3300005293 Bacteria 4572
27 Ga0070658_10004675 3300005327 Bacteria 11133
28 Ga0070658_10008403 3300005327 Bacteria 8299
29 Ga0070676_10000453 3300005328 Bacteria 19576
30 Ga0070683_100000816 3300005329 Bacteria 23110
31 Ga0070690_100114683 3300005330 Bacteria 1802
32 Ga0070670_100016076 3300005331 Bacteria 6423
33 Ga0070677_10000038 3300005333 Bacteria 40055
34 Ga0068869_100000405 3300005334 Bacteria 23497
35 Ga0070666_10019007 3300005335 Bacteria 4429
36 Ga0070666_10050422 3300005335 Bacteria 2799
37 Ga0070680_100019003 3300005336 Bacteria 5439
38 Ga0070682_100000181 3300005337 Bacteria 47168
39 Ga0070682_100043092 3300005337 Bacteria 2789
40 Ga0068868_100004321 3300005338 Bacteria 9954
41 Ga0068868_100130447 3300005338 Bacteria 2056
42 Ga0070660_100006899 3300005339 Bacteria 7878
43 Ga0070660_100007952 3300005339 Bacteria 7404
44 Ga0070660_100025000 3300005339 Bacteria 4435
45 Ga0070689_100058344 3300005340 Bacteria 2998
46 Ga0070689_100071332 3300005340 Bacteria 2713
47 Ga0070691_10001514 3300005341 Bacteria 9991
48 Ga0070691_10020512 3300005341 Bacteria 3053
49 Ga0070687_100000705 3300005343 Bacteria 11179
50 Ga0070661_100000411 3300005344 Bacteria 33139
51 Ga0070692_10003304 3300005345 Bacteria 6511
52 Ga0070668_100180179 3300005347 Bacteria 1725
53 Ga0070668_100498885 3300005347 Bacteria 1053
54 Ga0070669_100025011 3300005353 Bacteria 4286
55 Ga0070675_100031305 3300005354 Bacteria 4300
56 Ga0070671_100000333 3300005355 Bacteria 32358
57 Ga0070671_100049776 3300005355 Bacteria 3486
58 Ga0070671_100145509 3300005355 Bacteria 2000
59 Ga0070674_100017046 3300005356 Bacteria 4560
60 Ga0070674_100094359 3300005356 Bacteria 2167
61 Ga0070673_100000214 3300005364 Bacteria 28832
62 Ga0070673_100085503 3300005364 Bacteria 2568
63 Ga0070688_100001141 3300005365 Bacteria 13289
64 Ga0070688_100042687 3300005365 Bacteria 2791
65 Ga0070659_100000557 3300005366 Bacteria 27325
66 Ga0070667_100027014 3300005367 Bacteria 4774
67 Ga0070667_100032296 3300005367 Bacteria 4366
68 Ga0070667_100242839 3300005367 Bacteria 1608
69 Ga0070703_10082423 3300005406 Bacteria 1098
70 Ga0070709_10000633 3300005434 Bacteria 20088
71 Ga0070709_10056465 3300005434 Bacteria 2483
72 Ga0070714_100059149 3300005435 Bacteria 3285
73 Ga0070714_100307712 3300005435 Bacteria 1479
74 Ga0070713_100003394 3300005436 Bacteria 10521
75 Ga0070713_100028348 3300005436 Bacteria 4421
76 Ga0070713_100250133 3300005436 Bacteria 1617
77 Ga0070710_10022402 3300005437 Bacteria 3303
78 Ga0070711_100116368 3300005439 Bacteria 1970
79 Ga0070711_100129510 3300005439 Bacteria 1877
80 Ga0070711_100327084 3300005439 Bacteria 1226
81 Ga0070705_100000549 3300005440 Bacteria 21834
82 Ga0070700_100011579 3300005441 Bacteria 4889
83 Ga0070694_100000484 3300005444 Bacteria 21835
84 Ga0070708_100004954 3300005445 Bacteria 10528
85 Ga0070663_100000100 3300005455 Bacteria 39199
86 Ga0070663_100056560 3300005455 Bacteria 2811
87 Ga0070678_100001746 3300005456 Bacteria 11688
88 Ga0070678_100055233 3300005456 Bacteria 2898
89 Ga0070662_100019375 3300005457 Bacteria 4618
90 Ga0070662_100023548 3300005457 Bacteria 4231
91 Ga0070681_10001377 3300005458 Bacteria 21307
92 Ga0070681_10035054 3300005458 Bacteria 5040
93 Ga0070681_10246764 3300005458 Bacteria 1698
94 Ga0068867_100001032 3300005459 Bacteria 19040
95 Ga0070685_10003183 3300005466 Bacteria 8353
96 Ga0070685_10227231 3300005466 Bacteria 1225
97 Ga0070707_100155834 3300005468 Bacteria 2225
98 Ga0070699_100084405 3300005518 Bacteria 2772
99 Ga0070679_100005050 3300005530 Bacteria 12181
100 Ga0070679_100094327 3300005530 Bacteria 2979
101 Ga0070679_100115303 3300005530 Bacteria 2672
102 Ga0070684_100000306 3300005535 Bacteria 33761
103 Ga0070684_100140804 3300005535 Bacteria 2181
104 Ga0070697_100208031 3300005536 Bacteria 1665
105 Ga0068853_100004074 3300005539 Bacteria 11254
106 Ga0070672_100001956 3300005543 Bacteria 12922
107 Ga0070686_100000261 3300005544 Bacteria 36069
108 Ga0070686_100003004 3300005544 Bacteria 9244
109 Ga0070686_100052795 3300005544 Bacteria 2593
110 Ga0070695_100020475 3300005545 Bacteria 4040
111 Ga0070693_100000204 3300005547 Bacteria 27537
112 Ga0070665_100209394 3300005548 Bacteria 1950
113 Ga0070704_100031399 3300005549 Bacteria 3573
114 Ga0068855_100077333 3300005563 Bacteria 3861
115 Ga0068855_100087097 3300005563 Bacteria 3610
116 Ga0070664_100003036 3300005564 Bacteria 13580
117 Ga0070664_100059731 3300005564 Bacteria 3245
118 Ga0070664_100070175 3300005564 Bacteria 3000
119 Ga0070664_100282904 3300005564 Bacteria 1496
120 Ga0068857_100001279 3300005577 Bacteria 19743
121 Ga0068854_100002311 3300005578 Bacteria 11744
122 Ga0068856_100018687 3300005614 Bacteria 6718
123 Ga0068856_100028042 3300005614 Bacteria 5495
124 Ga0068856_100059075 3300005614 Bacteria 3787
125 Ga0068856_100365314 3300005614 Bacteria 1462
126 Ga0070702_100012193 3300005615 Bacteria 4300
127 Ga0068852_100002045 3300005616 Bacteria 13743
128 Ga0068859_100002494 3300005617 Bacteria 18713
129 Ga0068859_100097026 3300005617 Bacteria 3000
130 Ga0068864_100000172 3300005618 Bacteria 59525
131 Ga0068864_100071636 3300005618 Bacteria 3019
132 Ga0068864_100187058 3300005618 Bacteria 1896
133 Ga0068866_10002520 3300005718 Bacteria 7543
134 Ga0068861_100025525 3300005719 Bacteria 4286
135 Ga0068870_10000070 3300005840 Bacteria 32262
136 Ga0068863_100002553 3300005841 Bacteria 18073
137 Ga0068863_100084882 3300005841 Bacteria 3000
138 Ga0068863_100550234 3300005841 Bacteria 1139
139 Ga0068858_100017232 3300005842 Bacteria 6777
140 Ga0068860_100039398 3300005843 Bacteria 4519
141 Ga0068860_100349230 3300005843 Bacteria 1455
142 Ga0068862_100354253 3300005844 Bacteria 1362
143 Ga0081455_10000002 3300005937 Bacteria 460472
144 Ga0081455_10002251 3300005937 Bacteria 22976
145 Ga0081455_10240406 3300005937 Bacteria 1331
146 Ga0081540_1000105 3300005983 Bacteria 89863
147 Ga0081540_1015508 3300005983 Bacteria 4822
148 Ga0070717_10001268 3300006028 Bacteria 17254
149 Ga0075365_10036322 3300006038 Bacteria 3192
150 Ga0070716_100000480 3300006173 Bacteria 16522
151 Ga0070712_100081154 3300006175 Bacteria 2349
152 Ga0097621_100003914 3300006237 Bacteria 10316
153 Ga0097621_100218082 3300006237 Bacteria 1661
154 Ga0068871_100001147 3300006358 Bacteria 17768
155 Ga0068871_100002656 3300006358 Bacteria 12207
156 Ga0068871_100048494 3300006358 Bacteria 3429
157 Ga0075428_100189728 3300006844 Bacteria 2223
158 Ga0075430_100029067 3300006846 Bacteria 4692
159 Ga0075431_100172308 3300006847 Bacteria 2223
160 Ga0075434_100000152 3300006871 Bacteria 42821
161 Ga0075434_100010160 3300006871 Bacteria 8818
162 Ga0075429_100000083 3300006880 Bacteria 49131
163 Ga0068865_100000114 3300006881 Bacteria 40505
164 Ga0075436_100051009 3300006914 Bacteria 2855
165 Ga0097620_100002494 3300006931 Bacteria 18713
166 Ga0097620_100097025 3300006931 Bacteria 3000
167 Ga0075435_100155118 3300007076 Bacteria 1926
168 Ga0105244_10042327 3300009036 Bacteria 2355
169 Ga0105250_10049805 3300009092 Bacteria 1680
170 Ga0105240_10006614 3300009093 Bacteria 17013
171 Ga0105240_10025205 3300009093 Bacteria 7822
172 Ga0111539_10008561 3300009094 Bacteria 12990
173 Ga0111539_10008625 3300009094 Bacteria 12949
174 Ga0111539_10010388 3300009094 Bacteria 11719
175 Ga0111539_10071290 3300009094 Bacteria 4100
176 Ga0105245_10001740 3300009098 Bacteria 19851
177 Ga0105245_10338760 3300009098 Bacteria 1487
178 Ga0105247_10028940 3300009101 Bacteria 3354
179 Ga0114129_10167094 3300009147 Bacteria 3002
180 Ga0105243_10003377 3300009148 Bacteria 12955
181 Ga0105243_10007271 3300009148 Bacteria 8508
182 Ga0105243_10007400 3300009148 Bacteria 8440
183 Ga0105243_10076728 3300009148 Bacteria 2716
184 Ga0105241_10000316 3300009174 Bacteria 36435
185 Ga0105241_10085955 3300009174 Bacteria 2473
186 Ga0105241_10193843 3300009174 Bacteria 1693
187 Ga0105242_10000356 3300009176 Bacteria 36542
188 Ga0105242_10050148 3300009176 Bacteria 3398
189 Ga0105248_10001326 3300009177 Bacteria 27556
190 Ga0105248_10027529 3300009177 Bacteria 6330
191 Ga0105248_10065087 3300009177 Bacteria 4092
192 Ga0105248_10065642 3300009177 Bacteria 4075
193 Ga0105248_10296359 3300009177 Bacteria 1821
194 Ga0105237_10152105 3300009545 Bacteria 2310
195 Ga0105237_10274714 3300009545 Bacteria 1688
196 Ga0105238_10036149 3300009551 Bacteria 5020
197 Ga0105238_10314838 3300009551 Bacteria 1550
198 Ga0105249_10000289 3300009553 Bacteria 51753
199 Ga0105249_10042619 3300009553 Bacteria 4129
200 Ga0105239_10002550 3300010375 Bacteria 23105
201 Ga0105239_10300685 3300010375 Bacteria 1807
202 Ga0105246_10000070 3300011119 Bacteria 42277
203 Ga0105246_10352968 3300011119 Bacteria 1206
204 Ga0157345_1001411 3300012498 Bacteria 1693
205 Ga0157338_1000301 3300012515 Bacteria 2693
206 Ga0157373_10024701 3300013100 Bacteria 4352
207 Ga0157373_10086334 3300013100 Bacteria 2211
208 Ga0157371_10007238 3300013102 Bacteria 9012
209 Ga0157370_10048522 3300013104 Bacteria 4067
210 Ga0157369_10130193 3300013105 Bacteria 2667
211 Ga0157374_10002534 3300013296 Bacteria 15403
212 Ga0157378_10000713 3300013297 Bacteria 31078
213 Ga0157378_10023523 3300013297 Bacteria 5420
214 Ga0157378_10139586 3300013297 Bacteria 2249
215 Ga0163162_10002240 3300013306 Bacteria 18165
216 Ga0163162_10014150 3300013306 Bacteria 7796
217 Ga0163162_10077664 3300013306 Bacteria 3384
218 Ga0157372_10338966 3300013307 Bacteria 1751
219 Ga0157375_10025558 3300013308 Bacteria 5489
220 Ga0157375_10187426 3300013308 Bacteria 2223
221 Ga0157375_10310662 3300013308 Bacteria 1741
222 Ga0163163_10016298 3300014325 Bacteria 6900
223 Ga0163163_10080114 3300014325 Bacteria 3265
224 Ga0163163_10637338 3300014325 Bacteria 1129
225 Ga0157380_10051408 3300014326 Bacteria 3259
226 Ga0157380_10323339 3300014326 Bacteria 1431
227 Ga0157380_10373356 3300014326 Bacteria 1343
228 Ga0157377_10000109 3300014745 Bacteria 56306
229 Ga0157379_10003826 3300014968 Bacteria 12833
230 Ga0157376_10000352 3300014969 Bacteria 30620
231 Ga0157376_10041765 3300014969 Bacteria 3757
232 Ga0157376_10177252 3300014969 Bacteria 1945
233 Ga0163161_10000132 3300017792 Bacteria 70304
234 Ga0213875_10011974 3300021388 Bacteria 4298
235 Ga0207666_1000018 3300025271 Bacteria 39246
236 Ga0207666_1001398 3300025271 Bacteria 2844
237 Ga0207673_1002758 3300025290 Bacteria 2021
238 Ga0207697_10000078 3300025315 Bacteria 42249
239 Ga0207655_1040419 3300025728 Bacteria 2012
240 Ga0207653_10002169 3300025885 Bacteria 6243
241 Ga0207653_10065018 3300025885 Bacteria 1238
242 Ga0207682_10041168 3300025893 Bacteria 1885
243 Ga0207692_10000792 3300025898 Bacteria 11235
244 Ga0207692_10024243 3300025898 Bacteria 2818
245 Ga0207692_10028081 3300025898 Bacteria 2657
246 Ga0207642_10003174 3300025899 Bacteria 5158
247 Ga0207642_10035155 3300025899 Bacteria 2137
248 Ga0207710_10013944 3300025900 Bacteria 3385
249 Ga0207688_10000472 3300025901 Bacteria 19294
250 Ga0207680_10016345 3300025903 Bacteria 3893
251 Ga0207680_10032374 3300025903 Bacteria 2972
252 Ga0207680_10110589 3300025903 Bacteria 1781
253 Ga0207685_10055838 3300025905 Bacteria 1543
254 Ga0207699_10000206 3300025906 Bacteria 35327
255 Ga0207699_10011558 3300025906 Bacteria 4464
256 Ga0207699_10024354 3300025906 Bacteria 3309
257 Ga0207645_10000110 3300025907 Bacteria 61329
258 Ga0207645_10036805 3300025907 Bacteria 3142
259 Ga0207643_10000108 3300025908 Bacteria 56497
260 Ga0207654_10000847 3300025911 Bacteria 16869
261 Ga0207654_10094862 3300025911 Bacteria 1827
262 Ga0207707_10002724 3300025912 Bacteria 15782
263 Ga0207707_10007347 3300025912 Bacteria 9600
264 Ga0207707_10070287 3300025912 Bacteria 3051
265 Ga0207707_10076909 3300025912 Bacteria 2913
266 Ga0207695_10037186 3300025913 Bacteria 5254
267 Ga0207695_10140888 3300025913 Bacteria 2360
268 Ga0207671_10104985 3300025914 Bacteria 2143
269 Ga0207693_10001508 3300025915 Bacteria 20551
270 Ga0207693_10172171 3300025915 Bacteria 1704
271 Ga0207663_10021383 3300025916 Bacteria 3682
272 Ga0207663_10132110 3300025916 Bacteria 1726
273 Ga0207660_10000927 3300025917 Bacteria 19361
274 Ga0207660_10030334 3300025917 Bacteria 3716
275 Ga0207660_10098869 3300025917 Bacteria 2177
276 Ga0207660_10142360 3300025917 Bacteria 1834
277 Ga0207662_10000400 3300025918 Bacteria 19294
278 Ga0207657_10005770 3300025919 Bacteria 12909
279 Ga0207657_10011852 3300025919 Bacteria 8631
280 Ga0207657_10012169 3300025919 Bacteria 8502
281 Ga0207657_10049877 3300025919 Bacteria 3645
282 Ga0207649_10000064 3300025920 Bacteria 96018
283 Ga0207649_10045601 3300025920 Bacteria 2688
284 Ga0207649_10105555 3300025920 Bacteria 1873
285 Ga0207649_10225184 3300025920 Bacteria 1338
286 Ga0207652_10000128 3300025921 Bacteria 82012
287 Ga0207652_10040036 3300025921 Bacteria 3979
288 Ga0207652_10046535 3300025921 Bacteria 3701
289 Ga0207652_10531324 3300025921 Bacteria 1058
290 Ga0207646_10170417 3300025922 Bacteria 1966
291 Ga0207681_10000024 3300025923 Bacteria 206607
292 Ga0207694_10254509 3300025924 Bacteria 1437
293 Ga0207650_10040359 3300025925 Bacteria 3415
294 Ga0207659_10000034 3300025926 Bacteria 108227
295 Ga0207687_10002195 3300025927 Bacteria 13307
296 Ga0207687_10004808 3300025927 Bacteria 8985
297 Ga0207687_10119381 3300025927 Bacteria 1970
298 Ga0207700_10052208 3300025928 Bacteria 3055
299 Ga0207644_10012991 3300025931 Bacteria 5541
300 Ga0207644_10023890 3300025931 Bacteria 4192
301 Ga0207690_10000068 3300025932 Bacteria 90571
302 Ga0207690_10042993 3300025932 Bacteria 2971
303 Ga0207690_10089544 3300025932 Bacteria 2170
304 Ga0207690_10238695 3300025932 Bacteria 1399
305 Ga0207706_10002009 3300025933 Bacteria 19919
306 Ga0207706_10011231 3300025933 Bacteria 8166
307 Ga0207706_10046315 3300025933 Bacteria 3851
308 Ga0207686_10001995 3300025934 Bacteria 11251
309 Ga0207686_10030832 3300025934 Bacteria 3179
310 Ga0207686_10050496 3300025934 Bacteria 2586
311 Ga0207709_10000855 3300025935 Bacteria 23265
312 Ga0207709_10001896 3300025935 Bacteria 13797
313 Ga0207709_10016314 3300025935 Bacteria 4127
314 Ga0207670_10000057 3300025936 Bacteria 83573
315 Ga0207670_10043652 3300025936 Bacteria 2962
316 Ga0207669_10000005 3300025937 Bacteria 185218
317 Ga0207669_10154535 3300025937 Bacteria 1612
318 Ga0207669_10190363 3300025937 Bacteria 1479
319 Ga0207704_10000518 3300025938 Bacteria 17169
320 Ga0207665_10000639 3300025939 Bacteria 23591
321 Ga0207691_10000543 3300025940 Bacteria 37760
322 Ga0207691_10094996 3300025940 Bacteria 2667
323 Ga0207711_10001965 3300025941 Bacteria 18685
324 Ga0207711_10004883 3300025941 Bacteria 11380
325 Ga0207711_10093228 3300025941 Bacteria 2652
326 Ga0207689_10004415 3300025942 Bacteria 12772
327 Ga0207661_10000036 3300025944 Bacteria 149720
328 Ga0207679_10000025 3300025945 Bacteria 203699
329 Ga0207679_10235111 3300025945 Bacteria 1549
330 Ga0207679_10269978 3300025945 Bacteria 1454
331 Ga0207667_10178917 3300025949 Bacteria 2178
332 Ga0207667_10379097 3300025949 Bacteria 1441
333 Ga0207651_10000014 3300025960 Bacteria 166931
334 Ga0207651_10430541 3300025960 Bacteria 1128
335 Ga0207712_10002668 3300025961 Bacteria 11413
336 Ga0207668_10000352 3300025972 Bacteria 29941
337 Ga0207640_10000421 3300025981 Bacteria 26475
338 Ga0207640_10162621 3300025981 Bacteria 1653
339 Ga0207658_10003963 3300025986 Bacteria 10397
340 Ga0207677_10003964 3300026023 Bacteria 7889
341 Ga0207677_10028519 3300026023 Bacteria 3532
342 Ga0207703_10001824 3300026035 Bacteria 19005
343 Ga0207703_10055387 3300026035 Bacteria 3226
344 Ga0207703_10058474 3300026035 Bacteria 3147
345 Ga0207703_10304604 3300026035 Bacteria 1454
346 Ga0207639_10001709 3300026041 Bacteria 14792
347 Ga0207678_10000292 3300026067 Bacteria 45164
348 Ga0207708_10006528 3300026075 Bacteria 8633
349 Ga0207702_10006197 3300026078 Bacteria 10340
350 Ga0207702_10023890 3300026078 Bacteria 5071
351 Ga0207702_10137541 3300026078 Bacteria 2206
352 Ga0207641_10001199 3300026088 Bacteria 25972
353 Ga0207641_10053966 3300026088 Bacteria 3408
354 Ga0207648_10010793 3300026089 Bacteria 8631
355 Ga0207676_10071630 3300026095 Bacteria 2783
356 Ga0207674_10000376 3300026116 Bacteria 58065
357 Ga0207674_10034279 3300026116 Bacteria 5309
358 Ga0207674_10262775 3300026116 Bacteria 1673
359 Ga0207675_100001596 3300026118 Bacteria 22711
360 Ga0207675_100111791 3300026118 Bacteria 2578
361 Ga0207675_100160338 3300026118 Bacteria 2145
362 Ga0207683_10000001 3300026121 Bacteria 352047
363 Ga0207683_10002869 3300026121 Bacteria 15029
364 Ga0207683_10122759 3300026121 Bacteria 2333
365 Ga0207698_10010314 3300026142 Bacteria 5993
366 Ga0209995_1008330 3300027471 Bacteria 1671
367 Ga0210002_1005271 3300027617 Bacteria 1941
368 Ga0209983_1007022 3300027665 Bacteria 2313
369 Ga0209971_1002532 3300027682 Bacteria 4382
370 Ga0209998_10001583 3300027717 Bacteria 5468
371 Ga0209974_10009288 3300027876 Bacteria 3338
372 Ga0207428_10000162 3300027907 Bacteria 92143
373 Ga0207428_10000233 3300027907 Bacteria 76679
374 Ga0268266_10006428 3300028379 Bacteria 10762
375 Ga0268265_10000477 3300028380 Bacteria 42056
376 Ga0268265_10039527 3300028380 Bacteria 3478
377 Ga0265337_1010268 3300028556 Bacteria 3289
378 Ga0265330_10017380 3300031235 Bacteria 3313
379 Ga0265325_10000056 3300031241 Bacteria 77353
380 Ga0265325_10028790 3300031241 Bacteria 2990
381 Ga0265325_10051744 3300031241 Bacteria 2110
382 Ga0265325_10061674 3300031241 Bacteria 1901
383 Ga0265325_10106072 3300031241 Bacteria 1370
384 Ga0265340_10029737 3300031247 Bacteria 2743
385 Ga0265316_10059614 3300031344 Bacteria 2968
386 Ga0265313_10004705 3300031595 Bacteria 10304
387 Ga0265313_10017518 3300031595 Bacteria 4067
388 Ga0265313_10024646 3300031595 Bacteria 3209
389 Ga0265313_10027453 3300031595 Bacteria 2979
390 Ga0265313_10040120 3300031595 Bacteria 2317
391 Ga0265342_10000678 3300031712 Bacteria 35577
392 Ga0316583_10007481 3300032133 Bacteria 3932
393 Ga0316583_10039251 3300032133 Bacteria 1677
394 Ga0373930_0000382 3300034816 Bacteria 5829
395 Ga0373948_0000058 3300034817 Bacteria 11621
396 Ga0373948_0004860 3300034817 Bacteria 2147
397 Ga0373950_0000150 3300034818 Bacteria 10800
398 Ga0373959_0003744 3300034820 Bacteria 2435
399 Ga0373926_0004892 3300035083 Bacteria 4404
400 Ga0373926_0011016 3300035083 Bacteria 3038
401 Ga0373928_0001785 3300035084 Bacteria 4182
402 Ga0373928_0006324 3300035084 Bacteria 2278
403 Ga0373929_0000396 3300035085 Bacteria 8193
404 Ga0373934_0006297 3300035086 Bacteria 4399
405 Ga0373940_0000198 3300035088 Bacteria 8333
406 Ga0373940_0005664 3300035088 Bacteria 2721
407 Ga0373951_0000402 3300035091 Bacteria 12772
408 Ga0373951_0002227 3300035091 Bacteria 4928
409 Ga0373952_0002375 3300035092 Bacteria 3392
410 Ga0373952_0024858 3300035092 Bacteria 1289
411 Ga0373923_0012471 3300035111 Bacteria 3142
412 Ga0373923_0024122 3300035111 Bacteria 2399
413 Ga0373932_0000422 3300035112 Bacteria 12880
414 Ga0373932_0001273 3300035112 Bacteria 7145
415 Ga0373932_0002346 3300035112 Bacteria 4808
416 Ga0373939_0000992 3300035114 Bacteria 7022
417 Ga0373939_0002087 3300035114 Bacteria 4762
418 Ga0373939_0028488 3300035114 Bacteria 1590
419 Ga0373939_0028987 3300035114 Bacteria 1580
420 Ga0373939_0044705 3300035114 Bacteria 1349
421 Ga0373941_0000394 3300035115 Bacteria 8672
422 Ga0373941_0000706 3300035115 Bacteria 6836
423 Ga0373945_0004515 3300035116 Bacteria 4423
424 Ga0373945_0004999 3300035116 Bacteria 4223
425 Ga0373953_0023243 3300035117 Bacteria 2346
426 Ga0373953_0105321 3300035117 Bacteria 1189
427 Ga0373954_0002988 3300035118 Bacteria 7132
428 Ga0373954_0014409 3300035118 Bacteria 3525
429 Ga0373954_0021523 3300035118 Bacteria 2921
430 Ga0373956_0011467 3300035119 Bacteria 3654
431 Ga0373956_0031549 3300035119 Bacteria 2323
432 Ga0373957_0013839 3300035120 Bacteria 2746
433 Ga0373957_0025061 3300035120 Bacteria 2146
434 Ga0373957_0031469 3300035120 Bacteria 1949
435 Ga0373957_0074554 3300035120 Bacteria 1332
436 Ga0373960_0000500 3300035121 Bacteria 7813
437 Ga0373960_0000563 3300035121 Bacteria 7529
438 Ga0373960_0013690 3300035121 Bacteria 2042
439 Ga0373960_0028007 3300035121 Bacteria 1552
440 Ga0373943_0059962 3300035170 Bacteria 1898
441 Ga0373946_0004347 3300035171 Bacteria 5072
442 Ga0373946_0005977 3300035171 Bacteria 4412
443 Ga0373955_0001354 3300035172 Bacteria 10406
444 Ga0373955_0035879 3300035172 Bacteria 2629
445 Ga0373942_0000840 3300035207 Bacteria 8426
446 Ga0373942_0002597 3300035207 Bacteria 4356
447 Ga0373961_0000477 3300035241 Bacteria 15735
448 Ga0373962_0030991 3300035242 Bacteria 1465
449 Ga0373931_0000072 3300035691 Bacteria 49094
450 Ga0373931_0261514 3300035691 Bacteria 1056
451 Ga0373935_0015391 3300035692 Bacteria 4623
452 Ga0373935_0116561 3300035692 Bacteria 1779
453 Ga0373927_0036614 3300035695 Bacteria 3190
454 Ga0373927_0196503 3300035695 Bacteria 1324
455 Ga0373933_0000125 3300035724 Bacteria 49268
456 Ga0373933_0021903 3300035724 Bacteria 3635
457 Ga0373933_0041268 3300035724 Bacteria 2723
458 Ga0373933_0088886 3300035724 Bacteria 1904
459 Ga0373933_0171285 3300035724 Bacteria 1381
460 Ga0373947_0033560 3300035725 Bacteria 3031
461 Ga0373937_0014493 3300036401 Bacteria 6961
462 Ga0373937_0033957 3300036401 Bacteria 4637
463 Ga0373937_0040686 3300036401 Bacteria 4237
464 Ga0373937_0137594 3300036401 Bacteria 2284
465 Ga0373937_0250333 3300036401 Bacteria 1670
466 Ga0316582_0175089 3300036647 Bacteria 1458
467 Ga0373925_0003474 3300037068 Bacteria 12189
468 Ga0373925_0204574 3300037068 Bacteria 1571
469 Ga0373925_0280247 3300037068 Bacteria 1342
470 Ga0395899_0001464 3300037312 Bacteria 20108
471 Ga0395899_0113180 3300037312 Bacteria 1949
472 Ga0395900_0004156 3300037418 Bacteria 15405
473 Ga0395900_0028820 3300037418 Bacteria 5691
474 Ga0395900_0385701 3300037418 Bacteria 1368
475 Ga0395898_0046519 3300037466 Bacteria 4262
476 Ga0395898_0104989 3300037466 Bacteria 2709
477 Ga0395901_0005692 3300038443 Bacteria 12611
478 Ga0395901_0029628 3300038443 Bacteria 5636
479 Ga0395901_0084183 3300038443 Bacteria 3324
480 Ga0395901_0257408 3300038443 Bacteria 1817
481 Ga0436365_0372867 3300039437 Bacteria 17301
482 Ga0436365_0820123 3300039437 Bacteria 3120
483 Ga0436365_1568977 3300039437 Bacteria 3058
484 Ga0436365_1738433 3300039437 Bacteria 1223
485 Ga0436362_1144858 3300039453 Bacteria 1952
486 Ga0439441_001669 3300042001 Bacteria 2974
487 Ga0439455_0016744 3300042012 Bacteria 1699
488 Ga0439463_019847 3300042016 Bacteria 1675
489 Ga0466963_0017496 3300044694 Bacteria 4468
490 Ga0466963_0054193 3300044694 Bacteria 2665
491 Ga0453684_0127838 3300044712 Bacteria 3055
492 Ga0466968_0023795 3300044735 Bacteria 2498
493 Ga0466957_0092053 3300044842 Bacteria 1901
494 Ga0466967_0015735 3300045976 Bacteria 5941
495 Ga0466967_0088085 3300045976 Bacteria 2816
496 Ga0495617_015485 3300046452 Bacteria 2583
497 Ga0495592_0001181 3300046454 Bacteria 18113
498 Ga0495592_0076889 3300046454 Bacteria 2421
499 Ga0495592_0100625 3300046454 Bacteria 2060
500 Ga0495603_0012384 3300046455 Bacteria 5165
501 Ga0495603_0026393 3300046455 Bacteria 3509
502 Ga0495603_0060412 3300046455 Bacteria 2239
503 Ga0495629_0000301 3300046459 Bacteria 42369
504 Ga0495629_0050019 3300046459 Bacteria 2928
505 Ga0495629_0103735 3300046459 Bacteria 1983
506 Ga0495641_0019106 3300046461 Bacteria 3517
507 Ga0495641_0019449 3300046461 Bacteria 3473
508 Ga0495641_0063237 3300046461 Bacteria 1668
509 Ga0495651_0016908 3300046462 Bacteria 5648
510 Ga0495651_0027832 3300046462 Bacteria 4405
511 Ga0495653_0014682 3300046463 Bacteria 6391
512 Ga0495653_0020138 3300046463 Bacteria 5407
513 Ga0495653_0088891 3300046463 Bacteria 2265
514 Ga0495653_0125526 3300046463 Bacteria 1823
515 Ga0495580_0015866 3300046472 Bacteria 5669
516 Ga0495582_0002821 3300046473 Bacteria 9715
517 Ga0495582_0004575 3300046473 Bacteria 7769
518 Ga0495582_0026830 3300046473 Bacteria 3156
519 Ga0495639_0005189 3300046475 Bacteria 5594
520 Ga0495662_0011789 3300046476 Bacteria 4270
521 Ga0495664_0026606 3300046477 Bacteria 3369
522 Ga0495664_0165925 3300046477 Bacteria 1340
523 Ga0495585_0001941 3300046492 Bacteria 15445
524 Ga0495594_0023857 3300046499 Bacteria 3280
525 Ga0495594_0055738 3300046499 Bacteria 2180
526 Ga0495594_0096813 3300046499 Bacteria 1658
527 Ga0495607_0147098 3300046501 Bacteria 1209
528 Ga0495608_0009131 3300046511 Bacteria 6931
529 Ga0495608_0018950 3300046511 Bacteria 4743
530 Ga0495618_0019200 3300046514 Bacteria 4203
531 Ga0495618_0037823 3300046514 Bacteria 3031
532 Ga0495628_0012129 3300046516 Bacteria 7265
533 Ga0495628_0016608 3300046516 Bacteria 6137
534 Ga0495628_0029251 3300046516 Bacteria 4469
535 Ga0495628_0187587 3300046516 Bacteria 1562
536 Ga0495630_0304653 3300046517 Bacteria 1217
537 Ga0495637_0060008 3300046520 Bacteria 1564
538 Ga0495643_0086391 3300046522 Bacteria 1625
539 Ga0495644_0000364 3300046523 Bacteria 20566
540 Ga0495663_0010349 3300046525 Bacteria 2593
541 Ga0495666_0022871 3300046526 Bacteria 3093
542 Ga0495652_0059574 3300046529 Bacteria 3230
543 Ga0495652_0076732 3300046529 Bacteria 2771
544 Ga0495665_0128298 3300046531 Bacteria 1328
545 Ga0495640_0095123 3300046533 Bacteria 1961
546 Ga0495640_0163102 3300046533 Bacteria 1427
547 Ga0495587_0004237 3300046536 Bacteria 9484
548 Ga0495587_0035780 3300046536 Bacteria 2990
549 Ga0495587_0059576 3300046536 Bacteria 2240
550 Ga0495587_0088564 3300046536 Bacteria 1790
551 Ga0495598_0001458 3300046537 Bacteria 4695
552 Ga0495609_0019877 3300046538 Bacteria 3106
553 Ga0495645_0004138 3300046543 Bacteria 9909
554 Ga0495645_0026276 3300046543 Bacteria 4225
555 Ga0495622_0040633 3300046557 Bacteria 2164
556 Ga0495633_0002099 3300046558 Bacteria 14322
557 Ga0495667_0001131 3300046559 Bacteria 17364
558 Ga0495667_0026574 3300046559 Bacteria 3901
559 Ga0495667_0106786 3300046559 Bacteria 1809
560 Ga0495656_0000545 3300046615 Bacteria 12297
561 Ga0495634_0007414 3300046642 Bacteria 8246
562 Ga0495634_0038267 3300046642 Bacteria 3271
563 Ga0495634_0057013 3300046642 Bacteria 2608
564 Ga0495611_0001293 3300046648 Bacteria 12776
565 Ga0495635_0005248 3300046663 Bacteria 9013
566 Ga0495635_0010256 3300046663 Bacteria 6551
567 Ga0495635_0077285 3300046663 Bacteria 2280
568 Ga0495661_0044833 3300046665 Bacteria 2708
569 Ga0495588_0136403 3300046674 Bacteria 1295
570 Ga0495657_0008088 3300046675 Bacteria 8065
571 Ga0495657_0027503 3300046675 Bacteria 4012
572 Ga0495599_0012723 3300046678 Bacteria 5189
573 Ga0495623_0009249 3300046679 Bacteria 6395
574 Ga0495623_0029000 3300046679 Bacteria 3562
575 Ga0495646_0003259 3300046680 Bacteria 10097
576 Ga0495658_0013398 3300046683 Bacteria 4173
577 Ga0495613_0043975 3300046689 Bacteria 3305
578 Ga0495613_0136488 3300046689 Bacteria 1754
579 Ga0495624_0063342 3300046690 Bacteria 2311
580 Ga0495670_0011227 3300046691 Bacteria 4403
581 Ga0495600_0003748 3300046809 Bacteria 8990
582 Ga0495581_0020421 3300047315 Bacteria 3843
583 Ga0495581_0156596 3300047315 Bacteria 1331
584 Ga0495604_0001860 3300047317 Bacteria 17191
585 Ga0495604_0011241 3300047317 Bacteria 7106
586 Ga0495604_0016532 3300047317 Bacteria 5898
587 Ga0495604_0025397 3300047317 Bacteria 4721
588 Ga0495604_0118003 3300047317 Bacteria 1924
589 Ga0495674_0009909 3300047319 Bacteria 9037
590 Ga0495674_0141306 3300047319 Bacteria 2023
591 Ga0495676_0068274 3300047321 Bacteria 2747
592 Ga0495676_0185987 3300047321 Bacteria 1452
593 Ga0495680_0002396 3300047322 Bacteria 19238
594 Ga0495680_0008953 3300047322 Bacteria 9046
595 Ga0495680_0010929 3300047322 Bacteria 8066
596 Ga0495680_0033068 3300047322 Bacteria 4191
597 Ga0495680_0039672 3300047322 Bacteria 3754
598 Ga0495680_0132626 3300047322 Bacteria 1829
599 Ga0495680_0255914 3300047322 Bacteria 1239
600 Ga0495675_0019636 3300047444 Bacteria 4293
601 Ga0495675_0053442 3300047444 Bacteria 2564
602 Ga0495684_0005474 3300047471 Bacteria 9879
603 Ga0495684_0095808 3300047471 Bacteria 2246
604 Ga0495684_0175641 3300047471 Bacteria 1590
605 Ga0495593_0002913 3300047673 Bacteria 10308
606 Ga0495593_0004264 3300047673 Bacteria 8502
607 Ga0495602_0015697 3300048088 Bacteria 7634
608 Ga0495602_0018559 3300048088 Bacteria 6941
609 Ga0495614_0010400 3300048089 Bacteria 4104
610 Ga0495614_0026236 3300048089 Bacteria 2511
611 Ga0496100_0004057 3300048903 Bacteria 7720
612 Ga0496100_0075811 3300048903 Bacteria 2256
613 Ga0496101_0000079 3300048904 Bacteria 107673
614 Ga0496101_0063845 3300048904 Bacteria 2681
615 Ga0496101_0108455 3300048904 Bacteria 2087
616 Ga0496101_0184767 3300048904 Bacteria 1607
617 Ga0496101_0205960 3300048904 Bacteria 1522
618 Ga0496102_0020572 3300048905 Bacteria 5832
619 Ga0496102_0034041 3300048905 Bacteria 4581
620 Ga0496102_0464794 3300048905 Bacteria 1186
621 Ga0496103_0001275 3300048906 Bacteria 17179
622 Ga0496104_0000370 3300048907 Bacteria 39760
623 Ga0496104_0035629 3300048907 Bacteria 4647
624 Ga0496104_0210135 3300048907 Bacteria 1857
625 Ga0496105_0003107 3300048908 Bacteria 12219
626 Ga0496105_0020230 3300048908 Bacteria 5377
627 Ga0496106_0005757 3300048909 Bacteria 9162
628 Ga0496106_0031360 3300048909 Bacteria 3960
629 Ga0496106_0060419 3300048909 Bacteria 2873
630 Ga0496106_0154443 3300048909 Bacteria 1811
631 Ga0496106_0340480 3300048909 Bacteria 1204
632 Ga0496107_0018553 3300048910 Bacteria 4899
633 Ga0496107_0064011 3300048910 Bacteria 2665
634 Ga0496107_0163614 3300048910 Bacteria 1649
635 Ga0496107_0177907 3300048910 Bacteria 1579
636 Ga0496108_0003994 3300048911 Bacteria 11832
637 Ga0496108_0008753 3300048911 Bacteria 8206
638 Ga0496108_0009286 3300048911 Bacteria 7959
639 Ga0496109_0003389 3300048912 Bacteria 13338
640 Ga0496109_0016349 3300048912 Bacteria 6484
641 Ga0496109_0043276 3300048912 Bacteria 4081
642 Ga0496109_0062752 3300048912 Bacteria 3398
643 Ga0496109_0201703 3300048912 Bacteria 1870
644 Ga0496110_0010961 3300048913 Bacteria 7396
645 Ga0496110_0058079 3300048913 Bacteria 3407
646 Ga0496110_0142684 3300048913 Bacteria 2165
647 Ga0496110_0402705 3300048913 Bacteria 1247
648 Ga0496111_0019911 3300048914 Bacteria 4666
649 Ga0496111_0028833 3300048914 Bacteria 3936
650 Ga0496111_0177643 3300048914 Bacteria 1582
651 Ga0496112_0011054 3300048915 Bacteria 8224
652 Ga0496112_0012353 3300048915 Bacteria 7846
653 Ga0496113_0003058 3300048916 Bacteria 9917
654 Ga0496113_0016324 3300048916 Bacteria 5127
655 Ga0496113_0038307 3300048916 Bacteria 3524
656 Ga0496114_0002561 3300048917 Bacteria 13885
657 Ga0496114_0003879 3300048917 Bacteria 11522
658 Ga0496114_0040855 3300048917 Bacteria 3841
659 Ga0496115_0002571 3300048918 Bacteria 13028
660 Ga0496115_0186604 3300048918 Bacteria 1713
661 Ga0496119_0007447 3300048922 Bacteria 9856
662 Ga0501033_0121392 3300049570 Bacteria 1896
663 Ga0501034_0000089 3300049571 Bacteria 165644
664 Ga0501034_0007622 3300049571 Bacteria 11517
665 Ga0501034_0013576 3300049571 Bacteria 8383
666 Ga0501034_0096160 3300049571 Bacteria 2958
667 Ga0501034_0103448 3300049571 Bacteria 2841
668 Ga0501034_0175159 3300049571 Bacteria 2111
669 Ga0501034_0322131 3300049571 Bacteria 1478
670 Ga0501034_0480669 3300049571 Bacteria 1157
671 Ga0501036_0001378 3300049572 Bacteria 18662
672 Ga0501036_0005130 3300049572 Bacteria 10583
673 Ga0501036_0014971 3300049572 Bacteria 6470
674 Ga0501036_0052681 3300049572 Bacteria 3446
675 Ga0501036_0201806 3300049572 Bacteria 1672
676 Ga0501037_0010575 3300049573 Bacteria 6778
677 Ga0501037_0026050 3300049573 Bacteria 4321
678 Ga0501037_0041663 3300049573 Bacteria 3376
679 Ga0501037_0097044 3300049573 Bacteria 2130
680 Ga0501038_0278734 3300049574 Bacteria 1317
681 Ga0501039_0018824 3300049575 Bacteria 5300
682 Ga0501039_0123813 3300049575 Bacteria 2027
683 Ga0501043_0002048 3300049579 Bacteria 17205
684 Ga0501043_0045607 3300049579 Bacteria 3447
685 Ga0501043_0052899 3300049579 Bacteria 3189
686 Ga0501046_0038161 3300049580 Bacteria 3857
687 Ga0501046_0041608 3300049580 Bacteria 3666
688 Ga0501047_0000306 3300049581 Bacteria 56352
689 Ga0501047_0004125 3300049581 Bacteria 13673
690 Ga0501047_0036720 3300049581 Bacteria 4737
691 Ga0501047_0123840 3300049581 Bacteria 2465
692 Ga0501047_0197477 3300049581 Bacteria 1873
693 Ga0501047_0236701 3300049581 Bacteria 1678
694 Ga0501048_0001091 3300049582 Bacteria 20359
695 Ga0501070_0011521 3300049586 Bacteria 7467
696 Ga0501070_0023573 3300049586 Bacteria 5156
697 Ga0501070_0040729 3300049586 Bacteria 3874
698 Ga0501070_0077903 3300049586 Bacteria 2743
699 Ga0501070_0176746 3300049586 Bacteria 1757
700 Ga0501071_0016868 3300049587 Bacteria 5024
701 Ga0501072_0016199 3300049588 Bacteria 5718
702 Ga0501073_0012042 3300049589 Bacteria 6316
703 Ga0501074_0022992 3300049590 Bacteria 4534
704 Ga0501074_0040319 3300049590 Bacteria 3382
705 Ga0501077_0024892 3300049593 Bacteria 3801
706 Ga0501079_0182795 3300049741 Bacteria 1636
707 Ga0501080_0000268 3300049742 Bacteria 39347
708 Ga0501080_0036309 3300049742 Bacteria 4601
709 Ga0501080_0117746 3300049742 Bacteria 2462
710 Ga0501083_0001300 3300049744 Bacteria 16891
711 Ga0501083_0028781 3300049744 Bacteria 3827
712 Ga0501083_0157204 3300049744 Bacteria 1488
713 Ga0501035_0000253 3300049822 Bacteria 64326
714 Ga0501035_0086527 3300049822 Bacteria 2762
715 Ga0501044_0003767 3300049823 Bacteria 17034
716 Ga0501044_0042973 3300049823 Bacteria 4697
717 Ga0501044_0064449 3300049823 Bacteria 3741
718 Ga0501044_0166061 3300049823 Bacteria 2181
719 Ga0501044_0318738 3300049823 Bacteria 1479
720 Ga0501045_0086359 3300049824 Bacteria 2316
721 nmdc:mga0yw44_22908_c1 3300050492 Bacteria 3510
722 nmdc:mga06z11_44725_c1 3300050494 Bacteria 2234
723 nmdc:mga05p37_58_c1 3300050507 Bacteria 95765
724 nmdc:mga09592_246_c1 3300050508 Bacteria 39321
725 nmdc:mga0qj67_420_c1 3300050509 Bacteria 29051
726 nmdc:mga06r32_1189_c1 3300050510 Bacteria 23415
727 nmdc:mga08y16_39766_c1 3300050511 Bacteria 4933
728 nmdc:mga08y16_408_c1 3300050511 Bacteria 29565
729 nmdc:mga08y16_5776_c1 3300050511 Bacteria 12958
730 nmdc:mga0n895_12513_c1 3300050512 Bacteria 7616
731 nmdc:mga0n895_290437_c1 3300050512 Bacteria 1658
732 nmdc:mga0n895_7738_c1 3300050512 Bacteria 9251
733 nmdc:mga0rr50_912_c1 3300050513 Bacteria 15987
734 nmdc:mga0a205_14970_c1 3300050515 Bacteria 3734
735 nmdc:mga0a205_3403_c1 3300050515 Bacteria 14184
736 Ga0495601_0000048 3300053077 Bacteria 69310
737 Ga0495601_0003168 3300053077 Bacteria 9421
738 Ga0495601_0010143 3300053077 Bacteria 5596
739 Ga0495601_0010157 3300053077 Bacteria 5594
740 Ga0495612_0001145 3300053078 Bacteria 10893
741 Ga0495612_0009179 3300053078 Bacteria 4011
742 Ga0495612_0010947 3300053078 Bacteria 3663
743 Ga0495612_0013217 3300053078 Bacteria 3325
744 Ga0495612_0021292 3300053078 Bacteria 2601
745 Ga0495595_0003130 3300053084 Bacteria 6557
746 Ga0495595_0005444 3300053084 Bacteria 5153
747 Ga0495595_0008997 3300053084 Bacteria 4121
748 Ga0495595_0011204 3300053084 Bacteria 3746
749 Ga0495595_0014829 3300053084 Bacteria 3313
750 Ga0495595_0094786 3300053084 Bacteria 1435
751 Ga0495619_0000348 3300053085 Bacteria 32235
752 Ga0495619_0000760 3300053085 Bacteria 21033
753 Ga0495619_0010705 3300053085 Bacteria 5775
754 Ga0495619_0029291 3300053085 Bacteria 3556
755 Ga0495619_0066553 3300053085 Bacteria 2404
756 Ga0500644_0000983 3300053088 Bacteria 8877
757 Ga0500651_0002498 3300053093 Bacteria 9747
758 Ga0500595_000001 3300053119 Bacteria 1088438
759 Ga0500652_001225 3300053131 Bacteria 8170
760 Ga0500616_0031061 3300053153 Bacteria 2928
761 Ga0500645_000087 3300053730 Bacteria 74431
762 Ga0501084_0049217 3300054114 Bacteria 3528
763 2596371318 2595698237 Bacteria 6712432
764 2643757850 2643221547 Bacteria 4740017
765 2889306448 2889306138 Bacteria 6358934
766 2902332773 2902330777 Bacteria 6395352
767 2902408125 2902405164 Bacteria 6784948
768 2928126248 2928125067 Bacteria 5937560
769 Ga0501069_0024776
770 ARSoilYngRDRAFT_c00002
771 ARcpr5yngRDRAFT_c000018
772 ARCol0oldRDRAFT_c00089
773 ARCol0yngRDRAFT_1000001
774 JGI24032J14994_100067
775 JGI24746J21847_1001985
776 JGI24739J22299_10000440
777 JGI24737J22298_10001374
778 JGI24737J22298_10001997
779 JGI24743J22301_10001582
780 JGI24750J21931_1000246
781 JGI24750J21931_1000305
782 JGI24745J21846_1000197
783 JGI24748J21848_1000363
784 JGI24738J21930_10000248
785 JGI24749J21850_1003725
786 JGI24033J26618_1000456
787 JGI24034J26672_10000189
788 JGI24742J22300_10000074
789 JGI24751J29686_10008333
790 JGI25405J52794_10027540
791 Ga0065704_10079373
792 Ga0065712_10003989
793 Ga0065715_10013115
794 Ga0065715_10093751
795 Ga0070658_10004675
796 Ga0070658_10008403
797 Ga0070676_10000453
798 Ga0070683_100000816
799 Ga0070690_100114683
800 Ga0070670_100016076
801 Ga0070677_10000038
802 Ga0068869_100000405
803 Ga0070666_10019007
804 Ga0070666_10050422
805 Ga0070680_100019003
806 Ga0070682_100000181
807 Ga0070682_100043092
808 Ga0068868_100004321
809 Ga0068868_100130447
810 Ga0070660_100006899
811 Ga0070660_100007952
812 Ga0070660_100025000
813 Ga0070689_100058344
814 Ga0070689_100071332
815 Ga0070691_10001514
816 Ga0070691_10020512
817 Ga0070687_100000705
818 Ga0070661_100000411
819 Ga0070692_10003304
820 Ga0070668_100180179
821 Ga0070668_100498885
822 Ga0070669_100025011
823 Ga0070675_100031305
824 Ga0070671_100000333
825 Ga0070671_100049776
826 Ga0070671_100145509
827 Ga0070674_100017046
828 Ga0070674_100094359
829 Ga0070673_100000214
830 Ga0070673_100085503
831 Ga0070688_100001141
832 Ga0070688_100042687
833 Ga0070659_100000557
834 Ga0070667_100027014
835 Ga0070667_100032296
836 Ga0070667_100242839
837 Ga0070703_10082423
838 Ga0070709_10000633
839 Ga0070709_10056465
840 Ga0070714_100059149
841 Ga0070714_100307712
842 Ga0070713_100003394
843 Ga0070713_100028348
844 Ga0070713_100250133
845 Ga0070710_10022402
846 Ga0070711_100116368
847 Ga0070711_100129510
848 Ga0070711_100327084
849 Ga0070705_100000549
850 Ga0070700_100011579
851 Ga0070694_100000484
852 Ga0070708_100004954
853 Ga0070663_100000100
854 Ga0070663_100056560
855 Ga0070678_100001746
856 Ga0070678_100055233
857 Ga0070662_100019375
858 Ga0070662_100023548
859 Ga0070681_10001377
860 Ga0070681_10035054
861 Ga0070681_10246764
862 Ga0068867_100001032
863 Ga0070685_10003183
864 Ga0070685_10227231
865 Ga0070707_100155834
866 Ga0070699_100084405
867 Ga0070679_100005050
868 Ga0070679_100094327
869 Ga0070679_100115303
870 Ga0070684_100000306
871 Ga0070684_100140804
872 Ga0070697_100208031
873 Ga0068853_100004074
874 Ga0070672_100001956
875 Ga0070686_100000261
876 Ga0070686_100003004
877 Ga0070686_100052795
878 Ga0070695_100020475
879 Ga0070693_100000204
880 Ga0070665_100209394
881 Ga0070704_100031399
882 Ga0068855_100077333
883 Ga0068855_100087097
884 Ga0070664_100003036
885 Ga0070664_100059731
886 Ga0070664_100070175
887 Ga0070664_100282904
888 Ga0068857_100001279
889 Ga0068854_100002311
890 Ga0068856_100018687
891 Ga0068856_100028042
892 Ga0068856_100059075
893 Ga0068856_100365314
894 Ga0070702_100012193
895 Ga0068852_100002045
896 Ga0068859_100002494
897 Ga0068859_100097026
898 Ga0068864_100000172
899 Ga0068864_100071636
900 Ga0068864_100187058
901 Ga0068866_10002520
902 Ga0068861_100025525
903 Ga0068870_10000070
904 Ga0068863_100002553
905 Ga0068863_100084882
906 Ga0068863_100550234
907 Ga0068858_100017232
908 Ga0068860_100039398
909 Ga0068860_100349230
910 Ga0068862_100354253
911 Ga0081455_10000002
912 Ga0081455_10002251
913 Ga0081455_10240406
914 Ga0081540_1000105
915 Ga0081540_1015508
916 Ga0070717_10001268
917 Ga0075365_10036322
918 Ga0070716_100000480
919 Ga0070712_100081154
920 Ga0097621_100003914
921 Ga0097621_100218082
922 Ga0068871_100001147
923 Ga0068871_100002656
924 Ga0068871_100048494
925 Ga0075428_100189728
926 Ga0075430_100029067
927 Ga0075431_100172308
928 Ga0075434_100000152
929 Ga0075434_100010160
930 Ga0075429_100000083
931 Ga0068865_100000114
932 Ga0075436_100051009
933 Ga0097620_100002494
934 Ga0097620_100097025
935 Ga0075435_100155118
936 Ga0105244_10042327
937 Ga0105250_10049805
938 Ga0105240_10006614
939 Ga0105240_10025205
940 Ga0111539_10008561
941 Ga0111539_10008625
942 Ga0111539_10010388
943 Ga0111539_10071290
944 Ga0105245_10001740
945 Ga0105245_10338760
946 Ga0105247_10028940
947 Ga0114129_10167094
948 Ga0105243_10003377
949 Ga0105243_10007271
950 Ga0105243_10007400
951 Ga0105243_10076728
952 Ga0105241_10000316
953 Ga0105241_10085955
954 Ga0105241_10193843
955 Ga0105242_10000356
956 Ga0105242_10050148
957 Ga0105248_10001326
958 Ga0105248_10027529
959 Ga0105248_10065087
960 Ga0105248_10065642
961 Ga0105248_10296359
962 Ga0105237_10152105
963 Ga0105237_10274714
964 Ga0105238_10036149
965 Ga0105238_10314838
966 Ga0105249_10000289
967 Ga0105249_10042619
968 Ga0105239_10002550
969 Ga0105239_10300685
970 Ga0105246_10000070
971 Ga0105246_10352968
972 Ga0157345_1001411
973 Ga0157338_1000301
974 Ga0157373_10024701
975 Ga0157373_10086334
976 Ga0157371_10007238
977 Ga0157370_10048522
978 Ga0157369_10130193
979 Ga0157374_10002534
980 Ga0157378_10000713
981 Ga0157378_10023523
982 Ga0157378_10139586
983 Ga0163162_10002240
984 Ga0163162_10014150
985 Ga0163162_10077664
986 Ga0157372_10338966
987 Ga0157375_10025558
988 Ga0157375_10187426
989 Ga0157375_10310662
990 Ga0163163_10016298
991 Ga0163163_10080114
992 Ga0163163_10637338
993 Ga0157380_10051408
994 Ga0157380_10323339
995 Ga0157380_10373356
996 Ga0157377_10000109
997 Ga0157379_10003826
998 Ga0157376_10000352
999 Ga0157376_10041765
1000 Ga0157376_10177252
1001 Ga0163161_10000132
1002 Ga0213875_10011974
1003 Ga0207666_1000018
1004 Ga0207666_1001398
1005 Ga0207673_1002758
1006 Ga0207697_10000078
1007 Ga0207655_1040419
1008 Ga0207653_10002169
1009 Ga0207653_10065018
1010 Ga0207682_10041168
1011 Ga0207692_10000792
1012 Ga0207692_10024243
1013 Ga0207692_10028081
1014 Ga0207642_10003174
1015 Ga0207642_10035155
1016 Ga0207710_10013944
1017 Ga0207688_10000472
1018 Ga0207680_10016345
1019 Ga0207680_10032374
1020 Ga0207680_10110589
1021 Ga0207685_10055838
1022 Ga0207699_10000206
1023 Ga0207699_10011558
1024 Ga0207699_10024354
1025 Ga0207645_10000110
1026 Ga0207645_10036805
1027 Ga0207643_10000108
1028 Ga0207654_10000847
1029 Ga0207654_10094862
1030 Ga0207707_10002724
1031 Ga0207707_10007347
1032 Ga0207707_10070287
1033 Ga0207707_10076909
1034 Ga0207695_10037186
1035 Ga0207695_10140888
1036 Ga0207671_10104985
1037 Ga0207693_10001508
1038 Ga0207693_10172171
1039 Ga0207663_10021383
1040 Ga0207663_10132110
1041 Ga0207660_10000927
1042 Ga0207660_10030334
1043 Ga0207660_10098869
1044 Ga0207660_10142360
1045 Ga0207662_10000400
1046 Ga0207657_10005770
1047 Ga0207657_10011852
1048 Ga0207657_10012169
1049 Ga0207657_10049877
1050 Ga0207649_10000064
1051 Ga0207649_10045601
1052 Ga0207649_10105555
1053 Ga0207649_10225184
1054 Ga0207652_10000128
1055 Ga0207652_10040036
1056 Ga0207652_10046535
1057 Ga0207652_10531324
1058 Ga0207646_10170417
1059 Ga0207681_10000024
1060 Ga0207694_10254509
1061 Ga0207650_10040359
1062 Ga0207659_10000034
1063 Ga0207687_10002195
1064 Ga0207687_10004808
1065 Ga0207687_10119381
1066 Ga0207700_10052208
1067 Ga0207644_10012991
1068 Ga0207644_10023890
1069 Ga0207690_10000068
1070 Ga0207690_10042993
1071 Ga0207690_10089544
1072 Ga0207690_10238695
1073 Ga0207706_10002009
1074 Ga0207706_10011231
1075 Ga0207706_10046315
1076 Ga0207686_10001995
1077 Ga0207686_10030832
1078 Ga0207686_10050496
1079 Ga0207709_10000855
1080 Ga0207709_10001896
1081 Ga0207709_10016314
1082 Ga0207670_10000057
1083 Ga0207670_10043652
1084 Ga0207669_10000005
1085 Ga0207669_10154535
1086 Ga0207669_10190363
1087 Ga0207704_10000518
1088 Ga0207665_10000639
1089 Ga0207691_10000543
1090 Ga0207691_10094996
1091 Ga0207711_10001965
1092 Ga0207711_10004883
1093 Ga0207711_10093228
1094 Ga0207689_10004415
1095 Ga0207661_10000036
1096 Ga0207679_10000025
1097 Ga0207679_10235111
1098 Ga0207679_10269978
1099 Ga0207667_10178917
1100 Ga0207667_10379097
1101 Ga0207651_10000014
1102 Ga0207651_10430541
1103 Ga0207712_10002668
1104 Ga0207668_10000352
1105 Ga0207640_10000421
1106 Ga0207640_10162621
1107 Ga0207658_10003963
1108 Ga0207677_10003964
1109 Ga0207677_10028519
1110 Ga0207703_10001824
1111 Ga0207703_10055387
1112 Ga0207703_10058474
1113 Ga0207703_10304604
1114 Ga0207639_10001709
1115 Ga0207678_10000292
1116 Ga0207708_10006528
1117 Ga0207702_10006197
1118 Ga0207702_10023890
1119 Ga0207702_10137541
1120 Ga0207641_10001199
1121 Ga0207641_10053966
1122 Ga0207648_10010793
1123 Ga0207676_10071630
1124 Ga0207674_10000376
1125 Ga0207674_10034279
1126 Ga0207674_10262775
1127 Ga0207675_100001596
1128 Ga0207675_100111791
1129 Ga0207675_100160338
1130 Ga0207683_10000001
1131 Ga0207683_10002869
1132 Ga0207683_10122759
1133 Ga0207698_10010314
1134 Ga0209995_1008330
1135 Ga0210002_1005271
1136 Ga0209983_1007022
1137 Ga0209971_1002532
1138 Ga0209998_10001583
1139 Ga0209974_10009288
1140 Ga0207428_10000162
1141 Ga0207428_10000233
1142 Ga0268266_10006428
1143 Ga0268265_10000477
1144 Ga0268265_10039527
1145 Ga0265337_1010268
1146 Ga0265330_10017380
1147 Ga0265325_10000056
1148 Ga0265325_10028790
1149 Ga0265325_10051744
1150 Ga0265325_10061674
1151 Ga0265325_10106072
1152 Ga0265340_10029737
1153 Ga0265316_10059614
1154 Ga0265313_10004705
1155 Ga0265313_10017518
1156 Ga0265313_10024646
1157 Ga0265313_10027453
1158 Ga0265313_10040120
1159 Ga0265342_10000678
1160 Ga0316583_10007481
1161 Ga0316583_10039251
1162 Ga0373930_0000382
1163 Ga0373948_0000058
1164 Ga0373948_0004860
1165 Ga0373950_0000150
1166 Ga0373959_0003744
1167 Ga0373926_0004892
1168 Ga0373926_0011016
1169 Ga0373928_0001785
1170 Ga0373928_0006324
1171 Ga0373929_0000396
1172 Ga0373934_0006297
1173 Ga0373940_0000198
1174 Ga0373940_0005664
1175 Ga0373951_0000402
1176 Ga0373951_0002227
1177 Ga0373952_0002375
1178 Ga0373952_0024858
1179 Ga0373923_0012471
1180 Ga0373923_0024122
1181 Ga0373932_0000422
1182 Ga0373932_0001273
1183 Ga0373932_0002346
1184 Ga0373939_0000992
1185 Ga0373939_0002087
1186 Ga0373939_0028488
1187 Ga0373939_0028987
1188 Ga0373939_0044705
1189 Ga0373941_0000394
1190 Ga0373941_0000706
1191 Ga0373945_0004515
1192 Ga0373945_0004999
1193 Ga0373953_0023243
1194 Ga0373953_0105321
1195 Ga0373954_0002988
1196 Ga0373954_0014409
1197 Ga0373954_0021523
1198 Ga0373956_0011467
1199 Ga0373956_0031549
1200 Ga0373957_0013839
1201 Ga0373957_0025061
1202 Ga0373957_0031469
1203 Ga0373957_0074554
1204 Ga0373960_0000500
1205 Ga0373960_0000563
1206 Ga0373960_0013690
1207 Ga0373960_0028007
1208 Ga0373943_0059962
1209 Ga0373946_0004347
1210 Ga0373946_0005977
1211 Ga0373955_0001354
1212 Ga0373955_0035879
1213 Ga0373942_0000840
1214 Ga0373942_0002597
1215 Ga0373961_0000477
1216 Ga0373962_0030991
1217 Ga0373931_0000072
1218 Ga0373931_0261514
1219 Ga0373935_0015391
1220 Ga0373935_0116561
1221 Ga0373927_0036614
1222 Ga0373927_0196503
1223 Ga0373933_0000125
1224 Ga0373933_0021903
1225 Ga0373933_0041268
1226 Ga0373933_0088886
1227 Ga0373933_0171285
1228 Ga0373947_0033560
1229 Ga0373937_0014493
1230 Ga0373937_0033957
1231 Ga0373937_0040686
1232 Ga0373937_0137594
1233 Ga0373937_0250333
1234 Ga0316582_0175089
1235 Ga0373925_0003474
1236 Ga0373925_0204574
1237 Ga0373925_0280247
1238 Ga0395899_0001464
1239 Ga0395899_0113180
1240 Ga0395900_0004156
1241 Ga0395900_0028820
1242 Ga0395900_0385701
1243 Ga0395898_0046519
1244 Ga0395898_0104989
1245 Ga0395901_0005692
1246 Ga0395901_0029628
1247 Ga0395901_0084183
1248 Ga0395901_0257408
1249 Ga0436365_0372867
1250 Ga0436365_0820123
1251 Ga0436365_1568977
1252 Ga0436365_1738433
1253 Ga0436362_1144858
1254 Ga0439441_001669
1255 Ga0439455_0016744
1256 Ga0439463_019847
1257 Ga0466963_0017496
1258 Ga0466963_0054193
1259 Ga0453684_0127838
1260 Ga0466968_0023795
1261 Ga0466957_0092053
1262 Ga0466967_0015735
1263 Ga0466967_0088085
1264 Ga0495617_015485
1265 Ga0495592_0001181
1266 Ga0495592_0076889
1267 Ga0495592_0100625
1268 Ga0495603_0012384
1269 Ga0495603_0026393
1270 Ga0495603_0060412
1271 Ga0495629_0000301
1272 Ga0495629_0050019
1273 Ga0495629_0103735
1274 Ga0495641_0019106
1275 Ga0495641_0019449
1276 Ga0495641_0063237
1277 Ga0495651_0016908
1278 Ga0495651_0027832
1279 Ga0495653_0014682
1280 Ga0495653_0020138
1281 Ga0495653_0088891
1282 Ga0495653_0125526
1283 Ga0495580_0015866
1284 Ga0495582_0002821
1285 Ga0495582_0004575
1286 Ga0495582_0026830
1287 Ga0495639_0005189
1288 Ga0495662_0011789
1289 Ga0495664_0026606
1290 Ga0495664_0165925
1291 Ga0495585_0001941
1292 Ga0495594_0023857
1293 Ga0495594_0055738
1294 Ga0495594_0096813
1295 Ga0495607_0147098
1296 Ga0495608_0009131
1297 Ga0495608_0018950
1298 Ga0495618_0019200
1299 Ga0495618_0037823
1300 Ga0495628_0012129
1301 Ga0495628_0016608
1302 Ga0495628_0029251
1303 Ga0495628_0187587
1304 Ga0495630_0304653
1305 Ga0495637_0060008
1306 Ga0495643_0086391
1307 Ga0495644_0000364
1308 Ga0495663_0010349
1309 Ga0495666_0022871
1310 Ga0495652_0059574
1311 Ga0495652_0076732
1312 Ga0495665_0128298
1313 Ga0495640_0095123
1314 Ga0495640_0163102
1315 Ga0495587_0004237
1316 Ga0495587_0035780
1317 Ga0495587_0059576
1318 Ga0495587_0088564
1319 Ga0495598_0001458
1320 Ga0495609_0019877
1321 Ga0495645_0004138
1322 Ga0495645_0026276
1323 Ga0495622_0040633
1324 Ga0495633_0002099
1325 Ga0495667_0001131
1326 Ga0495667_0026574
1327 Ga0495667_0106786
1328 Ga0495656_0000545
1329 Ga0495634_0007414
1330 Ga0495634_0038267
1331 Ga0495634_0057013
1332 Ga0495611_0001293
1333 Ga0495635_0005248
1334 Ga0495635_0010256
1335 Ga0495635_0077285
1336 Ga0495661_0044833
1337 Ga0495588_0136403
1338 Ga0495657_0008088
1339 Ga0495657_0027503
1340 Ga0495599_0012723
1341 Ga0495623_0009249
1342 Ga0495623_0029000
1343 Ga0495646_0003259
1344 Ga0495658_0013398
1345 Ga0495613_0043975
1346 Ga0495613_0136488
1347 Ga0495624_0063342
1348 Ga0495670_0011227
1349 Ga0495600_0003748
1350 Ga0495581_0020421
1351 Ga0495581_0156596
1352 Ga0495604_0001860
1353 Ga0495604_0011241
1354 Ga0495604_0016532
1355 Ga0495604_0025397
1356 Ga0495604_0118003
1357 Ga0495674_0009909
1358 Ga0495674_0141306
1359 Ga0495676_0068274
1360 Ga0495676_0185987
1361 Ga0495680_0002396
1362 Ga0495680_0008953
1363 Ga0495680_0010929
1364 Ga0495680_0033068
1365 Ga0495680_0039672
1366 Ga0495680_0132626
1367 Ga0495680_0255914
1368 Ga0495675_0019636
1369 Ga0495675_0053442
1370 Ga0495684_0005474
1371 Ga0495684_0095808
1372 Ga0495684_0175641
1373 Ga0495593_0002913
1374 Ga0495593_0004264
1375 Ga0495602_0015697
1376 Ga0495602_0018559
1377 Ga0495614_0010400
1378 Ga0495614_0026236
1379 Ga0496100_0004057
1380 Ga0496100_0075811
1381 Ga0496101_0000079
1382 Ga0496101_0063845
1383 Ga0496101_0108455
1384 Ga0496101_0184767
1385 Ga0496101_0205960
1386 Ga0496102_0020572
1387 Ga0496102_0034041
1388 Ga0496102_0464794
1389 Ga0496103_0001275
1390 Ga0496104_0000370
1391 Ga0496104_0035629
1392 Ga0496104_0210135
1393 Ga0496105_0003107
1394 Ga0496105_0020230
1395 Ga0496106_0005757
1396 Ga0496106_0031360
1397 Ga0496106_0060419
1398 Ga0496106_0154443
1399 Ga0496106_0340480
1400 Ga0496107_0018553
1401 Ga0496107_0064011
1402 Ga0496107_0163614
1403 Ga0496107_0177907
1404 Ga0496108_0003994
1405 Ga0496108_0008753
1406 Ga0496108_0009286
1407 Ga0496109_0003389
1408 Ga0496109_0016349
1409 Ga0496109_0043276
1410 Ga0496109_0062752
1411 Ga0496109_0201703
1412 Ga0496110_0010961
1413 Ga0496110_0058079
1414 Ga0496110_0142684
1415 Ga0496110_0402705
1416 Ga0496111_0019911
1417 Ga0496111_0028833
1418 Ga0496111_0177643
1419 Ga0496112_0011054
1420 Ga0496112_0012353
1421 Ga0496113_0003058
1422 Ga0496113_0016324
1423 Ga0496113_0038307
1424 Ga0496114_0002561
1425 Ga0496114_0003879
1426 Ga0496114_0040855
1427 Ga0496115_0002571
1428 Ga0496115_0186604
1429 Ga0496119_0007447
1430 Ga0501033_0121392
1431 Ga0501034_0000089
1432 Ga0501034_0007622
1433 Ga0501034_0013576
1434 Ga0501034_0096160
1435 Ga0501034_0103448
1436 Ga0501034_0175159
1437 Ga0501034_0322131
1438 Ga0501034_0480669
1439 Ga0501036_0001378
1440 Ga0501036_0005130
1441 Ga0501036_0014971
1442 Ga0501036_0052681
1443 Ga0501036_0201806
1444 Ga0501037_0010575
1445 Ga0501037_0026050
1446 Ga0501037_0041663
1447 Ga0501037_0097044
1448 Ga0501038_0278734
1449 Ga0501039_0018824
1450 Ga0501039_0123813
1451 Ga0501043_0002048
1452 Ga0501043_0045607
1453 Ga0501043_0052899
1454 Ga0501046_0038161
1455 Ga0501046_0041608
1456 Ga0501047_0000306
1457 Ga0501047_0004125
1458 Ga0501047_0036720
1459 Ga0501047_0123840
1460 Ga0501047_0197477
1461 Ga0501047_0236701
1462 Ga0501048_0001091
1463 Ga0501070_0011521
1464 Ga0501070_0023573
1465 Ga0501070_0040729
1466 Ga0501070_0077903
1467 Ga0501070_0176746
1468 Ga0501071_0016868
1469 Ga0501072_0016199
1470 Ga0501073_0012042
1471 Ga0501074_0022992
1472 Ga0501074_0040319
1473 Ga0501077_0024892
1474 Ga0501079_0182795
1475 Ga0501080_0000268
1476 Ga0501080_0036309
1477 Ga0501080_0117746
1478 Ga0501083_0001300
1479 Ga0501083_0028781
1480 Ga0501083_0157204
1481 Ga0501035_0000253
1482 Ga0501035_0086527
1483 Ga0501044_0003767
1484 Ga0501044_0042973
1485 Ga0501044_0064449
1486 Ga0501044_0166061
1487 Ga0501044_0318738
1488 Ga0501045_0086359
1489 nmdc:mga0yw44_22908_c1
1490 nmdc:mga06z11_44725_c1
1491 nmdc:mga05p37_58_c1
1492 nmdc:mga09592_246_c1
1493 nmdc:mga0qj67_420_c1
1494 nmdc:mga06r32_1189_c1
1495 nmdc:mga08y16_39766_c1
1496 nmdc:mga08y16_408_c1
1497 nmdc:mga08y16_5776_c1
1498 nmdc:mga0n895_12513_c1
1499 nmdc:mga0n895_290437_c1
1500 nmdc:mga0n895_7738_c1
1501 nmdc:mga0rr50_912_c1
1502 nmdc:mga0a205_14970_c1
1503 nmdc:mga0a205_3403_c1
1504 Ga0495601_0000048
1505 Ga0495601_0003168
1506 Ga0495601_0010143
1507 Ga0495601_0010157
1508 Ga0495612_0001145
1509 Ga0495612_0009179
1510 Ga0495612_0010947
1511 Ga0495612_0013217
1512 Ga0495612_0021292
1513 Ga0495595_0003130
1514 Ga0495595_0005444
1515 Ga0495595_0008997
1516 Ga0495595_0011204
1517 Ga0495595_0014829
1518 Ga0495595_0094786
1519 Ga0495619_0000348
1520 Ga0495619_0000760
1521 Ga0495619_0010705
1522 Ga0495619_0029291
1523 Ga0495619_0066553
1524 Ga0500644_0000983
1525 Ga0500651_0002498
1526 Ga0500595_000001
1527 Ga0500652_001225
1528 Ga0500616_0031061
1529 Ga0500645_000087
1530 Ga0501084_0049217
1531 2596371318
1532 2643757850
1533 2889306448
1534 2902332773
1535 2902408125
1536 2928126248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

43

369

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.9226 2 331
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.9131 1 331
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8958 2 331
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8937 1 331
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8779 1 331
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9273 1 330 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9164 1 330 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9161 1 330 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8964 2 332 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8919 1 331 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A4Q5R4S9-F1-model_v4 MsnO8 family LLM class oxidoreductase (EC 1.-.-.-) 0.9808 1 120 GO:0005829
GO:0016705
AF-A0A2W4SAS2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9799 2 331 GO:0005829
GO:0016705
AF-A0A7T9B2X4-F1-model_v4 deleted 0.9773 2 331
AF-A0A2W2KRY3-F1-model_v4 Luciferase-like domain-containing protein 0.9762 2 109 GO:0005829
GO:0016705
AF-A0A3D2XZF9-F1-model_v4 Alkane 1-monooxygenase 0.9749 1 122 GO:0004497
GO:0005829
GO:0016705

Map