F479924

General Info

Members Datasets Scaffolds Average Seq Length
767 365 1534 350

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0002155|Ga0501084_0002155_2553_3581
Length 324
Sequence MAEEKKHALEHALDEINKRWGEGSIMPLGESNTMAIESIPTGSLSLDLALGVGGIPRGRVTEIYGPESSGKTTICQHIVAEVQKKGGTAAYIDMEHALDPTYAARCGVDVEKLLISQPDTGEQALEIAEALVRSGAVDLVVVDSVAALVPRSEIEGDMGDATMGMQARLMSQANQLRQKIGVMFGNPETTTGGMALKFYASVRMDVRRVQSIKEGQDIVGSRTRVRIVKNKVSAPFRTAEFDIMYNEGISKAGDVLDLASQLDIVTKRGSHYLYGEERLGQGRENAKAFLRENEAVAAAIEEKVRAHAEPNLLLGAGEGDAGDE

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
102 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
103 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
104 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
185 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
193 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
194 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
195 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
196 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
197 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
198 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
218 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
219 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
236 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
237 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
238 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
243 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
244 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
245 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
248 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
341 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
342 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
349 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
352 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
355 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
356 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
357 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
358 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
359 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
360 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
361 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
362 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
363 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
364 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
365 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 0.65
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.21
Nodule 0.26
Rhizoplane 3.26
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0002155 3300054114 Bacteria 15758
2 SwRhRL2b_contig_2039187 2162886007 Bacteria 9314
3 JGI24741J21665_1000172 3300001915 Bacteria 18661
4 JGI24741J21665_1000432 3300001915 Bacteria 12653
5 JGI24740J21852_10006184 3300001979 Bacteria 4990
6 JGI24740J21852_10008985 3300001979 Bacteria 3942
7 JGI24739J22299_10002774 3300001989 Bacteria 6734
8 JGI24739J22299_10003084 3300001989 Bacteria 6363
9 JGI24737J22298_10000010 3300001990 Bacteria 55828
10 JGI24737J22298_10000043 3300001990 Bacteria 36744
11 JGI24743J22301_10001560 3300001991 Bacteria 3214
12 JGI24735J21928_10000052 3300002067 Bacteria 50482
13 JGI24735J21928_10000104 3300002067 Bacteria 31029
14 JGI24738J21930_10000355 3300002075 Bacteria 12706
15 JGI24738J21930_10008934 3300002075 Bacteria 2270
16 JGI24033J26618_1000732 3300002155 Bacteria 3144
17 JGI25150J39212_1000657 3300002774 Bacteria 12838
18 JGI25151J46595_10029487 3300003187 Bacteria 2172
19 JGI25406J46586_10026712 3300003203 Bacteria 2221
20 JGI25153J46596_10000266 3300003215 Bacteria 41550
21 rootH1_10009329 3300003316 Bacteria 46993
22 rootH2_10006821 3300003320 Bacteria 94080
23 rootH1_10012137 3300003323 Bacteria 62005
24 Ga0055526_1006177 3300003771 Bacteria 6589
25 Ga0055540_1000692 3300003792 Bacteria 23249
26 Ga0065704_10000250 3300005289 Bacteria 52865
27 Ga0065704_10000296 3300005289 Bacteria 57332
28 Ga0065712_10160842 3300005290 Bacteria 1303
29 Ga0065707_10082246 3300005295 Bacteria 18304
30 Ga0065707_10105175 3300005295 Bacteria 2657
31 Ga0070658_10000009 3300005327 Bacteria 319868
32 Ga0070658_10000110 3300005327 Bacteria 73137
33 Ga0070658_10000385 3300005327 Bacteria 38446
34 Ga0070683_100000184 3300005329 Bacteria 41529
35 Ga0070683_100063971 3300005329 Bacteria 3423
36 Ga0070683_100113090 3300005329 Bacteria 2562
37 Ga0070690_100015025 3300005330 Bacteria 4608
38 Ga0070670_100115038 3300005331 Bacteria 2319
39 Ga0070666_10095755 3300005335 Bacteria 2043
40 Ga0070680_100244075 3300005336 Bacteria 1518
41 Ga0070660_100010369 3300005339 Bacteria 6585
42 Ga0070660_100183842 3300005339 Bacteria 1692
43 Ga0070669_100000068 3300005353 Bacteria 103282
44 Ga0070675_100115022 3300005354 Bacteria 2280
45 Ga0070671_100000001 3300005355 Bacteria 1228151
46 Ga0070671_100001336 3300005355 Bacteria 18491
47 Ga0070674_100046632 3300005356 Bacteria 2966
48 Ga0070659_100012416 3300005366 Bacteria 6316
49 Ga0070667_100000001 3300005367 Bacteria 1108638
50 Ga0070667_100000157 3300005367 Bacteria 84556
51 Ga0070667_100006733 3300005367 Bacteria 9546
52 Ga0070667_100019440 3300005367 Bacteria 5636
53 Ga0070667_100044275 3300005367 Bacteria 3737
54 Ga0070714_100000082 3300005435 Bacteria 82377
55 Ga0070714_100001000 3300005435 Bacteria 20165
56 Ga0070714_100031012 3300005435 Bacteria 4455
57 Ga0070713_100051150 3300005436 Bacteria 3417
58 Ga0070713_100059589 3300005436 Bacteria 3189
59 Ga0070713_100129400 3300005436 Bacteria 2224
60 Ga0070713_100264606 3300005436 Bacteria 1572
61 Ga0070701_10161699 3300005438 Bacteria 1297
62 Ga0070694_100198343 3300005444 Bacteria 1495
63 Ga0070708_100000018 3300005445 Bacteria 119022
64 Ga0070708_100004468 3300005445 Bacteria 11001
65 Ga0070708_100084659 3300005445 Bacteria 2876
66 Ga0070708_100089745 3300005445 Bacteria 2797
67 Ga0070708_100130313 3300005445 Bacteria 2327
68 Ga0070678_100000104 3300005456 Bacteria 32585
69 Ga0070678_100015475 3300005456 Bacteria 4852
70 Ga0070662_100006047 3300005457 Bacteria 7770
71 Ga0070681_10160778 3300005458 Bacteria 2170
72 Ga0070706_100000026 3300005467 Bacteria 156154
73 Ga0070706_100000548 3300005467 Bacteria 43687
74 Ga0070706_100006587 3300005467 Bacteria 10952
75 Ga0070706_100088844 3300005467 Bacteria 2865
76 Ga0070706_100143741 3300005467 Bacteria 2227
77 Ga0070706_100164761 3300005467 Bacteria 2070
78 Ga0070707_100000004 3300005468 Bacteria 265003
79 Ga0070707_100000434 3300005468 Bacteria 41451
80 Ga0070707_100002828 3300005468 Bacteria 16510
81 Ga0070707_100006967 3300005468 Bacteria 10476
82 Ga0070707_100027594 3300005468 Bacteria 5402
83 Ga0070707_100066689 3300005468 Bacteria 3459
84 Ga0070707_100183776 3300005468 Bacteria 2038
85 Ga0070698_100003377 3300005471 Bacteria 17558
86 Ga0070698_100004957 3300005471 Bacteria 14587
87 Ga0070698_100015120 3300005471 Bacteria 8160
88 Ga0070699_100000042 3300005518 Bacteria 127464
89 Ga0070699_100005835 3300005518 Bacteria 10763
90 Ga0070699_100050609 3300005518 Bacteria 3597
91 Ga0070699_100064723 3300005518 Bacteria 3171
92 Ga0070679_100016249 3300005530 Bacteria 7171
93 Ga0070679_100056515 3300005530 Bacteria 3910
94 Ga0070684_100000345 3300005535 Bacteria 31913
95 Ga0070697_100000006 3300005536 Bacteria 226483
96 Ga0070697_100003316 3300005536 Bacteria 12369
97 Ga0070697_100060273 3300005536 Bacteria 3092
98 Ga0070697_100184769 3300005536 Bacteria 1768
99 Ga0070695_100145339 3300005545 Bacteria 1649
100 Ga0070696_100080143 3300005546 Bacteria 2311
101 Ga0070665_100000086 3300005548 Bacteria 178229
102 Ga0070665_100007667 3300005548 Bacteria 10966
103 Ga0070704_100026011 3300005549 Bacteria 3861
104 Ga0068855_100000002 3300005563 Bacteria 616881
105 Ga0068855_100000005 3300005563 Bacteria 337711
106 Ga0068855_100007933 3300005563 Bacteria 12829
107 Ga0068855_100062267 3300005563 Bacteria 4356
108 Ga0070664_100000721 3300005564 Bacteria 25354
109 Ga0070664_100026141 3300005564 Bacteria 4840
110 Ga0068857_100000057 3300005577 Bacteria 62388
111 Ga0068857_100000066 3300005577 Bacteria 59014
112 Ga0068857_100040042 3300005577 Bacteria 4155
113 Ga0068857_100271286 3300005577 Bacteria 1559
114 Ga0068857_100277832 3300005577 Bacteria 1540
115 Ga0068856_100000029 3300005614 Bacteria 130205
116 Ga0068856_100000122 3300005614 Bacteria 78134
117 Ga0068856_100203100 3300005614 Bacteria 1996
118 Ga0068856_100543657 3300005614 Bacteria 1183
119 Ga0070702_100139784 3300005615 Bacteria 1541
120 Ga0068852_100000001 3300005616 Bacteria 716526
121 Ga0068852_100000011 3300005616 Bacteria 141147
122 Ga0068859_100213391 3300005617 Bacteria 2017
123 Ga0068864_100152392 3300005618 Bacteria 2095
124 Ga0068866_10029123 3300005718 Bacteria 2638
125 Ga0068860_100008228 3300005843 Bacteria 10381
126 Ga0068860_100119400 3300005843 Bacteria 2524
127 Ga0068862_100021245 3300005844 Bacteria 5425
128 Ga0068862_100317353 3300005844 Bacteria 1437
129 Ga0081455_10000008 3300005937 Bacteria 256558
130 Ga0081538_10000568 3300005981 Bacteria 40894
131 Ga0081538_10001762 3300005981 Bacteria 21919
132 Ga0081538_10088914 3300005981 Bacteria 1606
133 Ga0081539_10000597 3300005985 Bacteria 73805
134 Ga0081539_10005727 3300005985 Bacteria 12427
135 Ga0070717_10002899 3300006028 Bacteria 12180
136 Ga0070717_10046717 3300006028 Bacteria 3544
137 Ga0075365_10000083 3300006038 Bacteria 27773
138 Ga0075365_10000103 3300006038 Bacteria 25003
139 Ga0075365_10001489 3300006038 Bacteria 10671
140 Ga0075365_10005957 3300006038 Bacteria 6647
141 Ga0075365_10022550 3300006038 Bacteria 3947
142 Ga0075365_10023067 3300006038 Bacteria 3909
143 Ga0075365_10031136 3300006038 Bacteria 3421
144 Ga0075368_10000052 3300006042 Bacteria 28370
145 Ga0075368_10000058 3300006042 Bacteria 26490
146 Ga0075363_100000017 3300006048 Bacteria 37366
147 Ga0075363_100052852 3300006048 Bacteria 2169
148 Ga0075364_10000818 3300006051 Bacteria 16408
149 Ga0075364_10001226 3300006051 Bacteria 13804
150 Ga0075364_10005917 3300006051 Bacteria 7149
151 Ga0075364_10009157 3300006051 Bacteria 5931
152 Ga0075367_10000026 3300006178 Bacteria 31428
153 Ga0075367_10004148 3300006178 Bacteria 7030
154 Ga0075369_10005866 3300006186 Bacteria 4614
155 Ga0075427_10000444 3300006194 Bacteria 4706
156 Ga0075366_10000002 3300006195 Bacteria 153795
157 Ga0075366_10000007 3300006195 Bacteria 104412
158 Ga0075366_10000028 3300006195 Bacteria 50296
159 Ga0075366_10000695 3300006195 Bacteria 15902
160 Ga0075366_10006952 3300006195 Bacteria 6231
161 Ga0075366_10008696 3300006195 Bacteria 5654
162 Ga0075366_10208846 3300006195 Bacteria 1188
163 Ga0097621_100060979 3300006237 Bacteria 3093
164 Ga0075370_10000025 3300006353 Bacteria 52081
165 Ga0075370_10002100 3300006353 Bacteria 9088
166 Ga0075370_10024603 3300006353 Bacteria 3328
167 Ga0068871_100038215 3300006358 Bacteria 3832
168 Ga0075428_100000608 3300006844 Bacteria 36522
169 Ga0075428_100004454 3300006844 Bacteria 15454
170 Ga0075428_100325265 3300006844 Bacteria 1652
171 Ga0075428_100461906 3300006844 Bacteria 1359
172 Ga0075430_100002441 3300006846 Bacteria 15477
173 Ga0075431_100018973 3300006847 Bacteria 7006
174 Ga0075431_100208585 3300006847 Bacteria 1997
175 Ga0075434_100052531 3300006871 Bacteria 4050
176 Ga0075429_100028737 3300006880 Bacteria 4829
177 Ga0075429_100085547 3300006880 Bacteria 2748
178 Ga0075429_100301891 3300006880 Bacteria 1402
179 Ga0068865_100007409 3300006881 Bacteria 6752
180 Ga0097620_100001903 3300006931 Bacteria 21274
181 Ga0097620_100213392 3300006931 Bacteria 2017
182 Ga0079104_1020960 3300006946 Bacteria 1788
183 Ga0105240_10000554 3300009093 Bacteria 69214
184 Ga0105240_10002029 3300009093 Bacteria 33399
185 Ga0105240_10016535 3300009093 Bacteria 9986
186 Ga0105240_10026773 3300009093 Bacteria 7562
187 Ga0111539_10065395 3300009094 Bacteria 4297
188 Ga0111539_10183257 3300009094 Bacteria 2446
189 Ga0111539_10460569 3300009094 Bacteria 1481
190 Ga0105245_10014297 3300009098 Bacteria 6917
191 Ga0105247_10041511 3300009101 Bacteria 2816
192 Ga0114129_10000238 3300009147 Bacteria 61413
193 Ga0114129_10008060 3300009147 Bacteria 15011
194 Ga0114129_10012935 3300009147 Bacteria 11877
195 Ga0114129_10020433 3300009147 Bacteria 9417
196 Ga0114129_10083569 3300009147 Bacteria 4434
197 Ga0114129_10088530 3300009147 Bacteria 4292
198 Ga0114129_10107423 3300009147 Bacteria 3855
199 Ga0114129_10126724 3300009147 Bacteria 3510
200 Ga0105243_10000202 3300009148 Bacteria 69670
201 Ga0105241_10216967 3300009174 Bacteria 1606
202 Ga0105242_10093166 3300009176 Bacteria 2539
203 Ga0105248_10003194 3300009177 Bacteria 18164
204 Ga0105237_10000002 3300009545 Bacteria 702357
205 Ga0105237_10003197 3300009545 Bacteria 19653
206 Ga0105238_10005238 3300009551 Bacteria 12819
207 Ga0105238_10020637 3300009551 Bacteria 6711
208 Ga0105238_10131474 3300009551 Bacteria 2481
209 Ga0105238_10137152 3300009551 Bacteria 2424
210 Ga0105249_10032980 3300009553 Bacteria 4687
211 Ga0105249_10161045 3300009553 Bacteria 2168
212 Ga0105032_100002 3300009979 Bacteria 303884
213 Ga0105032_100013 3300009979 Bacteria 60280
214 Ga0105032_102837 3300009979 Bacteria 1530
215 Ga0105029_100084 3300009984 Bacteria 4504
216 Ga0105033_100015 3300009986 Bacteria 17160
217 Ga0105030_101827 3300009987 Bacteria 1874
218 Ga0105239_10001282 3300010375 Bacteria 33954
219 Ga0105239_10001890 3300010375 Bacteria 27386
220 Ga0105246_10000260 3300011119 Bacteria 27386
221 Ga0105246_10002918 3300011119 Bacteria 10347
222 Ga0105246_10005815 3300011119 Bacteria 7520
223 Ga0157373_10006247 3300013100 Bacteria 8901
224 Ga0157373_10008975 3300013100 Bacteria 7397
225 Ga0157373_10083103 3300013100 Bacteria 2257
226 Ga0157371_10000024 3300013102 Bacteria 281202
227 Ga0157371_10047312 3300013102 Bacteria 3058
228 Ga0157370_10001378 3300013104 Bacteria 30046
229 Ga0157370_10033569 3300013104 Bacteria 5003
230 Ga0157370_10065233 3300013104 Bacteria 3445
231 Ga0157370_10475909 3300013104 Bacteria 1148
232 Ga0157369_10000026 3300013105 Bacteria 216023
233 Ga0157369_10000634 3300013105 Bacteria 45464
234 Ga0157369_10019267 3300013105 Bacteria 7633
235 Ga0157374_10000709 3300013296 Bacteria 29221
236 Ga0157374_10025003 3300013296 Bacteria 5358
237 Ga0163162_10033432 3300013306 Bacteria 5111
238 Ga0157372_10000106 3300013307 Bacteria 87935
239 Ga0157372_10135225 3300013307 Bacteria 2838
240 Ga0157372_10191699 3300013307 Bacteria 2367
241 Ga0157372_10329715 3300013307 Bacteria 1777
242 Ga0157514_104927 3300013874 Bacteria 1339
243 Ga0163163_10178269 3300014325 Bacteria 2172
244 Ga0157380_10089451 3300014326 Bacteria 2537
245 Ga0157377_10000373 3300014745 Bacteria 19998
246 Ga0157376_10000085 3300014969 Bacteria 70910
247 Ga0157376_10007264 3300014969 Bacteria 7891
248 Ga0197907_10284452 3300020069 Bacteria 1414
249 Ga0213873_10005067 3300021358 Bacteria 2503
250 Ga0213872_10087167 3300021361 Bacteria 1399
251 Ga0213874_10003975 3300021377 Bacteria 3328
252 Ga0224712_10122007 3300022467 Bacteria 1129
253 Ga0207425_1000114 3300025245 Bacteria 77043
254 Ga0209129_1003213 3300025258 Bacteria 7295
255 Ga0209676_1000211 3300025292 Bacteria 129654
256 Ga0209676_1012541 3300025292 Bacteria 3321
257 Ga0209025_1007905 3300025294 Bacteria 7790
258 Ga0209025_1007934 3300025294 Bacteria 7772
259 Ga0209758_1000004 3300025297 Bacteria 1375322
260 Ga0209050_1000001 3300025298 Bacteria 3563507
261 Ga0209050_1000047 3300025298 Bacteria 380561
262 Ga0209050_1005259 3300025298 Bacteria 8245
263 Ga0207426_1018413 3300025302 Bacteria 2460
264 Ga0209051_1000336 3300025303 Bacteria 70491
265 Ga0209257_1000076 3300025304 Bacteria 324617
266 Ga0209257_1001103 3300025304 Bacteria 35112
267 Ga0207696_1007348 3300025711 Bacteria 4324
268 Ga0207713_1007508 3300025735 Bacteria 6419
269 Ga0207680_10105462 3300025903 Bacteria 1818
270 Ga0207647_10001626 3300025904 Bacteria 17272
271 Ga0207647_10003940 3300025904 Bacteria 11082
272 Ga0207705_10000010 3300025909 Bacteria 518023
273 Ga0207705_10000227 3300025909 Bacteria 55933
274 Ga0207705_10000306 3300025909 Bacteria 45253
275 Ga0207684_10000008 3300025910 Bacteria 601602
276 Ga0207684_10000034 3300025910 Bacteria 291009
277 Ga0207684_10013352 3300025910 Bacteria 7106
278 Ga0207684_10078416 3300025910 Bacteria 2809
279 Ga0207654_10000177 3300025911 Bacteria 39463
280 Ga0207654_10008838 3300025911 Bacteria 5110
281 Ga0207654_10058914 3300025911 Bacteria 2238
282 Ga0207707_10018045 3300025912 Bacteria 6147
283 Ga0207707_10039709 3300025912 Bacteria 4113
284 Ga0207695_10001111 3300025913 Bacteria 46810
285 Ga0207695_10016819 3300025913 Bacteria 8539
286 Ga0207695_10042724 3300025913 Bacteria 4837
287 Ga0207695_10075298 3300025913 Bacteria 3435
288 Ga0207695_10079328 3300025913 Bacteria 3328
289 Ga0207695_10129115 3300025913 Bacteria 2486
290 Ga0207671_10000008 3300025914 Bacteria 798229
291 Ga0207671_10007296 3300025914 Bacteria 9614
292 Ga0207671_10008857 3300025914 Bacteria 8474
293 Ga0207693_10021160 3300025915 Bacteria 5170
294 Ga0207660_10024531 3300025917 Bacteria 4084
295 Ga0207660_10106267 3300025917 Bacteria 2105
296 Ga0207660_10173410 3300025917 Bacteria 1671
297 Ga0207662_10199988 3300025918 Bacteria 1293
298 Ga0207657_10041847 3300025919 Bacteria 4047
299 Ga0207649_10000438 3300025920 Bacteria 30054
300 Ga0207652_10007555 3300025921 Bacteria 8751
301 Ga0207646_10000018 3300025922 Bacteria 291009
302 Ga0207646_10000192 3300025922 Bacteria 83182
303 Ga0207646_10001274 3300025922 Bacteria 31519
304 Ga0207646_10009519 3300025922 Bacteria 9595
305 Ga0207646_10031330 3300025922 Bacteria 4814
306 Ga0207646_10037262 3300025922 Bacteria 4385
307 Ga0207646_10068603 3300025922 Bacteria 3167
308 Ga0207681_10000083 3300025923 Bacteria 83026
309 Ga0207694_10039392 3300025924 Bacteria 3637
310 Ga0207694_10113960 3300025924 Bacteria 2153
311 Ga0207687_10008804 3300025927 Bacteria 6596
312 Ga0207700_10129110 3300025928 Bacteria 2061
313 Ga0207700_10241241 3300025928 Bacteria 1540
314 Ga0207664_10000005 3300025929 Bacteria 485048
315 Ga0207664_10001003 3300025929 Bacteria 18920
316 Ga0207664_10046732 3300025929 Bacteria 3399
317 Ga0207664_10149295 3300025929 Bacteria 1984
318 Ga0207664_10231159 3300025929 Bacteria 1607
319 Ga0207664_10235320 3300025929 Bacteria 1593
320 Ga0207644_10000001 3300025931 Bacteria 1243214
321 Ga0207644_10002137 3300025931 Bacteria 12813
322 Ga0207690_10005160 3300025932 Bacteria 7708
323 Ga0207690_10006471 3300025932 Bacteria 6943
324 Ga0207690_10033527 3300025932 Bacteria 3302
325 Ga0207706_10000004 3300025933 Bacteria 280765
326 Ga0207706_10192786 3300025933 Bacteria 1788
327 Ga0207686_10009883 3300025934 Bacteria 5186
328 Ga0207709_10000201 3300025935 Bacteria 78554
329 Ga0207709_10093789 3300025935 Bacteria 1969
330 Ga0207669_10000042 3300025937 Bacteria 65679
331 Ga0207704_10003921 3300025938 Bacteria 6764
332 Ga0207711_10002040 3300025941 Bacteria 18266
333 Ga0207661_10000117 3300025944 Bacteria 50849
334 Ga0207661_10003956 3300025944 Bacteria 10347
335 Ga0207661_10111942 3300025944 Bacteria 2310
336 Ga0207661_10191722 3300025944 Bacteria 1792
337 Ga0207661_10396337 3300025944 Bacteria 1251
338 Ga0207679_10000126 3300025945 Bacteria 62566
339 Ga0207667_10000005 3300025949 Bacteria 715503
340 Ga0207667_10000010 3300025949 Bacteria 477432
341 Ga0207667_10000027 3300025949 Bacteria 337700
342 Ga0207667_10007257 3300025949 Bacteria 13370
343 Ga0207667_10080034 3300025949 Bacteria 3386
344 Ga0207712_10140984 3300025961 Bacteria 1850
345 Ga0207712_10222550 3300025961 Bacteria 1510
346 Ga0207668_10019397 3300025972 Bacteria 4298
347 Ga0207640_10023753 3300025981 Bacteria 3689
348 Ga0207658_10000003 3300025986 Bacteria 1151934
349 Ga0207658_10000941 3300025986 Bacteria 24026
350 Ga0207658_10017635 3300025986 Bacteria 4922
351 Ga0207658_10056053 3300025986 Bacteria 2923
352 Ga0207703_10001425 3300026035 Bacteria 21819
353 Ga0207703_10158088 3300026035 Bacteria 1983
354 Ga0207639_10346274 3300026041 Bacteria 1326
355 Ga0207678_10002519 3300026067 Bacteria 16682
356 Ga0207702_10000051 3300026078 Bacteria 139040
357 Ga0207702_10000431 3300026078 Bacteria 47962
358 Ga0207702_10019321 3300026078 Bacteria 5638
359 Ga0207702_10022445 3300026078 Bacteria 5232
360 Ga0207702_10120752 3300026078 Bacteria 2345
361 Ga0207702_10122889 3300026078 Bacteria 2326
362 Ga0207674_10000032 3300026116 Bacteria 142389
363 Ga0207674_10000299 3300026116 Bacteria 62812
364 Ga0207674_10061756 3300026116 Bacteria 3785
365 Ga0207683_10000067 3300026121 Bacteria 79552
366 Ga0207683_10043323 3300026121 Bacteria 3933
367 Ga0207698_10000001 3300026142 Bacteria 625389
368 Ga0207698_10000024 3300026142 Bacteria 123946
369 Ga0207698_10028119 3300026142 Bacteria 4004
370 Ga0209281_1008313 3300027111 Bacteria 2529
371 Ga0209588_1050382 3300027671 Bacteria 1347
372 Ga0209998_10016051 3300027717 Bacteria 1574
373 Ga0209813_10000008 3300027866 Bacteria 102867
374 Ga0268266_10000002 3300028379 Bacteria 3059047
375 Ga0268266_10006783 3300028379 Bacteria 10438
376 Ga0268265_10125306 3300028380 Bacteria 2124
377 Ga0268264_10007078 3300028381 Bacteria 9399
378 Ga0268264_10028561 3300028381 Bacteria 4563
379 Ga0265337_1000643 3300028556 Bacteria 18479
380 Ga0265337_1001500 3300028556 Bacteria 11453
381 Ga0265326_10001451 3300028558 Bacteria 8338
382 Ga0265326_10004561 3300028558 Bacteria 4430
383 Ga0265334_10000004 3300028573 Bacteria 243436
384 Ga0265318_10031077 3300028577 Bacteria 2073
385 Ga0265336_10003070 3300028666 Bacteria 6649
386 Ga0307517_10042372 3300028786 Bacteria 4884
387 Ga0265338_10000003 3300028800 Bacteria 733923
388 Ga0265338_10000189 3300028800 Bacteria 115979
389 Ga0265338_10009651 3300028800 Bacteria 11453
390 Ga0265338_10023306 3300028800 Bacteria 6369
391 Ga0307511_10012705 3300030521 Bacteria 8249
392 Ga0314311_1009060 3300030733 Bacteria 4507
393 Ga0316179_1097059 3300030734 Bacteria 15011
394 Ga0316178_1074752 3300030735 Bacteria 1338
395 Ga0316180_1104216 3300030736 Bacteria 8845
396 Ga0316183_1035098 3300030742 Bacteria 17152
397 Ga0316183_1134592 3300030742 Bacteria 11520
398 Ga0316181_1116978 3300030744 Bacteria 53317
399 Ga0316182_1038280 3300030745 Bacteria 21015
400 Ga0316182_1110912 3300030745 Bacteria 16963
401 Ga0316182_1123588 3300030745 Bacteria 3123
402 Ga0265330_10042232 3300031235 Bacteria 2021
403 Ga0265340_10008273 3300031247 Bacteria 5619
404 Ga0265331_10009915 3300031250 Bacteria 5303
405 Ga0265327_10009859 3300031251 Bacteria 6820
406 Ga0265327_10011207 3300031251 Bacteria 6210
407 Ga0265316_10003366 3300031344 Bacteria 16199
408 Ga0307513_10073068 3300031456 Bacteria 3572
409 Ga0307509_10000584 3300031507 Bacteria 62341
410 Ga0307509_10002816 3300031507 Bacteria 27540
411 Ga0307408_100203579 3300031548 Bacteria 1604
412 Ga0265313_10017279 3300031595 Bacteria 4106
413 Ga0316575_10008136 3300031665 Bacteria 3812
414 Ga0316575_10041326 3300031665 Bacteria 1824
415 Ga0316575_10045815 3300031665 Bacteria 1737
416 Ga0316579_10055736 3300031691 Bacteria 1854
417 Ga0316579_10082603 3300031691 Bacteria 1531
418 Ga0265314_10114656 3300031711 Bacteria 1707
419 Ga0316576_10002497 3300031727 Bacteria 10480
420 Ga0316576_10050710 3300031727 Bacteria 3019
421 Ga0316576_10057465 3300031727 Bacteria 2843
422 Ga0316576_10061348 3300031727 Bacteria 2756
423 Ga0316578_10000007 3300031728 Bacteria 46913
424 Ga0316578_10027315 3300031728 Bacteria 3225
425 Ga0316578_10106336 3300031728 Bacteria 1684
426 Ga0307516_10106175 3300031730 Bacteria 2618
427 Ga0316577_10002771 3300031733 Bacteria 8735
428 Ga0316577_10008069 3300031733 Bacteria 5629
429 Ga0316577_10090201 3300031733 Bacteria 1716
430 Ga0307412_10007283 3300031911 Bacteria 6274
431 Ga0307412_10046235 3300031911 Bacteria 2851
432 Ga0307409_100066615 3300031995 Bacteria 2841
433 Ga0316585_10012623 3300032137 Bacteria 2505
434 Ga0316580_10029193 3300032139 Bacteria 1706
435 Ga0316580_10044078 3300032139 Bacteria 1376
436 Ga0316593_10069698 3300032168 Bacteria 1215
437 Ga0316593_10076388 3300032168 Bacteria 1164
438 Ga0316596_1046255 3300033541 Bacteria 1150
439 Ga0373930_0001506 3300034816 Bacteria 3484
440 Ga0373929_0004252 3300035085 Bacteria 2568
441 Ga0373929_0013123 3300035085 Bacteria 1584
442 Ga0316574_0009421 3300035398 Bacteria 5470
443 Ga0316574_0216332 3300035398 Bacteria 1229
444 Ga0373931_0017038 3300035691 Bacteria 3585
445 Ga0316582_0000419 3300036647 Bacteria 15541
446 Ga0316582_0003641 3300036647 Bacteria 7606
447 Ga0316582_0040620 3300036647 Bacteria 2904
448 Ga0316584_0001751 3300036712 Bacteria 13345
449 Ga0316584_0006450 3300036712 Bacteria 7942
450 Ga0316584_0008823 3300036712 Bacteria 6966
451 Ga0316584_0009448 3300036712 Bacteria 6770
452 Ga0316584_0097428 3300036712 Bacteria 2202
453 Ga0316584_0108735 3300036712 Bacteria 2075
454 Ga0316584_0126762 3300036712 Bacteria 1906
455 Ga0316584_0154914 3300036712 Bacteria 1704
456 Ga0373925_0164356 3300037068 Bacteria 1750
457 Ga0395899_0015610 3300037312 Bacteria 5790
458 Ga0395899_0045286 3300037312 Bacteria 3278
459 Ga0395899_0055382 3300037312 Bacteria 2933
460 Ga0395900_0000001 3300037418 Bacteria 931146
461 Ga0395900_0022488 3300037418 Bacteria 6448
462 Ga0395900_0215387 3300037418 Bacteria 1938
463 Ga0395900_0288491 3300037418 Bacteria 1630
464 Ga0395898_0000002 3300037466 Bacteria 931013
465 Ga0395898_0003669 3300037466 Bacteria 17057
466 Ga0395898_0005045 3300037466 Bacteria 14315
467 Ga0395905_0000657 3300037471 Bacteria 45935
468 Ga0395905_0011513 3300037471 Bacteria 8547
469 Ga0316581_0000650 3300037588 Bacteria 6981
470 Ga0316581_0007426 3300037588 Bacteria 2941
471 Ga0316581_0022060 3300037588 Bacteria 1876
472 Ga0316581_0055891 3300037588 Bacteria 1210
473 Ga0436364_0082894 3300037853 Bacteria 2473
474 Ga0436364_0273847 3300037853 Bacteria 5705
475 Ga0395901_0000006 3300038443 Bacteria 514112
476 Ga0395901_0017081 3300038443 Bacteria 7397
477 Ga0395901_0017721 3300038443 Bacteria 7270
478 Ga0395901_0019234 3300038443 Bacteria 6983
479 Ga0395901_0034900 3300038443 Bacteria 5195
480 Ga0400484_03334 3300038725 Bacteria 3005
481 Ga0400484_40207 3300038725 Bacteria 8711
482 Ga0400490_41921 3300038726 Bacteria 7533
483 Ga0400483_150426 3300039062 Bacteria 2629
484 Ga0400483_184323 3300039062 Bacteria 2835
485 Ga0400483_203392 3300039062 Bacteria 5028
486 Ga0400489_62630 3300039093 Bacteria 16168
487 Ga0436360_1174518 3300039438 Bacteria 3461
488 Ga0436363_0170025 3300039450 Bacteria 8219
489 Ga0436363_0787171 3300039450 Bacteria 2622
490 Ga0436362_0411973 3300039453 Bacteria 2758
491 Ga0436362_0702278 3300039453 Bacteria 2332
492 Ga0436362_0987544 3300039453 Bacteria 1427
493 Ga0439438_005445 3300041405 Bacteria 4681
494 Ga0439447_008552 3300041407 Bacteria 3165
495 Ga0439461_0001436 3300041410 Bacteria 3679
496 Ga0439461_0002116 3300041410 Bacteria 3142
497 Ga0439466_0018840 3300041411 Bacteria 2473
498 Ga0439432_001429 3300042006 Bacteria 8986
499 Ga0439452_011374 3300042010 Bacteria 2560
500 Ga0439463_016076 3300042016 Bacteria 1851
501 Ga0439446_0012241 3300042156 Bacteria 2341
502 Ga0439434_0009853 3300042435 Bacteria 2811
503 Ga0439464_0000005 3300042439 Bacteria 45669
504 Ga0451577_0003336 3300042876 Bacteria 18010
505 Ga0451577_0003347 3300042876 Bacteria 17951
506 Ga0451577_0005505 3300042876 Bacteria 12949
507 Ga0451577_0006411 3300042876 Bacteria 11744
508 Ga0451577_0051406 3300042876 Bacteria 3679
509 Ga0451577_0061329 3300042876 Bacteria 3353
510 Ga0451577_0122329 3300042876 Bacteria 2331
511 Ga0451577_0190190 3300042876 Bacteria 1851
512 Ga0451577_0219240 3300042876 Bacteria 1719
513 Ga0451577_0286263 3300042876 Bacteria 1493
514 Ga0453683_0000001 3300044673 Bacteria 1384965
515 Ga0453683_0000006 3300044673 Bacteria 586638
516 Ga0453683_0000012 3300044673 Bacteria 376341
517 Ga0453683_0002267 3300044673 Bacteria 15193
518 Ga0453683_0004035 3300044673 Bacteria 10578
519 Ga0453683_0007613 3300044673 Bacteria 7334
520 Ga0453683_0012486 3300044673 Bacteria 5566
521 Ga0453683_0043974 3300044673 Bacteria 2802
522 Ga0453683_0114676 3300044673 Bacteria 1695
523 Ga0453683_0185910 3300044673 Bacteria 1318
524 Ga0466963_0027972 3300044694 Bacteria 3615
525 Ga0466963_0035342 3300044694 Bacteria 3255
526 Ga0453684_0000041 3300044712 Bacteria 690022
527 Ga0453684_0000055 3300044712 Bacteria 532014
528 Ga0453684_0000318 3300044712 Bacteria 203553
529 Ga0453684_0000505 3300044712 Bacteria 152407
530 Ga0453684_0000548 3300044712 Bacteria 142109
531 Ga0453684_0000763 3300044712 Bacteria 111862
532 Ga0453684_0001495 3300044712 Bacteria 65841
533 Ga0453684_0003175 3300044712 Bacteria 37731
534 Ga0453684_0003680 3300044712 Bacteria 34010
535 Ga0453684_0005515 3300044712 Bacteria 24970
536 Ga0453684_0006071 3300044712 Bacteria 23344
537 Ga0453684_0006242 3300044712 Bacteria 22837
538 Ga0453684_0006753 3300044712 Bacteria 21593
539 Ga0453684_0010308 3300044712 Bacteria 16004
540 Ga0453684_0012287 3300044712 Bacteria 14173
541 Ga0453684_0012937 3300044712 Bacteria 13663
542 Ga0453684_0015120 3300044712 Bacteria 12246
543 Ga0453684_0015944 3300044712 Bacteria 11815
544 Ga0453684_0052906 3300044712 Bacteria 5304
545 Ga0453684_0056174 3300044712 Bacteria 5109
546 Ga0453684_0083223 3300044712 Bacteria 3983
547 Ga0453684_0103885 3300044712 Bacteria 3470
548 Ga0453684_0108890 3300044712 Bacteria 3371
549 Ga0453684_0137737 3300044712 Bacteria 2919
550 Ga0453684_0149919 3300044712 Bacteria 2773
551 Ga0453684_0161821 3300044712 Bacteria 2646
552 Ga0453684_0180571 3300044712 Bacteria 2478
553 Ga0453684_0218393 3300044712 Bacteria 2210
554 Ga0453684_0362184 3300044712 Bacteria 1632
555 Ga0453684_0393530 3300044712 Bacteria 1553
556 Ga0453684_0437803 3300044712 Bacteria 1457
557 Ga0453684_0484016 3300044712 Bacteria 1372
558 Ga0453684_0533426 3300044712 Bacteria 1295
559 Ga0453684_0582136 3300044712 Bacteria 1229
560 Ga0453684_0767322 3300044712 Bacteria 1042
561 Ga0466971_0026847 3300044719 Bacteria 2576
562 Ga0466959_0015089 3300045049 Bacteria 5628
563 Ga0451576_0000008 3300045051 Bacteria 746156
564 Ga0451576_0000023 3300045051 Bacteria 477965
565 Ga0451576_0000026 3300045051 Bacteria 427585
566 Ga0451576_0000038 3300045051 Bacteria 369709
567 Ga0451576_0000048 3300045051 Unclassified 325145
568 Ga0451576_0000054 3300045051 Bacteria 308162
569 Ga0451576_0000142 3300045051 Bacteria 181506
570 Ga0451576_0004232 3300045051 Bacteria 18845
571 Ga0451576_0006528 3300045051 Bacteria 14273
572 Ga0451576_0006943 3300045051 Bacteria 13709
573 Ga0451576_0010423 3300045051 Bacteria 10663
574 Ga0451576_0020602 3300045051 Bacteria 7176
575 Ga0451576_0025596 3300045051 Bacteria 6356
576 Ga0451576_0034858 3300045051 Bacteria 5343
577 Ga0451576_0036412 3300045051 Bacteria 5217
578 Ga0451576_0067571 3300045051 Bacteria 3721
579 Ga0451576_0104691 3300045051 Bacteria 2943
580 Ga0451576_0180271 3300045051 Bacteria 2205
581 Ga0451576_0412618 3300045051 Bacteria 1416
582 Ga0451576_0449187 3300045051 Bacteria 1353
583 Ga0495629_0018692 3300046459 Bacteria 4954
584 Ga0495629_0135179 3300046459 Bacteria 1717
585 Ga0495638_0000061 3300046460 Bacteria 188551
586 Ga0495638_0000167 3300046460 Bacteria 102139
587 Ga0495650_0000467 3300046471 Bacteria 62422
588 Ga0495596_0008118 3300046500 Bacteria 4688
589 Ga0495583_0017674 3300046506 Bacteria 3780
590 Ga0495648_0000166 3300046524 Bacteria 77879
591 Ga0495663_0003723 3300046525 Bacteria 4359
592 Ga0495622_0000008 3300046557 Bacteria 232461
593 Ga0495668_0000261 3300046616 Bacteria 74577
594 Ga0495625_0002648 3300046660 Bacteria 19090
595 Ga0495659_0001994 3300046664 Bacteria 6705
596 Ga0495659_0013183 3300046664 Bacteria 2689
597 Ga0495659_0040264 3300046664 Bacteria 1664
598 Ga0495658_0002026 3300046683 Bacteria 10311
599 Ga0495649_0000100 3300046694 Bacteria 75606
600 Ga0495604_0034265 3300047317 Bacteria 4018
601 Ga0495674_0215893 3300047319 Bacteria 1587
602 Ga0495672_0000010 3300047320 Bacteria 545038
603 Ga0496101_0020431 3300048904 Bacteria 4533
604 Ga0496101_0115381 3300048904 Bacteria 2026
605 Ga0496101_0318358 3300048904 Bacteria 1220
606 Ga0496102_0000577 3300048905 Bacteria 38948
607 Ga0496102_0197826 3300048905 Bacteria 1894
608 Ga0496103_0001103 3300048906 Bacteria 18811
609 Ga0496104_0001960 3300048907 Bacteria 17821
610 Ga0496104_0029554 3300048907 Bacteria 5084
611 Ga0496104_0050871 3300048907 Bacteria 3909
612 Ga0496104_0123706 3300048907 Bacteria 2483
613 Ga0496104_0143370 3300048907 Bacteria 2295
614 Ga0496105_0005203 3300048908 Bacteria 9856
615 Ga0496105_0024366 3300048908 Bacteria 4916
616 Ga0496105_0127370 3300048908 Bacteria 2099
617 Ga0496107_0112433 3300048910 Bacteria 2002
618 Ga0496109_0122864 3300048912 Bacteria 2419
619 Ga0496110_0313507 3300048913 Bacteria 1428
620 Ga0496111_0200396 3300048914 Bacteria 1484
621 Ga0496113_0010304 3300048916 Bacteria 6176
622 Ga0496114_0017367 3300048917 Bacteria 5806
623 Ga0496115_0000001 3300048918 Bacteria 367230
624 Ga0496115_0000382 3300048918 Bacteria 36611
625 Ga0496115_0000423 3300048918 Bacteria 34595
626 Ga0496115_0089623 3300048918 Bacteria 2512
627 Ga0496117_0000320 3300048920 Bacteria 84189
628 Ga0496118_0000144 3300048921 Bacteria 124411
629 Ga0496118_0005674 3300048921 Bacteria 14069
630 Ga0496119_0006832 3300048922 Bacteria 10460
631 Ga0496121_0000070 3300048924 Bacteria 249187
632 Ga0496121_0039799 3300048924 Bacteria 4134
633 Ga0496122_0008273 3300048925 Bacteria 11281
634 Ga0496123_0010797 3300048926 Bacteria 8014
635 Ga0496124_0005475 3300048927 Bacteria 14262
636 Ga0496124_0023302 3300048927 Bacteria 5654
637 Ga0496124_0129986 3300048927 Bacteria 2002
638 Ga0496126_0000505 3300048929 Bacteria 76567
639 Ga0496126_0000696 3300048929 Bacteria 61450
640 Ga0496126_0071597 3300048929 Bacteria 3086
641 Ga0501031_0000777 3300049568 Bacteria 19155
642 Ga0501032_0000641 3300049569 Bacteria 28409
643 Ga0501034_0000028 3300049571 Bacteria 255803
644 Ga0501034_0001066 3300049571 Bacteria 38868
645 Ga0501034_0001383 3300049571 Bacteria 32637
646 Ga0501034_0175821 3300049571 Bacteria 2107
647 Ga0501034_0422894 3300049571 Bacteria 1253
648 Ga0501036_0001678 3300049572 Bacteria 17176
649 Ga0501037_0000001 3300049573 Bacteria 753276
650 Ga0501037_0000138 3300049573 Bacteria 68040
651 Ga0501038_0000863 3300049574 Bacteria 26878
652 Ga0501038_0061888 3300049574 Bacteria 3200
653 Ga0501042_0145426 3300049578 Bacteria 1709
654 Ga0501043_0000062 3300049579 Bacteria 95664
655 Ga0501046_0000059 3300049580 Bacteria 126801
656 Ga0501047_0000032 3300049581 Bacteria 208294
657 Ga0501047_0033489 3300049581 Bacteria 4960
658 Ga0501047_0141318 3300049581 Bacteria 2286
659 Ga0501048_0000001 3300049582 Bacteria 132132
660 Ga0501070_0066407 3300049586 Bacteria 2987
661 Ga0501072_0067678 3300049588 Bacteria 2818
662 Ga0501072_0240505 3300049588 Bacteria 1442
663 Ga0501075_0300726 3300049591 Bacteria 1223
664 Ga0501076_0049781 3300049592 Bacteria 3314
665 Ga0501076_0103933 3300049592 Bacteria 2291
666 Ga0501076_0204966 3300049592 Bacteria 1611
667 Ga0501079_0010737 3300049741 Bacteria 6974
668 Ga0501080_0020371 3300049742 Bacteria 6138
669 Ga0501083_0002809 3300049744 Bacteria 12017
670 Ga0501035_0001735 3300049822 Bacteria 22038
671 Ga0501044_0032556 3300049823 Bacteria 5480
672 Ga0501045_0069229 3300049824 Bacteria 2594
673 nmdc:mga03683_209_c1 3300050489 Bacteria 19230
674 nmdc:mga03683_3956_c2 3300050489 Bacteria 4539
675 nmdc:mga03n38_11_c1 3300050490 Bacteria 47454
676 nmdc:mga00v17_13247_c1 3300050491 Bacteria 4571
677 nmdc:mga00v17_143_c1 3300050491 Bacteria 41277
678 nmdc:mga00v17_201301_c1 3300050491 Bacteria 1287
679 nmdc:mga00v17_3385_c2 3300050491 Bacteria 5944
680 nmdc:mga00v17_40179_c1 3300050491 Bacteria 2805
681 nmdc:mga00v17_96758_c1 3300050491 Bacteria 1860
682 nmdc:mga0yw44_12970_c1 3300050492 Bacteria 3947
683 nmdc:mga0yw44_14_c1 3300050492 Bacteria 86738
684 nmdc:mga0yw44_296_c1 3300050492 Bacteria 17171
685 nmdc:mga0yw44_4033_c1 3300050492 Bacteria 6645
686 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
687 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
688 nmdc:mga0k408_164_c1 3300050493 Bacteria 20604
689 nmdc:mga0k408_194276_c1 3300050493 Bacteria 1211
690 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
691 nmdc:mga0k408_29_c1 3300050493 Bacteria 89645
692 nmdc:mga0k408_6447_c1 3300050493 Bacteria 6258
693 nmdc:mga0k408_69_c2 3300050493 Bacteria 50340
694 nmdc:mga0k408_924_c1 3300050493 Bacteria 16077
695 nmdc:mga06z11_483_c1 3300050494 Bacteria 14692
696 nmdc:mga06z11_5_c1 3300050494 Bacteria 61643
697 nmdc:mga04h51_7988_c1 3300050495 Bacteria 2817
698 nmdc:mga04h51_9_c1 3300050495 Bacteria 107099
699 nmdc:mga07m45_1009_c1 3300050496 Bacteria 12437
700 nmdc:mga07m45_1611_c1 3300050496 Bacteria 10390
701 nmdc:mga07m45_31_c1 3300050496 Bacteria 81959
702 nmdc:mga07m45_36150_c1 3300050496 Bacteria 2750
703 nmdc:mga07m45_73623_c1 3300050496 Bacteria 1945
704 nmdc:mga05p37_107395_c1 3300050507 Bacteria 3434
705 nmdc:mga05p37_145822_c1 3300050507 Bacteria 2899
706 nmdc:mga05p37_164535_c1 3300050507 Bacteria 2708
707 nmdc:mga05p37_289387_c1 3300050507 Bacteria 1950
708 nmdc:mga05p37_39914_c1 3300050507 Bacteria 5764
709 nmdc:mga05p37_6974_c1 3300050507 Bacteria 13317
710 nmdc:mga09592_10685_c1 3300050508 Bacteria 7473
711 nmdc:mga09592_304400_c1 3300050508 Bacteria 1382
712 nmdc:mga09592_73388_c1 3300050508 Bacteria 2907
713 nmdc:mga09592_8433_c1 3300050508 Bacteria 8378
714 nmdc:mga0qj67_1812_c1 3300050509 Bacteria 15112
715 nmdc:mga06r32_3537_c1 3300050510 Bacteria 13956
716 nmdc:mga08y16_1493_c1 3300050511 Bacteria 22465
717 nmdc:mga08y16_218815_c1 3300050511 Bacteria 1972
718 nmdc:mga0n895_82487_c1 3300050512 Bacteria 3205
719 nmdc:mga0a205_303244_c1 3300050515 Bacteria 1470
720 nmdc:mga0sz30_3_c4 3300050516 Bacteria 4873
721 Ga0500610_0000389 3300053079 Bacteria 13347
722 Ga0495619_0000084 3300053085 Bacteria 70164
723 Ga0500643_000034 3300053087 Bacteria 185705
724 Ga0500643_000495 3300053087 Bacteria 28427
725 Ga0500644_0008364 3300053088 Bacteria 2730
726 Ga0500583_0007071 3300053092 Bacteria 3918
727 Ga0500583_0008403 3300053092 Bacteria 3703
728 Ga0500566_0000001 3300053094 Bacteria 1101031
729 Ga0500555_000001 3300053103 Bacteria 1353713
730 Ga0500555_000009 3300053103 Bacteria 263998
731 Ga0500562_000002 3300053108 Bacteria 977234
732 Ga0500569_000001 3300053109 Bacteria 137852
733 Ga0500593_000001 3300053117 Bacteria 784404
734 Ga0500593_027461 3300053117 Bacteria 2540
735 Ga0500614_000001 3300053123 Bacteria 1274484
736 Ga0500642_0123628 3300053130 Bacteria 1211
737 Ga0500655_000483 3300053133 Bacteria 8070
738 Ga0500559_0021462 3300053136 Bacteria 2737
739 Ga0500561_0000002 3300053137 Bacteria 394147
740 Ga0500568_0003924 3300053139 Bacteria 8098
741 Ga0500577_0003518 3300053142 Bacteria 4070
742 Ga0500588_0000027 3300053146 Bacteria 35097
743 Ga0500616_0000012 3300053153 Bacteria 681798
744 Ga0500616_0023868 3300053153 Bacteria 3403
745 Ga0500616_0026398 3300053153 Bacteria 3215
746 Ga0500616_0086596 3300053153 Bacteria 1562
747 Ga0500649_000039 3300053722 Bacteria 15061
748 Ga0500611_000481 3300053727 Bacteria 4036
749 Ga0500611_002005 3300053727 Bacteria 2365
750 Ga0500645_000062 3300053730 Bacteria 85561
751 Ga0501084_0009937 3300054114 Bacteria 7866
752 Ga0501084_0016042 3300054114 Bacteria 6217
753 Ga0501084_0084007 3300054114 Bacteria 2673
754 Ga0501084_0140552 3300054114 Bacteria 2033
755 Ga0501084_0266423 3300054114 Bacteria 1446
756 2512734540 2512564039 Bacteria 8739048
757 2600226200 2599185359 Bacteria 4772316
758 2819712753 2818991466 Bacteria 4748179
759 2864997678 2864997549 Bacteria 5139696
760 2865006008 2865002811 Bacteria 6333767
761 2879166984 2879163058 Bacteria 4223965
762 2928102683 2928100450 Bacteria 4837635
763 2928527354 2928526807 Bacteria 4760224
764 2928969165 2928968154 Bacteria 4633371
765 8007376455 8007375930 Bacteria 4080554
766 8022893510 8022893055 Bacteria 5300455
767 8057978663 8057977335 Bacteria 5694872
768 Ga0501084_0002155
769 SwRhRL2b_contig_2039187
770 JGI24741J21665_1000172
771 JGI24741J21665_1000432
772 JGI24740J21852_10006184
773 JGI24740J21852_10008985
774 JGI24739J22299_10002774
775 JGI24739J22299_10003084
776 JGI24737J22298_10000010
777 JGI24737J22298_10000043
778 JGI24743J22301_10001560
779 JGI24735J21928_10000052
780 JGI24735J21928_10000104
781 JGI24738J21930_10000355
782 JGI24738J21930_10008934
783 JGI24033J26618_1000732
784 JGI25150J39212_1000657
785 JGI25151J46595_10029487
786 JGI25406J46586_10026712
787 JGI25153J46596_10000266
788 rootH1_10009329
789 rootH2_10006821
790 rootH1_10012137
791 Ga0055526_1006177
792 Ga0055540_1000692
793 Ga0065704_10000250
794 Ga0065704_10000296
795 Ga0065712_10160842
796 Ga0065707_10082246
797 Ga0065707_10105175
798 Ga0070658_10000009
799 Ga0070658_10000110
800 Ga0070658_10000385
801 Ga0070683_100000184
802 Ga0070683_100063971
803 Ga0070683_100113090
804 Ga0070690_100015025
805 Ga0070670_100115038
806 Ga0070666_10095755
807 Ga0070680_100244075
808 Ga0070660_100010369
809 Ga0070660_100183842
810 Ga0070669_100000068
811 Ga0070675_100115022
812 Ga0070671_100000001
813 Ga0070671_100001336
814 Ga0070674_100046632
815 Ga0070659_100012416
816 Ga0070667_100000001
817 Ga0070667_100000157
818 Ga0070667_100006733
819 Ga0070667_100019440
820 Ga0070667_100044275
821 Ga0070714_100000082
822 Ga0070714_100001000
823 Ga0070714_100031012
824 Ga0070713_100051150
825 Ga0070713_100059589
826 Ga0070713_100129400
827 Ga0070713_100264606
828 Ga0070701_10161699
829 Ga0070694_100198343
830 Ga0070708_100000018
831 Ga0070708_100004468
832 Ga0070708_100084659
833 Ga0070708_100089745
834 Ga0070708_100130313
835 Ga0070678_100000104
836 Ga0070678_100015475
837 Ga0070662_100006047
838 Ga0070681_10160778
839 Ga0070706_100000026
840 Ga0070706_100000548
841 Ga0070706_100006587
842 Ga0070706_100088844
843 Ga0070706_100143741
844 Ga0070706_100164761
845 Ga0070707_100000004
846 Ga0070707_100000434
847 Ga0070707_100002828
848 Ga0070707_100006967
849 Ga0070707_100027594
850 Ga0070707_100066689
851 Ga0070707_100183776
852 Ga0070698_100003377
853 Ga0070698_100004957
854 Ga0070698_100015120
855 Ga0070699_100000042
856 Ga0070699_100005835
857 Ga0070699_100050609
858 Ga0070699_100064723
859 Ga0070679_100016249
860 Ga0070679_100056515
861 Ga0070684_100000345
862 Ga0070697_100000006
863 Ga0070697_100003316
864 Ga0070697_100060273
865 Ga0070697_100184769
866 Ga0070695_100145339
867 Ga0070696_100080143
868 Ga0070665_100000086
869 Ga0070665_100007667
870 Ga0070704_100026011
871 Ga0068855_100000002
872 Ga0068855_100000005
873 Ga0068855_100007933
874 Ga0068855_100062267
875 Ga0070664_100000721
876 Ga0070664_100026141
877 Ga0068857_100000057
878 Ga0068857_100000066
879 Ga0068857_100040042
880 Ga0068857_100271286
881 Ga0068857_100277832
882 Ga0068856_100000029
883 Ga0068856_100000122
884 Ga0068856_100203100
885 Ga0068856_100543657
886 Ga0070702_100139784
887 Ga0068852_100000001
888 Ga0068852_100000011
889 Ga0068859_100213391
890 Ga0068864_100152392
891 Ga0068866_10029123
892 Ga0068860_100008228
893 Ga0068860_100119400
894 Ga0068862_100021245
895 Ga0068862_100317353
896 Ga0081455_10000008
897 Ga0081538_10000568
898 Ga0081538_10001762
899 Ga0081538_10088914
900 Ga0081539_10000597
901 Ga0081539_10005727
902 Ga0070717_10002899
903 Ga0070717_10046717
904 Ga0075365_10000083
905 Ga0075365_10000103
906 Ga0075365_10001489
907 Ga0075365_10005957
908 Ga0075365_10022550
909 Ga0075365_10023067
910 Ga0075365_10031136
911 Ga0075368_10000052
912 Ga0075368_10000058
913 Ga0075363_100000017
914 Ga0075363_100052852
915 Ga0075364_10000818
916 Ga0075364_10001226
917 Ga0075364_10005917
918 Ga0075364_10009157
919 Ga0075367_10000026
920 Ga0075367_10004148
921 Ga0075369_10005866
922 Ga0075427_10000444
923 Ga0075366_10000002
924 Ga0075366_10000007
925 Ga0075366_10000028
926 Ga0075366_10000695
927 Ga0075366_10006952
928 Ga0075366_10008696
929 Ga0075366_10208846
930 Ga0097621_100060979
931 Ga0075370_10000025
932 Ga0075370_10002100
933 Ga0075370_10024603
934 Ga0068871_100038215
935 Ga0075428_100000608
936 Ga0075428_100004454
937 Ga0075428_100325265
938 Ga0075428_100461906
939 Ga0075430_100002441
940 Ga0075431_100018973
941 Ga0075431_100208585
942 Ga0075434_100052531
943 Ga0075429_100028737
944 Ga0075429_100085547
945 Ga0075429_100301891
946 Ga0068865_100007409
947 Ga0097620_100001903
948 Ga0097620_100213392
949 Ga0079104_1020960
950 Ga0105240_10000554
951 Ga0105240_10002029
952 Ga0105240_10016535
953 Ga0105240_10026773
954 Ga0111539_10065395
955 Ga0111539_10183257
956 Ga0111539_10460569
957 Ga0105245_10014297
958 Ga0105247_10041511
959 Ga0114129_10000238
960 Ga0114129_10008060
961 Ga0114129_10012935
962 Ga0114129_10020433
963 Ga0114129_10083569
964 Ga0114129_10088530
965 Ga0114129_10107423
966 Ga0114129_10126724
967 Ga0105243_10000202
968 Ga0105241_10216967
969 Ga0105242_10093166
970 Ga0105248_10003194
971 Ga0105237_10000002
972 Ga0105237_10003197
973 Ga0105238_10005238
974 Ga0105238_10020637
975 Ga0105238_10131474
976 Ga0105238_10137152
977 Ga0105249_10032980
978 Ga0105249_10161045
979 Ga0105032_100002
980 Ga0105032_100013
981 Ga0105032_102837
982 Ga0105029_100084
983 Ga0105033_100015
984 Ga0105030_101827
985 Ga0105239_10001282
986 Ga0105239_10001890
987 Ga0105246_10000260
988 Ga0105246_10002918
989 Ga0105246_10005815
990 Ga0157373_10006247
991 Ga0157373_10008975
992 Ga0157373_10083103
993 Ga0157371_10000024
994 Ga0157371_10047312
995 Ga0157370_10001378
996 Ga0157370_10033569
997 Ga0157370_10065233
998 Ga0157370_10475909
999 Ga0157369_10000026
1000 Ga0157369_10000634
1001 Ga0157369_10019267
1002 Ga0157374_10000709
1003 Ga0157374_10025003
1004 Ga0163162_10033432
1005 Ga0157372_10000106
1006 Ga0157372_10135225
1007 Ga0157372_10191699
1008 Ga0157372_10329715
1009 Ga0157514_104927
1010 Ga0163163_10178269
1011 Ga0157380_10089451
1012 Ga0157377_10000373
1013 Ga0157376_10000085
1014 Ga0157376_10007264
1015 Ga0197907_10284452
1016 Ga0213873_10005067
1017 Ga0213872_10087167
1018 Ga0213874_10003975
1019 Ga0224712_10122007
1020 Ga0207425_1000114
1021 Ga0209129_1003213
1022 Ga0209676_1000211
1023 Ga0209676_1012541
1024 Ga0209025_1007905
1025 Ga0209025_1007934
1026 Ga0209758_1000004
1027 Ga0209050_1000001
1028 Ga0209050_1000047
1029 Ga0209050_1005259
1030 Ga0207426_1018413
1031 Ga0209051_1000336
1032 Ga0209257_1000076
1033 Ga0209257_1001103
1034 Ga0207696_1007348
1035 Ga0207713_1007508
1036 Ga0207680_10105462
1037 Ga0207647_10001626
1038 Ga0207647_10003940
1039 Ga0207705_10000010
1040 Ga0207705_10000227
1041 Ga0207705_10000306
1042 Ga0207684_10000008
1043 Ga0207684_10000034
1044 Ga0207684_10013352
1045 Ga0207684_10078416
1046 Ga0207654_10000177
1047 Ga0207654_10008838
1048 Ga0207654_10058914
1049 Ga0207707_10018045
1050 Ga0207707_10039709
1051 Ga0207695_10001111
1052 Ga0207695_10016819
1053 Ga0207695_10042724
1054 Ga0207695_10075298
1055 Ga0207695_10079328
1056 Ga0207695_10129115
1057 Ga0207671_10000008
1058 Ga0207671_10007296
1059 Ga0207671_10008857
1060 Ga0207693_10021160
1061 Ga0207660_10024531
1062 Ga0207660_10106267
1063 Ga0207660_10173410
1064 Ga0207662_10199988
1065 Ga0207657_10041847
1066 Ga0207649_10000438
1067 Ga0207652_10007555
1068 Ga0207646_10000018
1069 Ga0207646_10000192
1070 Ga0207646_10001274
1071 Ga0207646_10009519
1072 Ga0207646_10031330
1073 Ga0207646_10037262
1074 Ga0207646_10068603
1075 Ga0207681_10000083
1076 Ga0207694_10039392
1077 Ga0207694_10113960
1078 Ga0207687_10008804
1079 Ga0207700_10129110
1080 Ga0207700_10241241
1081 Ga0207664_10000005
1082 Ga0207664_10001003
1083 Ga0207664_10046732
1084 Ga0207664_10149295
1085 Ga0207664_10231159
1086 Ga0207664_10235320
1087 Ga0207644_10000001
1088 Ga0207644_10002137
1089 Ga0207690_10005160
1090 Ga0207690_10006471
1091 Ga0207690_10033527
1092 Ga0207706_10000004
1093 Ga0207706_10192786
1094 Ga0207686_10009883
1095 Ga0207709_10000201
1096 Ga0207709_10093789
1097 Ga0207669_10000042
1098 Ga0207704_10003921
1099 Ga0207711_10002040
1100 Ga0207661_10000117
1101 Ga0207661_10003956
1102 Ga0207661_10111942
1103 Ga0207661_10191722
1104 Ga0207661_10396337
1105 Ga0207679_10000126
1106 Ga0207667_10000005
1107 Ga0207667_10000010
1108 Ga0207667_10000027
1109 Ga0207667_10007257
1110 Ga0207667_10080034
1111 Ga0207712_10140984
1112 Ga0207712_10222550
1113 Ga0207668_10019397
1114 Ga0207640_10023753
1115 Ga0207658_10000003
1116 Ga0207658_10000941
1117 Ga0207658_10017635
1118 Ga0207658_10056053
1119 Ga0207703_10001425
1120 Ga0207703_10158088
1121 Ga0207639_10346274
1122 Ga0207678_10002519
1123 Ga0207702_10000051
1124 Ga0207702_10000431
1125 Ga0207702_10019321
1126 Ga0207702_10022445
1127 Ga0207702_10120752
1128 Ga0207702_10122889
1129 Ga0207674_10000032
1130 Ga0207674_10000299
1131 Ga0207674_10061756
1132 Ga0207683_10000067
1133 Ga0207683_10043323
1134 Ga0207698_10000001
1135 Ga0207698_10000024
1136 Ga0207698_10028119
1137 Ga0209281_1008313
1138 Ga0209588_1050382
1139 Ga0209998_10016051
1140 Ga0209813_10000008
1141 Ga0268266_10000002
1142 Ga0268266_10006783
1143 Ga0268265_10125306
1144 Ga0268264_10007078
1145 Ga0268264_10028561
1146 Ga0265337_1000643
1147 Ga0265337_1001500
1148 Ga0265326_10001451
1149 Ga0265326_10004561
1150 Ga0265334_10000004
1151 Ga0265318_10031077
1152 Ga0265336_10003070
1153 Ga0307517_10042372
1154 Ga0265338_10000003
1155 Ga0265338_10000189
1156 Ga0265338_10009651
1157 Ga0265338_10023306
1158 Ga0307511_10012705
1159 Ga0314311_1009060
1160 Ga0316179_1097059
1161 Ga0316178_1074752
1162 Ga0316180_1104216
1163 Ga0316183_1035098
1164 Ga0316183_1134592
1165 Ga0316181_1116978
1166 Ga0316182_1038280
1167 Ga0316182_1110912
1168 Ga0316182_1123588
1169 Ga0265330_10042232
1170 Ga0265340_10008273
1171 Ga0265331_10009915
1172 Ga0265327_10009859
1173 Ga0265327_10011207
1174 Ga0265316_10003366
1175 Ga0307513_10073068
1176 Ga0307509_10000584
1177 Ga0307509_10002816
1178 Ga0307408_100203579
1179 Ga0265313_10017279
1180 Ga0316575_10008136
1181 Ga0316575_10041326
1182 Ga0316575_10045815
1183 Ga0316579_10055736
1184 Ga0316579_10082603
1185 Ga0265314_10114656
1186 Ga0316576_10002497
1187 Ga0316576_10050710
1188 Ga0316576_10057465
1189 Ga0316576_10061348
1190 Ga0316578_10000007
1191 Ga0316578_10027315
1192 Ga0316578_10106336
1193 Ga0307516_10106175
1194 Ga0316577_10002771
1195 Ga0316577_10008069
1196 Ga0316577_10090201
1197 Ga0307412_10007283
1198 Ga0307412_10046235
1199 Ga0307409_100066615
1200 Ga0316585_10012623
1201 Ga0316580_10029193
1202 Ga0316580_10044078
1203 Ga0316593_10069698
1204 Ga0316593_10076388
1205 Ga0316596_1046255
1206 Ga0373930_0001506
1207 Ga0373929_0004252
1208 Ga0373929_0013123
1209 Ga0316574_0009421
1210 Ga0316574_0216332
1211 Ga0373931_0017038
1212 Ga0316582_0000419
1213 Ga0316582_0003641
1214 Ga0316582_0040620
1215 Ga0316584_0001751
1216 Ga0316584_0006450
1217 Ga0316584_0008823
1218 Ga0316584_0009448
1219 Ga0316584_0097428
1220 Ga0316584_0108735
1221 Ga0316584_0126762
1222 Ga0316584_0154914
1223 Ga0373925_0164356
1224 Ga0395899_0015610
1225 Ga0395899_0045286
1226 Ga0395899_0055382
1227 Ga0395900_0000001
1228 Ga0395900_0022488
1229 Ga0395900_0215387
1230 Ga0395900_0288491
1231 Ga0395898_0000002
1232 Ga0395898_0003669
1233 Ga0395898_0005045
1234 Ga0395905_0000657
1235 Ga0395905_0011513
1236 Ga0316581_0000650
1237 Ga0316581_0007426
1238 Ga0316581_0022060
1239 Ga0316581_0055891
1240 Ga0436364_0082894
1241 Ga0436364_0273847
1242 Ga0395901_0000006
1243 Ga0395901_0017081
1244 Ga0395901_0017721
1245 Ga0395901_0019234
1246 Ga0395901_0034900
1247 Ga0400484_03334
1248 Ga0400484_40207
1249 Ga0400490_41921
1250 Ga0400483_150426
1251 Ga0400483_184323
1252 Ga0400483_203392
1253 Ga0400489_62630
1254 Ga0436360_1174518
1255 Ga0436363_0170025
1256 Ga0436363_0787171
1257 Ga0436362_0411973
1258 Ga0436362_0702278
1259 Ga0436362_0987544
1260 Ga0439438_005445
1261 Ga0439447_008552
1262 Ga0439461_0001436
1263 Ga0439461_0002116
1264 Ga0439466_0018840
1265 Ga0439432_001429
1266 Ga0439452_011374
1267 Ga0439463_016076
1268 Ga0439446_0012241
1269 Ga0439434_0009853
1270 Ga0439464_0000005
1271 Ga0451577_0003336
1272 Ga0451577_0003347
1273 Ga0451577_0005505
1274 Ga0451577_0006411
1275 Ga0451577_0051406
1276 Ga0451577_0061329
1277 Ga0451577_0122329
1278 Ga0451577_0190190
1279 Ga0451577_0219240
1280 Ga0451577_0286263
1281 Ga0453683_0000001
1282 Ga0453683_0000006
1283 Ga0453683_0000012
1284 Ga0453683_0002267
1285 Ga0453683_0004035
1286 Ga0453683_0007613
1287 Ga0453683_0012486
1288 Ga0453683_0043974
1289 Ga0453683_0114676
1290 Ga0453683_0185910
1291 Ga0466963_0027972
1292 Ga0466963_0035342
1293 Ga0453684_0000041
1294 Ga0453684_0000055
1295 Ga0453684_0000318
1296 Ga0453684_0000505
1297 Ga0453684_0000548
1298 Ga0453684_0000763
1299 Ga0453684_0001495
1300 Ga0453684_0003175
1301 Ga0453684_0003680
1302 Ga0453684_0005515
1303 Ga0453684_0006071
1304 Ga0453684_0006242
1305 Ga0453684_0006753
1306 Ga0453684_0010308
1307 Ga0453684_0012287
1308 Ga0453684_0012937
1309 Ga0453684_0015120
1310 Ga0453684_0015944
1311 Ga0453684_0052906
1312 Ga0453684_0056174
1313 Ga0453684_0083223
1314 Ga0453684_0103885
1315 Ga0453684_0108890
1316 Ga0453684_0137737
1317 Ga0453684_0149919
1318 Ga0453684_0161821
1319 Ga0453684_0180571
1320 Ga0453684_0218393
1321 Ga0453684_0362184
1322 Ga0453684_0393530
1323 Ga0453684_0437803
1324 Ga0453684_0484016
1325 Ga0453684_0533426
1326 Ga0453684_0582136
1327 Ga0453684_0767322
1328 Ga0466971_0026847
1329 Ga0466959_0015089
1330 Ga0451576_0000008
1331 Ga0451576_0000023
1332 Ga0451576_0000026
1333 Ga0451576_0000038
1334 Ga0451576_0000048
1335 Ga0451576_0000054
1336 Ga0451576_0000142
1337 Ga0451576_0004232
1338 Ga0451576_0006528
1339 Ga0451576_0006943
1340 Ga0451576_0010423
1341 Ga0451576_0020602
1342 Ga0451576_0025596
1343 Ga0451576_0034858
1344 Ga0451576_0036412
1345 Ga0451576_0067571
1346 Ga0451576_0104691
1347 Ga0451576_0180271
1348 Ga0451576_0412618
1349 Ga0451576_0449187
1350 Ga0495629_0018692
1351 Ga0495629_0135179
1352 Ga0495638_0000061
1353 Ga0495638_0000167
1354 Ga0495650_0000467
1355 Ga0495596_0008118
1356 Ga0495583_0017674
1357 Ga0495648_0000166
1358 Ga0495663_0003723
1359 Ga0495622_0000008
1360 Ga0495668_0000261
1361 Ga0495625_0002648
1362 Ga0495659_0001994
1363 Ga0495659_0013183
1364 Ga0495659_0040264
1365 Ga0495658_0002026
1366 Ga0495649_0000100
1367 Ga0495604_0034265
1368 Ga0495674_0215893
1369 Ga0495672_0000010
1370 Ga0496101_0020431
1371 Ga0496101_0115381
1372 Ga0496101_0318358
1373 Ga0496102_0000577
1374 Ga0496102_0197826
1375 Ga0496103_0001103
1376 Ga0496104_0001960
1377 Ga0496104_0029554
1378 Ga0496104_0050871
1379 Ga0496104_0123706
1380 Ga0496104_0143370
1381 Ga0496105_0005203
1382 Ga0496105_0024366
1383 Ga0496105_0127370
1384 Ga0496107_0112433
1385 Ga0496109_0122864
1386 Ga0496110_0313507
1387 Ga0496111_0200396
1388 Ga0496113_0010304
1389 Ga0496114_0017367
1390 Ga0496115_0000001
1391 Ga0496115_0000382
1392 Ga0496115_0000423
1393 Ga0496115_0089623
1394 Ga0496117_0000320
1395 Ga0496118_0000144
1396 Ga0496118_0005674
1397 Ga0496119_0006832
1398 Ga0496121_0000070
1399 Ga0496121_0039799
1400 Ga0496122_0008273
1401 Ga0496123_0010797
1402 Ga0496124_0005475
1403 Ga0496124_0023302
1404 Ga0496124_0129986
1405 Ga0496126_0000505
1406 Ga0496126_0000696
1407 Ga0496126_0071597
1408 Ga0501031_0000777
1409 Ga0501032_0000641
1410 Ga0501034_0000028
1411 Ga0501034_0001066
1412 Ga0501034_0001383
1413 Ga0501034_0175821
1414 Ga0501034_0422894
1415 Ga0501036_0001678
1416 Ga0501037_0000001
1417 Ga0501037_0000138
1418 Ga0501038_0000863
1419 Ga0501038_0061888
1420 Ga0501042_0145426
1421 Ga0501043_0000062
1422 Ga0501046_0000059
1423 Ga0501047_0000032
1424 Ga0501047_0033489
1425 Ga0501047_0141318
1426 Ga0501048_0000001
1427 Ga0501070_0066407
1428 Ga0501072_0067678
1429 Ga0501072_0240505
1430 Ga0501075_0300726
1431 Ga0501076_0049781
1432 Ga0501076_0103933
1433 Ga0501076_0204966
1434 Ga0501079_0010737
1435 Ga0501080_0020371
1436 Ga0501083_0002809
1437 Ga0501035_0001735
1438 Ga0501044_0032556
1439 Ga0501045_0069229
1440 nmdc:mga03683_209_c1
1441 nmdc:mga03683_3956_c2
1442 nmdc:mga03n38_11_c1
1443 nmdc:mga00v17_13247_c1
1444 nmdc:mga00v17_143_c1
1445 nmdc:mga00v17_201301_c1
1446 nmdc:mga00v17_3385_c2
1447 nmdc:mga00v17_40179_c1
1448 nmdc:mga00v17_96758_c1
1449 nmdc:mga0yw44_12970_c1
1450 nmdc:mga0yw44_14_c1
1451 nmdc:mga0yw44_296_c1
1452 nmdc:mga0yw44_4033_c1
1453 nmdc:mga0yw44_4_c1
1454 nmdc:mga0yw44_8_c1
1455 nmdc:mga0k408_164_c1
1456 nmdc:mga0k408_194276_c1
1457 nmdc:mga0k408_1_c1
1458 nmdc:mga0k408_29_c1
1459 nmdc:mga0k408_6447_c1
1460 nmdc:mga0k408_69_c2
1461 nmdc:mga0k408_924_c1
1462 nmdc:mga06z11_483_c1
1463 nmdc:mga06z11_5_c1
1464 nmdc:mga04h51_7988_c1
1465 nmdc:mga04h51_9_c1
1466 nmdc:mga07m45_1009_c1
1467 nmdc:mga07m45_1611_c1
1468 nmdc:mga07m45_31_c1
1469 nmdc:mga07m45_36150_c1
1470 nmdc:mga07m45_73623_c1
1471 nmdc:mga05p37_107395_c1
1472 nmdc:mga05p37_145822_c1
1473 nmdc:mga05p37_164535_c1
1474 nmdc:mga05p37_289387_c1
1475 nmdc:mga05p37_39914_c1
1476 nmdc:mga05p37_6974_c1
1477 nmdc:mga09592_10685_c1
1478 nmdc:mga09592_304400_c1
1479 nmdc:mga09592_73388_c1
1480 nmdc:mga09592_8433_c1
1481 nmdc:mga0qj67_1812_c1
1482 nmdc:mga06r32_3537_c1
1483 nmdc:mga08y16_1493_c1
1484 nmdc:mga08y16_218815_c1
1485 nmdc:mga0n895_82487_c1
1486 nmdc:mga0a205_303244_c1
1487 nmdc:mga0sz30_3_c4
1488 Ga0500610_0000389
1489 Ga0495619_0000084
1490 Ga0500643_000034
1491 Ga0500643_000495
1492 Ga0500644_0008364
1493 Ga0500583_0007071
1494 Ga0500583_0008403
1495 Ga0500566_0000001
1496 Ga0500555_000001
1497 Ga0500555_000009
1498 Ga0500562_000002
1499 Ga0500569_000001
1500 Ga0500593_000001
1501 Ga0500593_027461
1502 Ga0500614_000001
1503 Ga0500642_0123628
1504 Ga0500655_000483
1505 Ga0500559_0021462
1506 Ga0500561_0000002
1507 Ga0500568_0003924
1508 Ga0500577_0003518
1509 Ga0500588_0000027
1510 Ga0500616_0000012
1511 Ga0500616_0023868
1512 Ga0500616_0026398
1513 Ga0500616_0086596
1514 Ga0500649_000039
1515 Ga0500611_000481
1516 Ga0500611_002005
1517 Ga0500645_000062
1518 Ga0501084_0009937
1519 Ga0501084_0016042
1520 Ga0501084_0084007
1521 Ga0501084_0140552
1522 Ga0501084_0266423
1523 2512734540
1524 2600226200
1525 2819712753
1526 2864997678
1527 2865006008
1528 2879166984
1529 2928102683
1530 2928527354
1531 2928969165
1532 8007376455
1533 8022893510
1534 8057978663

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00154

RecA

recA bacterial DNA recombination protein

7

250

0.99

PF21096

RecA_C

RecA C-terminal domain

253

309

0.97

PF06745

ATPase

KaiC

39

249

0.92

PF08423

Rad51

Rad51

32

252

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jy9-assembly1.cif.gz_I structure of a 9 base pair reca-d loop complex 0.9016 46 351
7jy9-assembly1.cif.gz_I structure of a 9 base pair reca-d loop complex 0.8958 46 351
3cmw-assembly1.cif.gz_A mechanism of homologous recombination from the reca-ssdna/dsdna structures 0.8869 15 337
3cmu-assembly1.cif.gz_A mechanism of homologous recombination from the reca-ssdna/dsdna structures 0.8854 15 337
2zrb-assembly1.cif.gz_A msreca q196e form ii' 0.8851 19 336
ID Description Score Start End Superfamily
af_C0HJ69_348_406_3.30.250.10 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9998 281 337 3.30.250.10
2zrcA02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9891 281 338 3.30.250.10
2zr7A02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9797 281 336 3.30.250.10
2zrgA02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.9732 281 336 3.30.250.10
1ubgA02 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.973 281 338 3.30.250.10

Map