F479925

General Info

Members Datasets Scaffolds Average Seq Length
767 567 1534 323

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2534681796|2535520697
Length 371
Sequence GRVSWPVRIPKMASFAAAAARLNHGFNQASCEKNELMIALSIFNRVVMAAVTLFGVALIVFVLLRVVPGDPIAMMISPGASAADIAALRAHYGLDASLPVQFGLWLKAMLGGDFGTSISLKRSVLDLLGERLPATLELAVAALVVAVASGMAIAVAGTLLRRGPLEPVIDALNGLFLAVPDFVWALALVLILGVFYPIFPLSGRIDPTINMPFATPFYLIESLLRLRFAVFGDVVAHMVMPVLALGLPLAAIIARVLKAALSEAMVQDYVLLARLKGMSELRLVLQEALRNAIGPTIALTGVQFTFLIGGTVIVERIFSYPGIGNMAIDAVINRDLPLIQGLVLVFGVLFILVNLLVDLLVAAFNPRLRHG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
278 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
281 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
285 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
286 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
287 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
288 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
289 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
290 2512875024
291 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
292 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
293 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
294 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
295 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
296 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
297 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
298 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
299 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
300 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
301 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
302 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
303 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
304 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
305 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
306 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
307 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
308 2643221568 Rhizobium sp. Root564 Isolate Unclassified
309 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
310 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
311 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
312 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
313 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
314 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
315 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
316 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
317 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
318 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
319 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
320 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
321 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
322 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
323 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
324 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
325 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
326 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
327 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
328 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
329 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
330 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
331 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
332 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
333 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
334 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
335 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
336 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
337 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
338 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
339 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
340 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
341 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
342 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
343 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
344 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
345 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
346 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
347 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
348 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
349 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
350 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
351 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
352 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
353 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
354 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
355 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
356 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
357 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
358 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
359 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
360 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
361 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
362 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
363 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
364 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
365 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
366 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
367 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
368 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
369 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
370 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
371 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
372 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
373 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
374 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
375 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
376 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
377 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
378 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
379 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
380 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
381 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
382 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
383 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
384 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
385 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
386 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
387 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
388 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
389 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
390 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
391 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
392 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
393 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
394 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
395 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
396 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
397 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
398 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
399 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
400 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
401 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
402 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
403 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
404 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
405 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
406 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
407 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
408 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
409 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
410 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
411 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
412 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
413 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
414 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
415 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
416 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
417 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
418 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
419 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
420 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
421 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
422 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
423 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
424 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
425 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
426 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
427 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
428 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
429 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
430 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
431 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
432 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
433 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
434 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
435 2932401849 Devosia sp. 2618 Isolate Rhizosphere
436 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
437 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
438 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
439 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
440 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
441 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
442 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
443 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
444 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
445 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
446 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
447 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
448 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
449 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
450 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
451 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
452 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
453 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
454 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
455 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
456 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
457 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
458 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
459 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
460 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
461 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
462 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
463 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
464 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
465 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
466 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
467 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
468 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
469 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
470 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
471 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
472 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
473 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
474 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
475 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
476 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
477 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
478 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
479 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
480 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
481 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
482 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
483 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
484 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
485 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
486 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
487 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
488 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
489 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
490 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
491 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
492 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
493 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
494 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
495 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
496 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
497 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
498 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
499 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
500 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
501 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
502 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
503 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
504 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
505 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
506 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
507 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
508 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
509 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
510 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
511 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
512 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
513 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
514 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
515 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
516 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
517 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
518 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
519 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
520 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
521 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
522 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
523 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
524 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
525 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
526 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
527 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
528 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
529 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
530 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
531 3004167301 Mesorhizobium loti 582 Isolate Unclassified
532 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
533 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
534 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
535 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
536 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
537 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
538 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
539 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
540 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
541 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
542 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
543 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
544 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
545 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
546 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
547 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
548 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
549 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
550 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
551 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
552 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
553 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
554 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
555 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
556 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
557 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
558 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
559 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
560 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
561 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
562 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
563 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
564 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
565 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
566 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
567 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.58
Metatranscriptomes 0
Isolates 37.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 7.95
Nodule 29.6
Rhizoplane 4.04
Rhizosphere 43.94
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018233 3300001979 Bacteria 2496
2 JGI25156J39149_1000050 3300002705 Bacteria 89634
3 JGI25162J39368_1000418 3300002737 Bacteria 34635
4 JGI25162J39368_1000515 3300002737 Bacteria 28990
5 JGI25154J39366_1000035 3300002738 Bacteria 172224
6 JGI25157J39369_1000036 3300002741 Bacteria 133671
7 JGI25159J45721_1004732 3300002987 Bacteria 4424
8 JGI25165J46597_1000375 3300003214 Bacteria 49445
9 JGI25165J46597_1000703 3300003214 Bacteria 26447
10 rootH1_10060886 3300003323 Bacteria 1472
11 rootH1_10289051 3300003323 Bacteria 1458
12 JGI25160J50197_1000001 3300003354 Bacteria 782301
13 JGI25161J50226_1000047 3300003374 Bacteria 113472
14 Ga0055542_1000295 3300003762 Bacteria 55507
15 Ga0055529_1001144 3300003763 Bacteria 11209
16 Ga0055540_1015051 3300003792 Bacteria 2271
17 Ga0055540_1018129 3300003792 Bacteria 1939
18 Ga0058692_1010167 3300003856 Bacteria 2336
19 Ga0055543_1000007 3300004625 Bacteria 204042
20 Ga0065165_1000464 3300005262 Bacteria 63619
21 Ga0065712_10070322 3300005290 Bacteria 6113
22 Ga0065715_10093116 3300005293 Bacteria 4805
23 Ga0065715_10272810 3300005293 Bacteria 1106
24 Ga0070670_100000359 3300005331 Bacteria 38101
25 Ga0070670_100030535 3300005331 Bacteria 4641
26 Ga0070660_100026496 3300005339 Bacteria 4316
27 Ga0070689_100172905 3300005340 Bacteria 1751
28 Ga0070687_100211773 3300005343 Unclassified 1181
29 Ga0070661_100109895 3300005344 Bacteria 2058
30 Ga0070661_100155549 3300005344 Bacteria 1730
31 Ga0070669_100027674 3300005353 Bacteria 4081
32 Ga0070671_100016976 3300005355 Bacteria 5887
33 Ga0070659_100171962 3300005366 Bacteria 1775
34 Ga0070713_100030217 3300005436 Bacteria 4301
35 Ga0070713_100099174 3300005436 Bacteria 2520
36 Ga0070711_100047169 3300005439 Bacteria 2939
37 Ga0070663_100124224 3300005455 Bacteria 1953
38 Ga0070662_100073987 3300005457 Bacteria 2519
39 Ga0070706_100099290 3300005467 Bacteria 2705
40 Ga0070697_100217183 3300005536 Bacteria 1629
41 Ga0068853_100269042 3300005539 Bacteria 1569
42 Ga0070665_100112635 3300005548 Bacteria 2724
43 Ga0070665_100194198 3300005548 Bacteria 2031
44 Ga0070665_100528113 3300005548 Bacteria 1192
45 Ga0068855_100029478 3300005563 Bacteria 6560
46 Ga0068855_100094868 3300005563 Bacteria 3440
47 Ga0068855_100544781 3300005563 Bacteria 1256
48 Ga0070664_100072989 3300005564 Bacteria 2943
49 Ga0068857_100081217 3300005577 Bacteria 2895
50 Ga0068854_100066599 3300005578 Bacteria 2621
51 Ga0068854_100123394 3300005578 Bacteria 1970
52 Ga0068856_100099524 3300005614 Bacteria 2899
53 Ga0070702_100130546 3300005615 Bacteria 1586
54 Ga0068852_100014705 3300005616 Bacteria 6037
55 Ga0068859_100140372 3300005617 Bacteria 2490
56 Ga0068859_100200164 3300005617 Bacteria 2082
57 Ga0068864_100169410 3300005618 Bacteria 1990
58 Ga0068866_10051381 3300005718 Bacteria 2098
59 Ga0068861_100249767 3300005719 Bacteria 1513
60 Ga0068851_10041873 3300005834 Bacteria 2304
61 Ga0068858_100231820 3300005842 Bacteria 1751
62 Ga0068860_100000217 3300005843 Bacteria 90245
63 Ga0068862_100326522 3300005844 Unclassified 1418
64 Ga0081540_1034659 3300005983 Bacteria 2717
65 Ga0070717_10007198 3300006028 Bacteria 8250
66 Ga0075365_10008039 3300006038 Bacteria 5957
67 Ga0075365_10040435 3300006038 Bacteria 3040
68 Ga0075365_10057298 3300006038 Bacteria 2592
69 Ga0075363_100035657 3300006048 Bacteria 2605
70 Ga0075363_100046135 3300006048 Bacteria 2311
71 Ga0070712_100015805 3300006175 Bacteria 4867
72 Ga0070712_100151349 3300006175 Bacteria 1782
73 Ga0075428_100386195 3300006844 Bacteria 1501
74 Ga0075433_10113886 3300006852 Bacteria 2399
75 Ga0097620_100140377 3300006931 Bacteria 2490
76 Ga0097620_100200177 3300006931 Bacteria 2082
77 Ga0075435_100242575 3300007076 Bacteria 1533
78 Ga0099794_10004551 3300007265 Bacteria 5464
79 Ga0099795_10001273 3300007788 Bacteria 5358
80 Ga0105240_10000014 3300009093 Bacteria 482033
81 Ga0105240_10055392 3300009093 Bacteria 4964
82 Ga0105240_10077982 3300009093 Bacteria 4081
83 Ga0105245_10127683 3300009098 Bacteria 2382
84 Ga0105245_10188929 3300009098 Bacteria 1972
85 Ga0105247_10055807 3300009101 Bacteria 2438
86 Ga0105241_10003792 3300009174 Bacteria 11210
87 Ga0105241_10057175 3300009174 Bacteria 2992
88 Ga0105241_10058783 3300009174 Bacteria 2953
89 Ga0105242_10138494 3300009176 Bacteria 2109
90 Ga0105248_10040706 3300009177 Bacteria 5209
91 Ga0105248_10355666 3300009177 Bacteria 1649
92 Ga0105248_10474145 3300009177 Bacteria 1411
93 Ga0105237_10001838 3300009545 Bacteria 27303
94 Ga0105237_10062632 3300009545 Bacteria 3719
95 Ga0105237_10096702 3300009545 Bacteria 2943
96 Ga0105237_10133802 3300009545 Bacteria 2474
97 Ga0105237_10167299 3300009545 Bacteria 2198
98 Ga0105238_10010231 3300009551 Bacteria 9407
99 Ga0105238_10122794 3300009551 Bacteria 2576
100 Ga0099796_10000237 3300010159 Bacteria 8644
101 Ga0105239_10006392 3300010375 Bacteria 13685
102 Ga0105239_10016078 3300010375 Bacteria 8279
103 Ga0105239_10039243 3300010375 Bacteria 5187
104 Ga0105239_10066449 3300010375 Bacteria 3961
105 Ga0105239_10066684 3300010375 Bacteria 3954
106 Ga0105246_10166160 3300011119 Bacteria 1685
107 Ga0105246_10194692 3300011119 Bacteria 1572
108 Ga0157370_10000015 3300013104 Bacteria 185771
109 Ga0157369_10019081 3300013105 Bacteria 7678
110 Ga0157369_10169760 3300013105 Bacteria 2299
111 Ga0157378_10494401 3300013297 Bacteria 1221
112 Ga0163162_10051368 3300013306 Bacteria 4137
113 Ga0157375_10019634 3300013308 Bacteria 6153
114 Ga0157375_10032233 3300013308 Bacteria 4968
115 Ga0157375_10410746 3300013308 Bacteria 1520
116 Ga0163163_10256395 3300014325 Bacteria 1800
117 Ga0157379_10151761 3300014968 Bacteria 2090
118 Ga0157376_10099765 3300014969 Bacteria 2534
119 Ga0182006_1041539 3300015261 Bacteria 1805
120 Ga0182007_10013215 3300015262 Bacteria 3156
121 Ga0182005_1003993 3300015265 Bacteria 4858
122 Ga0213874_10000517 3300021377 Bacteria 7743
123 Ga0228598_1001278 3300024227 Bacteria 5536
124 Ga0209435_100005 3300025206 Bacteria 573745
125 Ga0209437_100058 3300025233 Bacteria 357279
126 Ga0209437_100060 3300025233 Bacteria 355034
127 Ga0209646_1000011 3300025246 Bacteria 573745
128 Ga0209026_1000008 3300025250 Bacteria 573745
129 Ga0209026_1000013 3300025250 Bacteria 415633
130 Ga0209677_101413 3300025253 Bacteria 10399
131 Ga0209677_104869 3300025253 Bacteria 3691
132 Ga0209148_1000032 3300025254 Bacteria 557660
133 Ga0209148_1000840 3300025254 Bacteria 21813
134 Ga0209759_1000004 3300025256 Bacteria 573745
135 Ga0209759_1000058 3300025256 Bacteria 203580
136 Ga0209233_1000137 3300025261 Bacteria 200314
137 Ga0209233_1000240 3300025261 Bacteria 90758
138 Ga0209233_1000275 3300025261 Bacteria 72941
139 Ga0209233_1003699 3300025261 Bacteria 5346
140 Ga0209233_1007964 3300025261 Bacteria 3313
141 Ga0209455_1000098 3300025272 Bacteria 213890
142 Ga0209455_1000105 3300025272 Bacteria 199725
143 Ga0209130_1000145 3300025284 Bacteria 113201
144 Ga0209025_1059110 3300025294 Bacteria 1449
145 Ga0207426_1000011 3300025302 Bacteria 791203
146 Ga0209051_1000668 3300025303 Bacteria 38496
147 Ga0207656_10035310 3300025321 Bacteria 2093
148 Ga0207642_10040086 3300025899 Bacteria 2041
149 Ga0207680_10106493 3300025903 Bacteria 1811
150 Ga0207654_10080956 3300025911 Bacteria 1954
151 Ga0207695_10000037 3300025913 Bacteria 476303
152 Ga0207695_10000065 3300025913 Bacteria 336949
153 Ga0207695_10045254 3300025913 Bacteria 4673
154 Ga0207671_10000080 3300025914 Bacteria 148567
155 Ga0207671_10009698 3300025914 Bacteria 8019
156 Ga0207671_10083788 3300025914 Bacteria 2394
157 Ga0207693_10015518 3300025915 Bacteria 6112
158 Ga0207693_10092541 3300025915 Bacteria 2369
159 Ga0207663_10180394 3300025916 Bacteria 1507
160 Ga0207657_10034232 3300025919 Bacteria 4571
161 Ga0207681_10078334 3300025923 Bacteria 2326
162 Ga0207694_10027869 3300025924 Bacteria 4304
163 Ga0207694_10094277 3300025924 Bacteria 2365
164 Ga0207650_10000295 3300025925 Bacteria 50101
165 Ga0207650_10028633 3300025925 Bacteria 3997
166 Ga0207659_10085668 3300025926 Bacteria 2341
167 Ga0207687_10060563 3300025927 Bacteria 2670
168 Ga0207700_10067320 3300025928 Bacteria 2741
169 Ga0207644_10003799 3300025931 Bacteria 9786
170 Ga0207706_10118776 3300025933 Bacteria 2325
171 Ga0207706_10320468 3300025933 Bacteria 1349
172 Ga0207686_10079326 3300025934 Unclassified 2137
173 Ga0207691_10309706 3300025940 Bacteria 1355
174 Ga0207711_10322385 3300025941 Bacteria 1428
175 Ga0207689_10005846 3300025942 Bacteria 10904
176 Ga0207689_10056007 3300025942 Bacteria 3244
177 Ga0207667_10024842 3300025949 Bacteria 6570
178 Ga0207640_10198292 3300025981 Bacteria 1519
179 Ga0207703_10134759 3300026035 Bacteria 2137
180 Ga0207641_10335085 3300026088 Bacteria 1438
181 Ga0207676_10140175 3300026095 Bacteria 2069
182 Ga0207674_10449906 3300026116 Bacteria 1245
183 Ga0207675_100056825 3300026118 Bacteria 3650
184 Ga0207698_10124793 3300026142 Bacteria 2187
185 Ga0207698_10211227 3300026142 Bacteria 1746
186 Ga0209371_1002423 3300027312 Bacteria 10466
187 Ga0209588_1001573 3300027671 Bacteria 5999
188 Ga0268266_10214635 3300028379 Bacteria 1766
189 Ga0268266_10324524 3300028379 Bacteria 1442
190 Ga0268265_10460885 3300028380 Unclassified 1189
191 Ga0268264_10000271 3300028381 Bacteria 90154
192 Ga0265326_10016755 3300028558 Bacteria 2116
193 Ga0265319_1005465 3300028563 Bacteria 6076
194 Ga0265318_10015172 3300028577 Bacteria 3211
195 Ga0265323_10003264 3300028653 Bacteria 7213
196 Ga0265322_10020427 3300028654 Bacteria 1899
197 Ga0265336_10000229 3300028666 Bacteria 39820
198 Ga0265338_10000176 3300028800 Bacteria 118726
199 Ga0268256_1002151 3300030500 Bacteria 10467
200 Ga0265325_10029042 3300031241 Bacteria 2975
201 Ga0265340_10004862 3300031247 Bacteria 7473
202 Ga0265340_10023283 3300031247 Bacteria 3159
203 Ga0307513_10426021 3300031456 Bacteria 1056
204 Ga0265313_10008049 3300031595 Bacteria 7061
205 Ga0307508_10000350 3300031616 Bacteria 55985
206 Ga0307508_10014887 3300031616 Bacteria 7095
207 Ga0307508_10163740 3300031616 Bacteria 1827
208 Ga0265342_10049745 3300031712 Bacteria 2507
209 Ga0307516_10004565 3300031730 Bacteria 17014
210 Ga0307516_10117239 3300031730 Bacteria 2457
211 Ga0307414_10043687 3300032004 Bacteria 3055
212 Ga0307507_10078735 3300033179 Bacteria 2919
213 Ga0307510_10017027 3300033180 Bacteria 8575
214 Ga0373934_0001379 3300035086 Bacteria 8851
215 Ga0373923_0000206 3300035111 Bacteria 12144
216 Ga0373953_0000106 3300035117 Bacteria 20249
217 Ga0373954_0000170 3300035118 Bacteria 23317
218 Ga0373954_0006368 3300035118 Bacteria 5147
219 Ga0373956_0000884 3300035119 Bacteria 12420
220 Ga0373957_0000147 3300035120 Bacteria 17718
221 Ga0373943_0139330 3300035170 Bacteria 1305
222 Ga0373946_0016576 3300035171 Bacteria 2809
223 Ga0373946_0029835 3300035171 Bacteria 2174
224 Ga0373955_0000206 3300035172 Bacteria 24511
225 Ga0373924_0011290 3300035410 Bacteria 3315
226 Ga0373931_0141486 3300035691 Bacteria 1394
227 Ga0373927_0045344 3300035695 Bacteria 2844
228 Ga0373933_0000387 3300035724 Bacteria 28169
229 Ga0373937_0002677 3300036401 Bacteria 14851
230 Ga0373937_0074360 3300036401 Bacteria 3135
231 Ga0373937_0105807 3300036401 Bacteria 2615
232 Ga0316582_0018167 3300036647 Bacteria 4086
233 Ga0373925_0092953 3300037068 Bacteria 2308
234 Ga0395905_0000658 3300037471 Bacteria 45924
235 Ga0395905_0008261 3300037471 Bacteria 10280
236 Ga0395905_0453814 3300037471 Bacteria 1180
237 Ga0436364_0037519 3300037853 Bacteria 2068
238 Ga0436364_0134116 3300037853 Bacteria 1396
239 Ga0395901_0057005 3300038443 Bacteria 4064
240 Ga0436365_0952743 3300039437 Bacteria 3688
241 Ga0436360_0752626 3300039438 Bacteria 2755
242 Ga0436360_1229096 3300039438 Bacteria 3179
243 Ga0436361_0310370 3300039447 Bacteria 3782
244 Ga0436361_0921593 3300039447 Bacteria 4443
245 Ga0436363_0551746 3300039450 Bacteria 3897
246 Ga0436362_0648946 3300039453 Bacteria 1358
247 Ga0439449_0008928 3300042007 Bacteria 3802
248 Ga0466963_0290326 3300044694 Bacteria 1150
249 Ga0453684_0020411 3300044712 Bacteria 9993
250 Ga0466971_0128146 3300044719 Bacteria 1177
251 Ga0466968_0082090 3300044735 Bacteria 1418
252 Ga0466970_0069163 3300044765 Bacteria 1897
253 Ga0466959_0037583 3300045049 Bacteria 3578
254 Ga0466958_0049083 3300045836 Bacteria 2553
255 Ga0466967_0091640 3300045976 Bacteria 2763
256 Ga0495592_0000751 3300046454 Bacteria 22619
257 Ga0495592_0120792 3300046454 Bacteria 1843
258 Ga0495592_0135510 3300046454 Bacteria 1718
259 Ga0495629_0000897 3300046459 Bacteria 23925
260 Ga0495629_0002395 3300046459 Bacteria 14415
261 Ga0495629_0023667 3300046459 Bacteria 4375
262 Ga0495638_0055748 3300046460 Bacteria 2453
263 Ga0495651_0007094 3300046462 Bacteria 8563
264 Ga0495651_0011879 3300046462 Bacteria 6700
265 Ga0495651_0118323 3300046462 Bacteria 1949
266 Ga0495653_0000579 3300046463 Bacteria 28088
267 Ga0495653_0119220 3300046463 Bacteria 1884
268 Ga0495662_0168852 3300046476 Bacteria 1078
269 Ga0495664_0010890 3300046477 Bacteria 5114
270 Ga0495606_0001142 3300046507 Bacteria 37680
271 Ga0495606_0045488 3300046507 Bacteria 2908
272 Ga0495606_0053957 3300046507 Bacteria 2605
273 Ga0495608_0002255 3300046511 Bacteria 13920
274 Ga0495608_0015523 3300046511 Bacteria 5281
275 Ga0495608_0068727 3300046511 Bacteria 2316
276 Ga0495608_0089128 3300046511 Bacteria 1997
277 Ga0495616_0118024 3300046513 Bacteria 1227
278 Ga0495618_0013166 3300046514 Bacteria 5033
279 Ga0495618_0019457 3300046514 Bacteria 4178
280 Ga0495618_0133543 3300046514 Bacteria 1588
281 Ga0495628_0003554 3300046516 Bacteria 13972
282 Ga0495628_0073520 3300046516 Bacteria 2663
283 Ga0495630_0034810 3300046517 Bacteria 3763
284 Ga0495630_0049698 3300046517 Bacteria 3138
285 Ga0495643_0013929 3300046522 Bacteria 4794
286 Ga0495648_0069934 3300046524 Bacteria 2041
287 Ga0495652_0001180 3300046529 Bacteria 29379
288 Ga0495652_0012160 3300046529 Bacteria 7773
289 Ga0495652_0095673 3300046529 Bacteria 2420
290 Ga0495652_0305197 3300046529 Bacteria 1155
291 Ga0495665_0035562 3300046531 Bacteria 2661
292 Ga0495640_0001298 3300046533 Bacteria 19623
293 Ga0495640_0037378 3300046533 Bacteria 3424
294 Ga0495640_0039974 3300046533 Bacteria 3287
295 Ga0495640_0076787 3300046533 Bacteria 2228
296 Ga0495587_0001384 3300046536 Bacteria 16127
297 Ga0495587_0012795 3300046536 Bacteria 5278
298 Ga0495587_0032384 3300046536 Bacteria 3161
299 Ga0495587_0034704 3300046536 Bacteria 3041
300 Ga0495645_0042503 3300046543 Bacteria 3314
301 Ga0495645_0053536 3300046543 Bacteria 2933
302 Ga0495645_0056750 3300046543 Bacteria 2843
303 Ga0495622_0012725 3300046557 Bacteria 3901
304 Ga0495622_0039334 3300046557 Bacteria 2202
305 Ga0495667_0004633 3300046559 Bacteria 9297
306 Ga0495667_0031335 3300046559 Bacteria 3569
307 Ga0495667_0088628 3300046559 Bacteria 2005
308 Ga0495634_0025835 3300046642 Bacteria 4102
309 Ga0495634_0034152 3300046642 Bacteria 3491
310 Ga0495625_0092471 3300046660 Bacteria 2090
311 Ga0495635_0007510 3300046663 Bacteria 7607
312 Ga0495635_0027545 3300046663 Bacteria 3952
313 Ga0495635_0028233 3300046663 Bacteria 3900
314 Ga0495588_0018302 3300046674 Bacteria 3414
315 Ga0495657_0003793 3300046675 Bacteria 12227
316 Ga0495657_0033300 3300046675 Bacteria 3588
317 Ga0495599_0000449 3300046678 Bacteria 23477
318 Ga0495599_0007023 3300046678 Bacteria 6810
319 Ga0495623_0000656 3300046679 Bacteria 22970
320 Ga0495623_0013093 3300046679 Bacteria 5376
321 Ga0495646_0003837 3300046680 Bacteria 9392
322 Ga0495646_0020429 3300046680 Bacteria 4190
323 Ga0495646_0025561 3300046680 Bacteria 3714
324 Ga0495613_0008739 3300046689 Bacteria 7513
325 Ga0495613_0050555 3300046689 Bacteria 3065
326 Ga0495613_0083575 3300046689 Bacteria 2318
327 Ga0495624_0027929 3300046690 Bacteria 3689
328 Ga0495649_0053539 3300046694 Bacteria 2184
329 Ga0495649_0094924 3300046694 Bacteria 1588
330 Ga0495589_0078540 3300046794 Bacteria 1607
331 Ga0495600_0000752 3300046809 Bacteria 17069
332 Ga0495600_0006313 3300046809 Bacteria 7204
333 Ga0495600_0022396 3300046809 Bacteria 4055
334 Ga0495600_0132464 3300046809 Bacteria 1620
335 Ga0495600_0139171 3300046809 Bacteria 1575
336 Ga0495600_0244078 3300046809 Bacteria 1144
337 Ga0495604_0001767 3300047317 Bacteria 17656
338 Ga0495604_0003038 3300047317 Bacteria 13416
339 Ga0495604_0021338 3300047317 Bacteria 5170
340 Ga0495604_0058540 3300047317 Bacteria 2958
341 Ga0495604_0118653 3300047317 Bacteria 1917
342 Ga0495674_0007155 3300047319 Bacteria 10673
343 Ga0495674_0021770 3300047319 Bacteria 5923
344 Ga0495674_0077080 3300047319 Bacteria 2866
345 Ga0495676_0018839 3300047321 Bacteria 6085
346 Ga0495680_0000270 3300047322 Bacteria 57629
347 Ga0495680_0001110 3300047322 Bacteria 29716
348 Ga0495680_0144435 3300047322 Bacteria 1739
349 Ga0495680_0158440 3300047322 Bacteria 1645
350 Ga0495683_0044528 3300047323 Bacteria 2232
351 Ga0495675_0008348 3300047444 Bacteria 6412
352 Ga0495675_0011813 3300047444 Bacteria 5486
353 Ga0495675_0120079 3300047444 Bacteria 1637
354 Ga0495684_0000545 3300047471 Bacteria 30505
355 Ga0495686_0000422 3300047472 Bacteria 66571
356 Ga0495686_0069427 3300047472 Bacteria 2172
357 Ga0495686_0113539 3300047472 Bacteria 1622
358 Ga0495593_0000659 3300047673 Bacteria 19879
359 Ga0495593_0114055 3300047673 Bacteria 1378
360 Ga0495593_0130041 3300047673 Bacteria 1278
361 Ga0495602_0003968 3300048088 Bacteria 15414
362 Ga0495602_0017909 3300048088 Bacteria 7088
363 Ga0495602_0039361 3300048088 Bacteria 4354
364 Ga0495602_0151587 3300048088 Bacteria 1821
365 Ga0496100_0000690 3300048903 Bacteria 16112
366 Ga0496100_0372773 3300048903 Bacteria 1083
367 Ga0496101_0369252 3300048904 Bacteria 1128
368 Ga0496102_0001193 3300048905 Bacteria 23568
369 Ga0496102_0021065 3300048905 Bacteria 5766
370 Ga0496102_0230615 3300048905 Bacteria 1746
371 Ga0496102_0598701 3300048905 Bacteria 1025
372 Ga0496103_0002243 3300048906 Bacteria 12242
373 Ga0496104_0015847 3300048907 Bacteria 6837
374 Ga0496104_0038345 3300048907 Bacteria 4483
375 Ga0496104_0043565 3300048907 Bacteria 4215
376 Ga0496104_0317521 3300048907 Bacteria 1471
377 Ga0496104_0389450 3300048907 Bacteria 1306
378 Ga0496105_0034643 3300048908 Bacteria 4153
379 Ga0496106_0001282 3300048909 Bacteria 18846
380 Ga0496106_0013877 3300048909 Bacteria 5954
381 Ga0496106_0246734 3300048909 Bacteria 1427
382 Ga0496108_0125826 3300048911 Bacteria 2200
383 Ga0496109_0182532 3300048912 Bacteria 1971
384 Ga0496109_0266831 3300048912 Bacteria 1613
385 Ga0496110_0157845 3300048913 Bacteria 2055
386 Ga0496112_0012609 3300048915 Bacteria 7769
387 Ga0496112_0034912 3300048915 Bacteria 4894
388 Ga0496112_0128724 3300048915 Bacteria 2502
389 Ga0496113_0011265 3300048916 Bacteria 5956
390 Ga0496113_0051376 3300048916 Bacteria 3076
391 Ga0496114_0054575 3300048917 Bacteria 3333
392 Ga0496115_0012911 3300048918 Bacteria 6299
393 Ga0496115_0069171 3300048918 Bacteria 2859
394 Ga0496116_0000042 3300048919 Bacteria 330516
395 Ga0496116_0006896 3300048919 Bacteria 10197
396 Ga0496117_0001124 3300048920 Bacteria 40302
397 Ga0496117_0008969 3300048920 Bacteria 9414
398 Ga0496117_0262282 3300048920 Bacteria 936
399 Ga0496118_0000759 3300048921 Bacteria 52080
400 Ga0496118_0001904 3300048921 Bacteria 29719
401 Ga0496118_0026951 3300048921 Bacteria 4878
402 Ga0496118_0092883 3300048921 Bacteria 2069
403 Ga0496118_0095168 3300048921 Bacteria 2034
404 Ga0496118_0180707 3300048921 Bacteria 1275
405 Ga0496119_0003685 3300048922 Bacteria 15705
406 Ga0496119_0005634 3300048922 Bacteria 11904
407 Ga0496119_0017607 3300048922 Bacteria 5368
408 Ga0496119_0023903 3300048922 Bacteria 4317
409 Ga0496119_0037459 3300048922 Bacteria 3150
410 Ga0496120_0002914 3300048923 Bacteria 16343
411 Ga0496120_0007991 3300048923 Bacteria 7784
412 Ga0496120_0059015 3300048923 Bacteria 2152
413 Ga0496121_0000570 3300048924 Bacteria 69574
414 Ga0496121_0000711 3300048924 Bacteria 61682
415 Ga0496121_0002467 3300048924 Bacteria 28235
416 Ga0496121_0007926 3300048924 Bacteria 12696
417 Ga0496121_0009635 3300048924 Bacteria 11065
418 Ga0496121_0010266 3300048924 Bacteria 10595
419 Ga0496121_0179053 3300048924 Bacteria 1532
420 Ga0496122_0001989 3300048925 Bacteria 30502
421 Ga0496122_0047046 3300048925 Bacteria 3334
422 Ga0496123_0004577 3300048926 Bacteria 14408
423 Ga0496123_0010572 3300048926 Bacteria 8130
424 Ga0496123_0077632 3300048926 Bacteria 2039
425 Ga0496124_0000913 3300048927 Bacteria 47694
426 Ga0496124_0111383 3300048927 Bacteria 2202
427 Ga0496125_0005337 3300048928 Bacteria 14359
428 Ga0496125_0022548 3300048928 Bacteria 5842
429 Ga0496125_0090555 3300048928 Bacteria 2295
430 Ga0496125_0097867 3300048928 Bacteria 2172
431 Ga0496126_0000053 3300048929 Bacteria 311989
432 Ga0496126_0011770 3300048929 Bacteria 9008
433 Ga0496126_0013582 3300048929 Bacteria 8270
434 Ga0496126_0137131 3300048929 Bacteria 2109
435 Ga0496126_0142334 3300048929 Bacteria 2063
436 Ga0496126_0160674 3300048929 Bacteria 1920
437 Ga0496126_0185029 3300048929 Bacteria 1767
438 Ga0496126_0229605 3300048929 Bacteria 1555
439 Ga0501033_0000186 3300049570 Bacteria 59624
440 Ga0501073_0007862 3300049589 Bacteria 7916
441 Ga0501249_000983 3300049679 Bacteria 6164
442 Ga0501035_0001063 3300049822 Bacteria 28793
443 nmdc:mga03n38_23426_c1 3300050490 Bacteria 2511
444 nmdc:mga0yw44_10104_c1 3300050492 Bacteria 4806
445 nmdc:mga0yw44_16259_c1 3300050492 Bacteria 4015
446 nmdc:mga0yw44_20639_c1 3300050492 Bacteria 3660
447 nmdc:mga0yw44_4948_c1 3300050492 Bacteria 6207
448 nmdc:mga06z11_101846_c1 3300050494 Bacteria 1577
449 nmdc:mga07m45_20684_c1 3300050496 Bacteria 3576
450 nmdc:mga06r32_44059_c1 3300050510 Bacteria 4247
451 nmdc:mga0sz30_42284_c1 3300050516 Bacteria 1917
452 Ga0495601_0006770 3300053077 Bacteria 6714
453 Ga0495612_0003900 3300053078 Bacteria 6182
454 Ga0495612_0046806 3300053078 Bacteria 1772
455 Ga0495595_0003431 3300053084 Bacteria 6287
456 Ga0495595_0005885 3300053084 Bacteria 4971
457 Ga0495595_0008861 3300053084 Bacteria 4143
458 Ga0495595_0059142 3300053084 Bacteria 1791
459 Ga0495619_0004678 3300053085 Bacteria 8719
460 Ga0495619_0008637 3300053085 Bacteria 6445
461 Ga0500572_000487 3300053111 Bacteria 13649
462 Ga0500595_013359 3300053119 Bacteria 3148
463 Ga0500618_001067 3300053125 Bacteria 13537
464 Ga0500559_0002428 3300053136 Bacteria 9641
465 Ga0500559_0035785 3300053136 Bacteria 2146
466 Ga0500559_0082482 3300053136 Bacteria 1463
467 Ga0500568_0008512 3300053139 Bacteria 4935
468 Ga0500590_004930 3300053148 Bacteria 6375
469 Ga0500616_0000253 3300053153 Bacteria 82747
470 Ga0500619_048671 3300053154 Bacteria 1366
471 Ga0500620_000173 3300053155 Bacteria 13051
472 Ga0500627_0100411 3300053158 Bacteria 1298
473 Ga0500638_022082 3300053162 Bacteria 3012
474 Ga0500639_083920 3300053163 Bacteria 1600
475 Ga0500636_0041831 3300053177 Bacteria 2710
476 Ga0500636_0111639 3300053177 Bacteria 1544
477 Ga0500576_099809 3300053725 Bacteria 1187
478 Ga0500611_034099 3300053727 Bacteria 1076
479 Ga0501084_0441753 3300054114 Bacteria 1100
480 Ga0501082_0181949 3300060353 Bacteria 1828
481 2535520697 2534681796 Bacteria 7146037
482 2509370534 2509276018 Bacteria 6910194
483 2509393024 2509276022 Bacteria 6200534
484 2510314439 2510065059 Bacteria 6847884
485 2511170207 2510917026 Bacteria 7046020
486 2512934421 2512875016 Bacteria 6529530
487 2512962762 2512875024 Bacteria 7195110
488 2513609561 2513237090 Bacteria 7096802
489 2514037358 2513237164 Bacteria 7563725
490 2514419761 2513237305 Bacteria 7293571
491 2514587227 2513237351 Bacteria 6968952
492 2524462204 2524023209 Bacteria 6679728
493 2585279550 2582581308 Bacteria 7413247
494 2585322791 2582581315 Bacteria 7318924
495 2585330960 2582581316 Bacteria 7774528
496 2585530966 2585427527 Bacteria 7273426
497 2585553113 2585427530 Bacteria 7383882
498 2588520589 2588253730 Bacteria 6881675
499 2597810187 2597489875 Bacteria 7010078
500 2599935700 2599185301 Bacteria 6161860
501 2616307124 2615840626 Bacteria 7921970
502 2616554726 2615840698 Bacteria 7319877
503 2617383079 2617270742 Bacteria 6808054
504 2643771487 2643221550 Bacteria 4619371
505 2643857061 2643221568 Bacteria 5187270
506 2643985048 2643221595 Bacteria 6565519
507 2644154022 2643221627 Bacteria 6761570
508 2644242281 2643221643 Bacteria 5749658
509 2671111962 2667528174 Bacteria 6435400
510 2688595405 2687453392 Bacteria 6880454
511 2723572636 2721755686 Bacteria 7343952
512 2738945173 2738541317 Bacteria 5340176
513 2756674519 2756170246 Bacteria 7451806
514 2778175799 2775507266 Bacteria 7392367
515 2792746613 2791355123 Bacteria 8049106
516 2793279672 2791355253 Bacteria 5171699
517 2819609814 2818991448 Bacteria 6772224
518 2819639916 2818991453 Bacteria 7181617
519 2821445678 2821443989 Bacteria 7658172
520 2838034037 2838029111 Bacteria 6603031
521 2841735878 2841734538 Bacteria 6784580
522 2842298481 2842298080 Bacteria 6123127
523 2842360493 2842357229 Bacteria 6485165
524 2842480795 2842475841 Bacteria 6603183
525 2842507394 2842502639 Bacteria 6604161
526 2842510509 2842509118 Bacteria 6850950
527 2844004078 2844002411 Bacteria 7168230
528 2844010186 2844009547 Bacteria 6728125
529 2847689484 2847686936 Bacteria 6278406
530 2852390939 2852387548 Bacteria 8025568
531 2856327823 2856320880 Bacteria 7263508
532 2856331994 2856328259 Bacteria 6528202
533 2856337032 2856334872 Bacteria 7037011
534 2856345210 2856342000 Bacteria 7176905
535 2856355297 2856349417 Bacteria 6230045
536 2856363859 2856356410 Bacteria 6297484
537 2856371287 2856364286 Bacteria 6939991
538 2857357521 2857349434 Bacteria 7926032
539 2857372893 2857367948 Bacteria 6965560
540 2869166245 2869162929 Bacteria 6399702
541 2869238008 2869234852 Bacteria 6654993
542 2869245157 2869242130 Bacteria 6609239
543 2869256011 2869249662 Bacteria 6868783
544 2869261165 2869256925 Bacteria 6981691
545 2869270822 2869264136 Bacteria 6880765
546 2869277529 2869271264 Bacteria 6908218
547 2869279772 2869278585 Bacteria 7077053
548 2869292510 2869285874 Bacteria 6901219
549 2871429325 2871429161 Bacteria 6547891
550 2871439864 2871435913 Bacteria 6880295
551 2871447511 2871444079 Bacteria 6423508
552 2871455162 2871451962 Bacteria 7336357
553 2871459957 2871459585 Bacteria 6866887
554 2871470541 2871466892 Bacteria 6923287
555 2871470775 2871466892 Bacteria 6923287
556 2871478359 2871474448 Bacteria 6806570
557 2871490840 2871488783 Bacteria 6929816
558 2874106964 2874102143 Bacteria 6342645
559 2874112508 2874109183 Bacteria 6517025
560 2874116886 2874116593 Bacteria 6674494
561 2874135596 2874131515 Bacteria 6820270
562 2874145734 2874139085 Bacteria 7021506
563 2874154231 2874146452 Bacteria 7533118
564 2874161733 2874155637 Bacteria 6724144
565 2874166407 2874162495 Bacteria 6174670
566 2874171801 2874168670 Bacteria 8062617
567 2876363316 2876363079 Bacteria 6544991
568 2876390344 2876386047 Bacteria 6698674
569 2876392879 2876392853 Bacteria 6660880
570 2876405413 2876399893 Bacteria 6927900
571 2876410573 2876406927 Bacteria 6191900
572 2876419915 2876413966 Bacteria 6831344
573 2876423810 2876420981 Bacteria 6687741
574 2878740384 2878738818 Bacteria 7136951
575 2878752853 2878745973 Bacteria 6867388
576 2878755245 2878753008 Bacteria 6922523
577 2878778068 2878774303 Bacteria 6108671
578 2878784835 2878781027 Bacteria 6834456
579 2878795984 2878788777 Bacteria 6567085
580 2881147662 2881147464 Bacteria 7779814
581 2881158752 2881155292 Bacteria 6461656
582 2881164438 2881161766 Bacteria 7127907
583 2881856337 2881853255 Bacteria 6698367
584 2881861819 2881861095 Bacteria 7128710
585 2882635014 2882632389 Bacteria 8154593
586 2882916741 2882912400 Bacteria 6801539
587 2885306301 2885305155 Bacteria 7348390
588 2885314653 2885312484 Bacteria 6415165
589 2885338665 2885334103 Bacteria 7216818
590 2885346231 2885342637 Bacteria 7011821
591 2885357071 2885350715 Bacteria 6787678
592 2888342751 2888337043 Bacteria 6629336
593 2888343852 2888343758 Bacteria 6611049
594 2888352551 2888350351 Bacteria 7372807
595 2889014325 2889010040 Bacteria 6749192
596 2889020686 2889016732 Bacteria 6700763
597 2895514792 2895511927 Bacteria 6802080
598 2898797900 2898795034 Bacteria 4294459
599 2899805152 2899803654 Bacteria 5577784
600 2903454609 2903448605 Bacteria 7357801
601 2903494952 2903492973 Bacteria 13473544
602 2903499276 2903492973 Bacteria 13473544
603 2903525266 2903521522 Bacteria 6525694
604 2903531989 2903528002 Bacteria 6586099
605 2904659585 2904659560 Bacteria 6685615
606 2906315244 2906308376 Bacteria 6841989
607 2906321500 2906321335 Bacteria 6579571
608 2906334505 2906328253 Bacteria 6585166
609 2906361906 2906354277 Bacteria 6991324
610 2906365139 2906363423 Bacteria 6856682
611 2906374422 2906370794 Bacteria 6881062
612 2906386122 2906378014 Bacteria 6911440
613 2906396496 2906393657 Bacteria 6790866
614 2906404682 2906401398 Bacteria 6693206
615 2906412012 2906408224 Bacteria 6162342
616 2906435256 2906427513 Bacteria 6375796
617 2913309799 2913308742 Bacteria 5350706
618 2919170209 2919166419 Bacteria 4952238
619 2919175638 2919171160 Bacteria 6499771
620 2919410466 2919408235 Bacteria 6149349
621 2922135791 2922130491 Bacteria 7173936
622 2922153665 2922151315 Bacteria 6902399
623 2922164785 2922158528 Bacteria 6573167
624 2922173449 2922172374 Bacteria 6167644
625 2922193364 2922185730 Bacteria 7113964
626 2924714799 2924710171 Bacteria 6752351
627 2924724015 2924718760 Bacteria 6331356
628 2924731370 2924726620 Bacteria 6271473
629 2924734249 2924733363 Bacteria 7574837
630 2924742480 2924741084 Bacteria 6661321
631 2924754584 2924748358 Bacteria 6154725
632 2924777985 2924776078 Bacteria 7492003
633 2924791466 2924784321 Bacteria 7416538
634 2932404040 2932401849 Bacteria 4262978
635 2935695623 2935694250 Bacteria 9291695
636 2937821786 2937813078 Bacteria 7783518
637 2937822887 2937822353 Bacteria 7290551
638 2937839172 2937836603 Bacteria 6811263
639 2937854543 2937848649 Bacteria 6983481
640 2937867888 2937861824 Bacteria 6660327
641 2937876806 2937868953 Bacteria 6639878
642 2937884547 2937877337 Bacteria 7246526
643 2937895848 2937891427 Bacteria 6357007
644 2937972472 2937972304 Bacteria 7532020
645 2937980570 2937972304 Bacteria 7532020
646 2937983003 2937980651 Bacteria 6517427
647 2939633629 2939631187 Bacteria 6118131
648 2958035640 2958034702 Bacteria 6989922
649 2958044672 2958041894 Bacteria 13082850
650 2958066774 2958064165 Bacteria 7158582
651 2958076256 2958071322 Bacteria 6815895
652 2958091858 2958084443 Bacteria 7312792
653 2958098909 2958092219 Bacteria 6861151
654 2958102413 2958100919 Bacteria 6800575
655 2958112786 2958108152 Bacteria 6681128
656 2958119629 2958115193 Bacteria 6923548
657 2958127769 2958122699 Bacteria 7280457
658 2958136910 2958130278 Bacteria 6897202
659 2958138631 2958137437 Bacteria 6050276
660 2958148247 2958144490 Bacteria 6677056
661 2958174671 2958172287 Bacteria 6716688
662 2958186793 2958179912 Bacteria 6874908
663 2961085294 2961077736 Bacteria 7079850
664 2961114910 2961114664 Bacteria 6680456
665 2961127918 2961127735 Bacteria 7196641
666 2961143209 2961136820 Bacteria 6775228
667 2961176713 2961170736 Bacteria 7072258
668 2961190046 2961183825 Bacteria 6688536
669 2963644776 2963644680 Bacteria 6530403
670 2965028802 2965025482 Bacteria 6532201
671 2965046711 2965040258 Bacteria 6855979
672 2965063919 2965062239 Bacteria 7412989
673 2965091602 2965089291 Bacteria 6866420
674 2965109363 2965102966 Bacteria 6800987
675 2965114303 2965110997 Bacteria 6693150
676 2965125584 2965119406 Bacteria 6956431
677 2968001178 2967996073 Bacteria 6787468
678 2968007230 2968003550 Bacteria 6929263
679 2968021670 2968016561 Bacteria 7022047
680 2968088948 2968083720 Bacteria 7351627
681 2968094054 2968091066 Bacteria 6052692
682 2968100644 2968097103 Bacteria 6107094
683 2968110638 2968110612 Bacteria 6814636
684 2968121708 2968117919 Bacteria 6536078
685 2968134330 2968128360 Bacteria 6270294
686 2968146862 2968138860 Bacteria 6605449
687 2970476651 2970469710 Bacteria 6969209
688 2970494108 2970489779 Bacteria 6517260
689 2970509386 2970503327 Bacteria 7099517
690 2970514934 2970510686 Bacteria 7006402
691 2970525555 2970524798 Bacteria 6840927
692 2970536369 2970532167 Bacteria 6553173
693 2970542146 2970540015 Bacteria 6977556
694 2970553838 2970547951 Bacteria 6931819
695 2970594372 2970593180 Bacteria 7073582
696 2970622909 2970619444 Bacteria 6986144
697 2970633189 2970627176 Bacteria 6680862
698 2977824385 2977821940 Bacteria 6906439
699 2977836710 2977828996 Bacteria 7007971
700 2977849989 2977843712 Bacteria 6753583
701 2977853340 2977851361 Bacteria 6694324
702 2977861504 2977858184 Bacteria 6215359
703 2977867623 2977864932 Bacteria 7534097
704 2977873590 2977872689 Bacteria 7270173
705 2977912238 2977907340 Bacteria 6577984
706 2977921450 2977915119 Bacteria 6829656
707 2977925330 2977922695 Bacteria 6956781
708 2977938326 2977935797 Bacteria 6252826
709 2977950440 2977942078 Bacteria 7570577
710 2977955709 2977950692 Bacteria 6893264
711 2977974107 2977971508 Bacteria 7472917
712 2977987002 2977986579 Bacteria 6581278
713 2978970168 2978969890 Bacteria 5400756
714 2979715062 2979710463 Bacteria 6785254
715 2979766373 2979764755 Bacteria 6610066
716 2979777041 2979772303 Bacteria 6618277
717 2979781733 2979779861 Bacteria 6219781
718 2979796214 2979793036 Bacteria 6808957
719 2979814173 2979808191 Bacteria 7179355
720 2984587195 2984587000 Bacteria 5263363
721 2987644912 2987636660 Bacteria 8088555
722 2987649913 2987645492 Bacteria 6117018
723 2987656991 2987652177 Bacteria 6969023
724 2987673853 2987673487 Bacteria 6884027
725 2995394174 2995392953 Bacteria 4539380
726 2996337502 2996336353 Bacteria 5511628
727 2996344643 2996341866 Bacteria 6643098
728 2996356074 2996348954 Bacteria 7239054
729 2996388456 2996386984 Bacteria 6978667
730 3000135976 3000135777 Bacteria 6891109
731 3004172586 3004167301 Bacteria 8330599
732 3004198768 3004195979 Bacteria 6776956
733 3004209766 3004203850 Bacteria 7307914
734 3004216648 3004211236 Bacteria 7417683
735 3004219681 3004218560 Bacteria 7421728
736 3004235118 3004232784 Bacteria 6662140
737 3004243183 3004239961 Bacteria 6892290
738 3004253638 3004248173 Bacteria 6563236
739 3004273099 3004268573 Bacteria 7043476
740 3004282388 3004275668 Bacteria 7114440
741 3004292957 3004289098 Bacteria 6135450
742 3005416174 3005409236 Bacteria 7188837
743 3005418702 3005416602 Bacteria 7064308
744 3005711474 3005710791 Bacteria 7622528
745 3005721172 3005718088 Bacteria 8283608
746 637077577 637000159 Bacteria 7596297
747 649869973 649633066 Bacteria 6690028
748 8004304140 8004300914 Bacteria 6132239
749 8004314782 8004312739 Bacteria 7444653
750 8004362982 8004361976 Bacteria 6858373
751 8004376824 8004374579 Bacteria 6898112
752 8004395184 8004387939 Bacteria 7049250
753 8004402629 8004395343 Bacteria 6620908
754 8004446947 8004445564 Bacteria 6322258
755 8004638829 8004633249 Bacteria 6723080
756 8004646872 8004640170 Bacteria 6723001
757 8004707213 8004703790 Bacteria 8006957
758 8004721505 8004714634 Bacteria 6776161
759 8004730170 8004727605 Bacteria 6643904
760 8005318406 8005314921 Bacteria 7072929
761 8005488710 8005484373 Bacteria 6297373
762 8005548462 8005542996 Bacteria 7077758
763 8005645909 8005645114 Bacteria 6950293
764 8005682412 8005682033 Bacteria 6726518
765 8024488554 8024486573 Bacteria 6540512
766 8046772517 8046767195 Bacteria 7547379
767 8057577024 8057575449 Bacteria 7367519
768 JGI24740J21852_10018233
769 JGI25156J39149_1000050
770 JGI25162J39368_1000418
771 JGI25162J39368_1000515
772 JGI25154J39366_1000035
773 JGI25157J39369_1000036
774 JGI25159J45721_1004732
775 JGI25165J46597_1000375
776 JGI25165J46597_1000703
777 rootH1_10060886
778 rootH1_10289051
779 JGI25160J50197_1000001
780 JGI25161J50226_1000047
781 Ga0055542_1000295
782 Ga0055529_1001144
783 Ga0055540_1015051
784 Ga0055540_1018129
785 Ga0058692_1010167
786 Ga0055543_1000007
787 Ga0065165_1000464
788 Ga0065712_10070322
789 Ga0065715_10093116
790 Ga0065715_10272810
791 Ga0070670_100000359
792 Ga0070670_100030535
793 Ga0070660_100026496
794 Ga0070689_100172905
795 Ga0070687_100211773
796 Ga0070661_100109895
797 Ga0070661_100155549
798 Ga0070669_100027674
799 Ga0070671_100016976
800 Ga0070659_100171962
801 Ga0070713_100030217
802 Ga0070713_100099174
803 Ga0070711_100047169
804 Ga0070663_100124224
805 Ga0070662_100073987
806 Ga0070706_100099290
807 Ga0070697_100217183
808 Ga0068853_100269042
809 Ga0070665_100112635
810 Ga0070665_100194198
811 Ga0070665_100528113
812 Ga0068855_100029478
813 Ga0068855_100094868
814 Ga0068855_100544781
815 Ga0070664_100072989
816 Ga0068857_100081217
817 Ga0068854_100066599
818 Ga0068854_100123394
819 Ga0068856_100099524
820 Ga0070702_100130546
821 Ga0068852_100014705
822 Ga0068859_100140372
823 Ga0068859_100200164
824 Ga0068864_100169410
825 Ga0068866_10051381
826 Ga0068861_100249767
827 Ga0068851_10041873
828 Ga0068858_100231820
829 Ga0068860_100000217
830 Ga0068862_100326522
831 Ga0081540_1034659
832 Ga0070717_10007198
833 Ga0075365_10008039
834 Ga0075365_10040435
835 Ga0075365_10057298
836 Ga0075363_100035657
837 Ga0075363_100046135
838 Ga0070712_100015805
839 Ga0070712_100151349
840 Ga0075428_100386195
841 Ga0075433_10113886
842 Ga0097620_100140377
843 Ga0097620_100200177
844 Ga0075435_100242575
845 Ga0099794_10004551
846 Ga0099795_10001273
847 Ga0105240_10000014
848 Ga0105240_10055392
849 Ga0105240_10077982
850 Ga0105245_10127683
851 Ga0105245_10188929
852 Ga0105247_10055807
853 Ga0105241_10003792
854 Ga0105241_10057175
855 Ga0105241_10058783
856 Ga0105242_10138494
857 Ga0105248_10040706
858 Ga0105248_10355666
859 Ga0105248_10474145
860 Ga0105237_10001838
861 Ga0105237_10062632
862 Ga0105237_10096702
863 Ga0105237_10133802
864 Ga0105237_10167299
865 Ga0105238_10010231
866 Ga0105238_10122794
867 Ga0099796_10000237
868 Ga0105239_10006392
869 Ga0105239_10016078
870 Ga0105239_10039243
871 Ga0105239_10066449
872 Ga0105239_10066684
873 Ga0105246_10166160
874 Ga0105246_10194692
875 Ga0157370_10000015
876 Ga0157369_10019081
877 Ga0157369_10169760
878 Ga0157378_10494401
879 Ga0163162_10051368
880 Ga0157375_10019634
881 Ga0157375_10032233
882 Ga0157375_10410746
883 Ga0163163_10256395
884 Ga0157379_10151761
885 Ga0157376_10099765
886 Ga0182006_1041539
887 Ga0182007_10013215
888 Ga0182005_1003993
889 Ga0213874_10000517
890 Ga0228598_1001278
891 Ga0209435_100005
892 Ga0209437_100058
893 Ga0209437_100060
894 Ga0209646_1000011
895 Ga0209026_1000008
896 Ga0209026_1000013
897 Ga0209677_101413
898 Ga0209677_104869
899 Ga0209148_1000032
900 Ga0209148_1000840
901 Ga0209759_1000004
902 Ga0209759_1000058
903 Ga0209233_1000137
904 Ga0209233_1000240
905 Ga0209233_1000275
906 Ga0209233_1003699
907 Ga0209233_1007964
908 Ga0209455_1000098
909 Ga0209455_1000105
910 Ga0209130_1000145
911 Ga0209025_1059110
912 Ga0207426_1000011
913 Ga0209051_1000668
914 Ga0207656_10035310
915 Ga0207642_10040086
916 Ga0207680_10106493
917 Ga0207654_10080956
918 Ga0207695_10000037
919 Ga0207695_10000065
920 Ga0207695_10045254
921 Ga0207671_10000080
922 Ga0207671_10009698
923 Ga0207671_10083788
924 Ga0207693_10015518
925 Ga0207693_10092541
926 Ga0207663_10180394
927 Ga0207657_10034232
928 Ga0207681_10078334
929 Ga0207694_10027869
930 Ga0207694_10094277
931 Ga0207650_10000295
932 Ga0207650_10028633
933 Ga0207659_10085668
934 Ga0207687_10060563
935 Ga0207700_10067320
936 Ga0207644_10003799
937 Ga0207706_10118776
938 Ga0207706_10320468
939 Ga0207686_10079326
940 Ga0207691_10309706
941 Ga0207711_10322385
942 Ga0207689_10005846
943 Ga0207689_10056007
944 Ga0207667_10024842
945 Ga0207640_10198292
946 Ga0207703_10134759
947 Ga0207641_10335085
948 Ga0207676_10140175
949 Ga0207674_10449906
950 Ga0207675_100056825
951 Ga0207698_10124793
952 Ga0207698_10211227
953 Ga0209371_1002423
954 Ga0209588_1001573
955 Ga0268266_10214635
956 Ga0268266_10324524
957 Ga0268265_10460885
958 Ga0268264_10000271
959 Ga0265326_10016755
960 Ga0265319_1005465
961 Ga0265318_10015172
962 Ga0265323_10003264
963 Ga0265322_10020427
964 Ga0265336_10000229
965 Ga0265338_10000176
966 Ga0268256_1002151
967 Ga0265325_10029042
968 Ga0265340_10004862
969 Ga0265340_10023283
970 Ga0307513_10426021
971 Ga0265313_10008049
972 Ga0307508_10000350
973 Ga0307508_10014887
974 Ga0307508_10163740
975 Ga0265342_10049745
976 Ga0307516_10004565
977 Ga0307516_10117239
978 Ga0307414_10043687
979 Ga0307507_10078735
980 Ga0307510_10017027
981 Ga0373934_0001379
982 Ga0373923_0000206
983 Ga0373953_0000106
984 Ga0373954_0000170
985 Ga0373954_0006368
986 Ga0373956_0000884
987 Ga0373957_0000147
988 Ga0373943_0139330
989 Ga0373946_0016576
990 Ga0373946_0029835
991 Ga0373955_0000206
992 Ga0373924_0011290
993 Ga0373931_0141486
994 Ga0373927_0045344
995 Ga0373933_0000387
996 Ga0373937_0002677
997 Ga0373937_0074360
998 Ga0373937_0105807
999 Ga0316582_0018167
1000 Ga0373925_0092953
1001 Ga0395905_0000658
1002 Ga0395905_0008261
1003 Ga0395905_0453814
1004 Ga0436364_0037519
1005 Ga0436364_0134116
1006 Ga0395901_0057005
1007 Ga0436365_0952743
1008 Ga0436360_0752626
1009 Ga0436360_1229096
1010 Ga0436361_0310370
1011 Ga0436361_0921593
1012 Ga0436363_0551746
1013 Ga0436362_0648946
1014 Ga0439449_0008928
1015 Ga0466963_0290326
1016 Ga0453684_0020411
1017 Ga0466971_0128146
1018 Ga0466968_0082090
1019 Ga0466970_0069163
1020 Ga0466959_0037583
1021 Ga0466958_0049083
1022 Ga0466967_0091640
1023 Ga0495592_0000751
1024 Ga0495592_0120792
1025 Ga0495592_0135510
1026 Ga0495629_0000897
1027 Ga0495629_0002395
1028 Ga0495629_0023667
1029 Ga0495638_0055748
1030 Ga0495651_0007094
1031 Ga0495651_0011879
1032 Ga0495651_0118323
1033 Ga0495653_0000579
1034 Ga0495653_0119220
1035 Ga0495662_0168852
1036 Ga0495664_0010890
1037 Ga0495606_0001142
1038 Ga0495606_0045488
1039 Ga0495606_0053957
1040 Ga0495608_0002255
1041 Ga0495608_0015523
1042 Ga0495608_0068727
1043 Ga0495608_0089128
1044 Ga0495616_0118024
1045 Ga0495618_0013166
1046 Ga0495618_0019457
1047 Ga0495618_0133543
1048 Ga0495628_0003554
1049 Ga0495628_0073520
1050 Ga0495630_0034810
1051 Ga0495630_0049698
1052 Ga0495643_0013929
1053 Ga0495648_0069934
1054 Ga0495652_0001180
1055 Ga0495652_0012160
1056 Ga0495652_0095673
1057 Ga0495652_0305197
1058 Ga0495665_0035562
1059 Ga0495640_0001298
1060 Ga0495640_0037378
1061 Ga0495640_0039974
1062 Ga0495640_0076787
1063 Ga0495587_0001384
1064 Ga0495587_0012795
1065 Ga0495587_0032384
1066 Ga0495587_0034704
1067 Ga0495645_0042503
1068 Ga0495645_0053536
1069 Ga0495645_0056750
1070 Ga0495622_0012725
1071 Ga0495622_0039334
1072 Ga0495667_0004633
1073 Ga0495667_0031335
1074 Ga0495667_0088628
1075 Ga0495634_0025835
1076 Ga0495634_0034152
1077 Ga0495625_0092471
1078 Ga0495635_0007510
1079 Ga0495635_0027545
1080 Ga0495635_0028233
1081 Ga0495588_0018302
1082 Ga0495657_0003793
1083 Ga0495657_0033300
1084 Ga0495599_0000449
1085 Ga0495599_0007023
1086 Ga0495623_0000656
1087 Ga0495623_0013093
1088 Ga0495646_0003837
1089 Ga0495646_0020429
1090 Ga0495646_0025561
1091 Ga0495613_0008739
1092 Ga0495613_0050555
1093 Ga0495613_0083575
1094 Ga0495624_0027929
1095 Ga0495649_0053539
1096 Ga0495649_0094924
1097 Ga0495589_0078540
1098 Ga0495600_0000752
1099 Ga0495600_0006313
1100 Ga0495600_0022396
1101 Ga0495600_0132464
1102 Ga0495600_0139171
1103 Ga0495600_0244078
1104 Ga0495604_0001767
1105 Ga0495604_0003038
1106 Ga0495604_0021338
1107 Ga0495604_0058540
1108 Ga0495604_0118653
1109 Ga0495674_0007155
1110 Ga0495674_0021770
1111 Ga0495674_0077080
1112 Ga0495676_0018839
1113 Ga0495680_0000270
1114 Ga0495680_0001110
1115 Ga0495680_0144435
1116 Ga0495680_0158440
1117 Ga0495683_0044528
1118 Ga0495675_0008348
1119 Ga0495675_0011813
1120 Ga0495675_0120079
1121 Ga0495684_0000545
1122 Ga0495686_0000422
1123 Ga0495686_0069427
1124 Ga0495686_0113539
1125 Ga0495593_0000659
1126 Ga0495593_0114055
1127 Ga0495593_0130041
1128 Ga0495602_0003968
1129 Ga0495602_0017909
1130 Ga0495602_0039361
1131 Ga0495602_0151587
1132 Ga0496100_0000690
1133 Ga0496100_0372773
1134 Ga0496101_0369252
1135 Ga0496102_0001193
1136 Ga0496102_0021065
1137 Ga0496102_0230615
1138 Ga0496102_0598701
1139 Ga0496103_0002243
1140 Ga0496104_0015847
1141 Ga0496104_0038345
1142 Ga0496104_0043565
1143 Ga0496104_0317521
1144 Ga0496104_0389450
1145 Ga0496105_0034643
1146 Ga0496106_0001282
1147 Ga0496106_0013877
1148 Ga0496106_0246734
1149 Ga0496108_0125826
1150 Ga0496109_0182532
1151 Ga0496109_0266831
1152 Ga0496110_0157845
1153 Ga0496112_0012609
1154 Ga0496112_0034912
1155 Ga0496112_0128724
1156 Ga0496113_0011265
1157 Ga0496113_0051376
1158 Ga0496114_0054575
1159 Ga0496115_0012911
1160 Ga0496115_0069171
1161 Ga0496116_0000042
1162 Ga0496116_0006896
1163 Ga0496117_0001124
1164 Ga0496117_0008969
1165 Ga0496117_0262282
1166 Ga0496118_0000759
1167 Ga0496118_0001904
1168 Ga0496118_0026951
1169 Ga0496118_0092883
1170 Ga0496118_0095168
1171 Ga0496118_0180707
1172 Ga0496119_0003685
1173 Ga0496119_0005634
1174 Ga0496119_0017607
1175 Ga0496119_0023903
1176 Ga0496119_0037459
1177 Ga0496120_0002914
1178 Ga0496120_0007991
1179 Ga0496120_0059015
1180 Ga0496121_0000570
1181 Ga0496121_0000711
1182 Ga0496121_0002467
1183 Ga0496121_0007926
1184 Ga0496121_0009635
1185 Ga0496121_0010266
1186 Ga0496121_0179053
1187 Ga0496122_0001989
1188 Ga0496122_0047046
1189 Ga0496123_0004577
1190 Ga0496123_0010572
1191 Ga0496123_0077632
1192 Ga0496124_0000913
1193 Ga0496124_0111383
1194 Ga0496125_0005337
1195 Ga0496125_0022548
1196 Ga0496125_0090555
1197 Ga0496125_0097867
1198 Ga0496126_0000053
1199 Ga0496126_0011770
1200 Ga0496126_0013582
1201 Ga0496126_0137131
1202 Ga0496126_0142334
1203 Ga0496126_0160674
1204 Ga0496126_0185029
1205 Ga0496126_0229605
1206 Ga0501033_0000186
1207 Ga0501073_0007862
1208 Ga0501249_000983
1209 Ga0501035_0001063
1210 nmdc:mga03n38_23426_c1
1211 nmdc:mga0yw44_10104_c1
1212 nmdc:mga0yw44_16259_c1
1213 nmdc:mga0yw44_20639_c1
1214 nmdc:mga0yw44_4948_c1
1215 nmdc:mga06z11_101846_c1
1216 nmdc:mga07m45_20684_c1
1217 nmdc:mga06r32_44059_c1
1218 nmdc:mga0sz30_42284_c1
1219 Ga0495601_0006770
1220 Ga0495612_0003900
1221 Ga0495612_0046806
1222 Ga0495595_0003431
1223 Ga0495595_0005885
1224 Ga0495595_0008861
1225 Ga0495595_0059142
1226 Ga0495619_0004678
1227 Ga0495619_0008637
1228 Ga0500572_000487
1229 Ga0500595_013359
1230 Ga0500618_001067
1231 Ga0500559_0002428
1232 Ga0500559_0035785
1233 Ga0500559_0082482
1234 Ga0500568_0008512
1235 Ga0500590_004930
1236 Ga0500616_0000253
1237 Ga0500619_048671
1238 Ga0500620_000173
1239 Ga0500627_0100411
1240 Ga0500638_022082
1241 Ga0500639_083920
1242 Ga0500636_0041831
1243 Ga0500636_0111639
1244 Ga0500576_099809
1245 Ga0500611_034099
1246 Ga0501084_0441753
1247 Ga0501082_0181949
1248 2535520697
1249 2509370534
1250 2509393024
1251 2510314439
1252 2511170207
1253 2512934421
1254 2512962762
1255 2513609561
1256 2514037358
1257 2514419761
1258 2514587227
1259 2524462204
1260 2585279550
1261 2585322791
1262 2585330960
1263 2585530966
1264 2585553113
1265 2588520589
1266 2597810187
1267 2599935700
1268 2616307124
1269 2616554726
1270 2617383079
1271 2643771487
1272 2643857061
1273 2643985048
1274 2644154022
1275 2644242281
1276 2671111962
1277 2688595405
1278 2723572636
1279 2738945173
1280 2756674519
1281 2778175799
1282 2792746613
1283 2793279672
1284 2819609814
1285 2819639916
1286 2821445678
1287 2838034037
1288 2841735878
1289 2842298481
1290 2842360493
1291 2842480795
1292 2842507394
1293 2842510509
1294 2844004078
1295 2844010186
1296 2847689484
1297 2852390939
1298 2856327823
1299 2856331994
1300 2856337032
1301 2856345210
1302 2856355297
1303 2856363859
1304 2856371287
1305 2857357521
1306 2857372893
1307 2869166245
1308 2869238008
1309 2869245157
1310 2869256011
1311 2869261165
1312 2869270822
1313 2869277529
1314 2869279772
1315 2869292510
1316 2871429325
1317 2871439864
1318 2871447511
1319 2871455162
1320 2871459957
1321 2871470541
1322 2871470775
1323 2871478359
1324 2871490840
1325 2874106964
1326 2874112508
1327 2874116886
1328 2874135596
1329 2874145734
1330 2874154231
1331 2874161733
1332 2874166407
1333 2874171801
1334 2876363316
1335 2876390344
1336 2876392879
1337 2876405413
1338 2876410573
1339 2876419915
1340 2876423810
1341 2878740384
1342 2878752853
1343 2878755245
1344 2878778068
1345 2878784835
1346 2878795984
1347 2881147662
1348 2881158752
1349 2881164438
1350 2881856337
1351 2881861819
1352 2882635014
1353 2882916741
1354 2885306301
1355 2885314653
1356 2885338665
1357 2885346231
1358 2885357071
1359 2888342751
1360 2888343852
1361 2888352551
1362 2889014325
1363 2889020686
1364 2895514792
1365 2898797900
1366 2899805152
1367 2903454609
1368 2903494952
1369 2903499276
1370 2903525266
1371 2903531989
1372 2904659585
1373 2906315244
1374 2906321500
1375 2906334505
1376 2906361906
1377 2906365139
1378 2906374422
1379 2906386122
1380 2906396496
1381 2906404682
1382 2906412012
1383 2906435256
1384 2913309799
1385 2919170209
1386 2919175638
1387 2919410466
1388 2922135791
1389 2922153665
1390 2922164785
1391 2922173449
1392 2922193364
1393 2924714799
1394 2924724015
1395 2924731370
1396 2924734249
1397 2924742480
1398 2924754584
1399 2924777985
1400 2924791466
1401 2932404040
1402 2935695623
1403 2937821786
1404 2937822887
1405 2937839172
1406 2937854543
1407 2937867888
1408 2937876806
1409 2937884547
1410 2937895848
1411 2937972472
1412 2937980570
1413 2937983003
1414 2939633629
1415 2958035640
1416 2958044672
1417 2958066774
1418 2958076256
1419 2958091858
1420 2958098909
1421 2958102413
1422 2958112786
1423 2958119629
1424 2958127769
1425 2958136910
1426 2958138631
1427 2958148247
1428 2958174671
1429 2958186793
1430 2961085294
1431 2961114910
1432 2961127918
1433 2961143209
1434 2961176713
1435 2961190046
1436 2963644776
1437 2965028802
1438 2965046711
1439 2965063919
1440 2965091602
1441 2965109363
1442 2965114303
1443 2965125584
1444 2968001178
1445 2968007230
1446 2968021670
1447 2968088948
1448 2968094054
1449 2968100644
1450 2968110638
1451 2968121708
1452 2968134330
1453 2968146862
1454 2970476651
1455 2970494108
1456 2970509386
1457 2970514934
1458 2970525555
1459 2970536369
1460 2970542146
1461 2970553838
1462 2970594372
1463 2970622909
1464 2970633189
1465 2977824385
1466 2977836710
1467 2977849989
1468 2977853340
1469 2977861504
1470 2977867623
1471 2977873590
1472 2977912238
1473 2977921450
1474 2977925330
1475 2977938326
1476 2977950440
1477 2977955709
1478 2977974107
1479 2977987002
1480 2978970168
1481 2979715062
1482 2979766373
1483 2979777041
1484 2979781733
1485 2979796214
1486 2979814173
1487 2984587195
1488 2987644912
1489 2987649913
1490 2987656991
1491 2987673853
1492 2995394174
1493 2996337502
1494 2996344643
1495 2996356074
1496 2996388456
1497 3000135976
1498 3004172586
1499 3004198768
1500 3004209766
1501 3004216648
1502 3004219681
1503 3004235118
1504 3004243183
1505 3004253638
1506 3004273099
1507 3004282388
1508 3004292957
1509 3005416174
1510 3005418702
1511 3005711474
1512 3005721172
1513 637077577
1514 649869973
1515 8004304140
1516 8004314782
1517 8004362982
1518 8004376824
1519 8004395184
1520 8004402629
1521 8004446947
1522 8004638829
1523 8004646872
1524 8004707213
1525 8004721505
1526 8004730170
1527 8005318406
1528 8005488710
1529 8005548462
1530 8005645909
1531 8005682412
1532 8024488554
1533 8046772517
1534 8057577024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

146

370

0.96

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

37

139

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6263 89 291
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.6193 88 288
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.5901 89 291
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.5511 90 297
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.5394 50 291
ID Description Score Start End Superfamily
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.849 71 292 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7615 85 293 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7604 86 289 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7571 89 291 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7491 90 291 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A533IW25-F1-model_v4 deleted 0.8906 4 164
AF-A0A3S4TSE0-F1-model_v4 ABC transporter permease 0.889 4 158 GO:0005886
GO:0071916
AF-A0A436BUJ9-F1-model_v4 ABC transporter permease 0.8785 1 157 GO:0005886
GO:0071916
AF-A0A436BUJ9-F1-model_v4 ABC transporter permease 0.8734 1 157 GO:0005886
GO:0071916
AF-I3UE07-F1-model_v4 Binding-protein-dependent transport system inner membrane protein 0.8727 1 296 GO:0005886
GO:0071916

Map