F479924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 767 | 365 | 1534 | 350 |
Family's Representative Sequence
| Representative Sequence | 3300054114|Ga0501084_0002155|Ga0501084_0002155_2553_3581 |
| Length | 324 |
| Sequence | MAEEKKHALEHALDEINKRWGEGSIMPLGESNTMAIESIPTGSLSLDLALGVGGIPRGRVTEIYGPESSGKTTICQHIVAEVQKKGGTAAYIDMEHALDPTYAARCGVDVEKLLISQPDTGEQALEIAEALVRSGAVDLVVVDSVAALVPRSEIEGDMGDATMGMQARLMSQANQLRQKIGVMFGNPETTTGGMALKFYASVRMDVRRVQSIKEGQDIVGSRTRVRIVKNKVSAPFRTAEFDIMYNEGISKAGDVLDLASQLDIVTKRGSHYLYGEERLGQGRENAKAFLRENEAVAAAIEEKVRAHAEPNLLLGAGEGDAGDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 102 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 103 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 104 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 192 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 193 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 194 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 195 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 196 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 197 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 198 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 209 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 218 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 219 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 226 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 236 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 237 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 238 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 243 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 244 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 247 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 248 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 249 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 337 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 339 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 341 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 342 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 343 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 353 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 354 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 355 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 356 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 357 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 358 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 359 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 360 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 361 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 362 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 363 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 364 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 365 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.78 |
| Metatranscriptomes | 0.65 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.21 |
| Nodule | 0.26 |
| Rhizoplane | 3.26 |
| Rhizosphere | 76.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501084_0002155 | 3300054114 | Bacteria | 15758 |
| 2 | SwRhRL2b_contig_2039187 | 2162886007 | Bacteria | 9314 |
| 3 | JGI24741J21665_1000172 | 3300001915 | Bacteria | 18661 |
| 4 | JGI24741J21665_1000432 | 3300001915 | Bacteria | 12653 |
| 5 | JGI24740J21852_10006184 | 3300001979 | Bacteria | 4990 |
| 6 | JGI24740J21852_10008985 | 3300001979 | Bacteria | 3942 |
| 7 | JGI24739J22299_10002774 | 3300001989 | Bacteria | 6734 |
| 8 | JGI24739J22299_10003084 | 3300001989 | Bacteria | 6363 |
| 9 | JGI24737J22298_10000010 | 3300001990 | Bacteria | 55828 |
| 10 | JGI24737J22298_10000043 | 3300001990 | Bacteria | 36744 |
| 11 | JGI24743J22301_10001560 | 3300001991 | Bacteria | 3214 |
| 12 | JGI24735J21928_10000052 | 3300002067 | Bacteria | 50482 |
| 13 | JGI24735J21928_10000104 | 3300002067 | Bacteria | 31029 |
| 14 | JGI24738J21930_10000355 | 3300002075 | Bacteria | 12706 |
| 15 | JGI24738J21930_10008934 | 3300002075 | Bacteria | 2270 |
| 16 | JGI24033J26618_1000732 | 3300002155 | Bacteria | 3144 |
| 17 | JGI25150J39212_1000657 | 3300002774 | Bacteria | 12838 |
| 18 | JGI25151J46595_10029487 | 3300003187 | Bacteria | 2172 |
| 19 | JGI25406J46586_10026712 | 3300003203 | Bacteria | 2221 |
| 20 | JGI25153J46596_10000266 | 3300003215 | Bacteria | 41550 |
| 21 | rootH1_10009329 | 3300003316 | Bacteria | 46993 |
| 22 | rootH2_10006821 | 3300003320 | Bacteria | 94080 |
| 23 | rootH1_10012137 | 3300003323 | Bacteria | 62005 |
| 24 | Ga0055526_1006177 | 3300003771 | Bacteria | 6589 |
| 25 | Ga0055540_1000692 | 3300003792 | Bacteria | 23249 |
| 26 | Ga0065704_10000250 | 3300005289 | Bacteria | 52865 |
| 27 | Ga0065704_10000296 | 3300005289 | Bacteria | 57332 |
| 28 | Ga0065712_10160842 | 3300005290 | Bacteria | 1303 |
| 29 | Ga0065707_10082246 | 3300005295 | Bacteria | 18304 |
| 30 | Ga0065707_10105175 | 3300005295 | Bacteria | 2657 |
| 31 | Ga0070658_10000009 | 3300005327 | Bacteria | 319868 |
| 32 | Ga0070658_10000110 | 3300005327 | Bacteria | 73137 |
| 33 | Ga0070658_10000385 | 3300005327 | Bacteria | 38446 |
| 34 | Ga0070683_100000184 | 3300005329 | Bacteria | 41529 |
| 35 | Ga0070683_100063971 | 3300005329 | Bacteria | 3423 |
| 36 | Ga0070683_100113090 | 3300005329 | Bacteria | 2562 |
| 37 | Ga0070690_100015025 | 3300005330 | Bacteria | 4608 |
| 38 | Ga0070670_100115038 | 3300005331 | Bacteria | 2319 |
| 39 | Ga0070666_10095755 | 3300005335 | Bacteria | 2043 |
| 40 | Ga0070680_100244075 | 3300005336 | Bacteria | 1518 |
| 41 | Ga0070660_100010369 | 3300005339 | Bacteria | 6585 |
| 42 | Ga0070660_100183842 | 3300005339 | Bacteria | 1692 |
| 43 | Ga0070669_100000068 | 3300005353 | Bacteria | 103282 |
| 44 | Ga0070675_100115022 | 3300005354 | Bacteria | 2280 |
| 45 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 46 | Ga0070671_100001336 | 3300005355 | Bacteria | 18491 |
| 47 | Ga0070674_100046632 | 3300005356 | Bacteria | 2966 |
| 48 | Ga0070659_100012416 | 3300005366 | Bacteria | 6316 |
| 49 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 50 | Ga0070667_100000157 | 3300005367 | Bacteria | 84556 |
| 51 | Ga0070667_100006733 | 3300005367 | Bacteria | 9546 |
| 52 | Ga0070667_100019440 | 3300005367 | Bacteria | 5636 |
| 53 | Ga0070667_100044275 | 3300005367 | Bacteria | 3737 |
| 54 | Ga0070714_100000082 | 3300005435 | Bacteria | 82377 |
| 55 | Ga0070714_100001000 | 3300005435 | Bacteria | 20165 |
| 56 | Ga0070714_100031012 | 3300005435 | Bacteria | 4455 |
| 57 | Ga0070713_100051150 | 3300005436 | Bacteria | 3417 |
| 58 | Ga0070713_100059589 | 3300005436 | Bacteria | 3189 |
| 59 | Ga0070713_100129400 | 3300005436 | Bacteria | 2224 |
| 60 | Ga0070713_100264606 | 3300005436 | Bacteria | 1572 |
| 61 | Ga0070701_10161699 | 3300005438 | Bacteria | 1297 |
| 62 | Ga0070694_100198343 | 3300005444 | Bacteria | 1495 |
| 63 | Ga0070708_100000018 | 3300005445 | Bacteria | 119022 |
| 64 | Ga0070708_100004468 | 3300005445 | Bacteria | 11001 |
| 65 | Ga0070708_100084659 | 3300005445 | Bacteria | 2876 |
| 66 | Ga0070708_100089745 | 3300005445 | Bacteria | 2797 |
| 67 | Ga0070708_100130313 | 3300005445 | Bacteria | 2327 |
| 68 | Ga0070678_100000104 | 3300005456 | Bacteria | 32585 |
| 69 | Ga0070678_100015475 | 3300005456 | Bacteria | 4852 |
| 70 | Ga0070662_100006047 | 3300005457 | Bacteria | 7770 |
| 71 | Ga0070681_10160778 | 3300005458 | Bacteria | 2170 |
| 72 | Ga0070706_100000026 | 3300005467 | Bacteria | 156154 |
| 73 | Ga0070706_100000548 | 3300005467 | Bacteria | 43687 |
| 74 | Ga0070706_100006587 | 3300005467 | Bacteria | 10952 |
| 75 | Ga0070706_100088844 | 3300005467 | Bacteria | 2865 |
| 76 | Ga0070706_100143741 | 3300005467 | Bacteria | 2227 |
| 77 | Ga0070706_100164761 | 3300005467 | Bacteria | 2070 |
| 78 | Ga0070707_100000004 | 3300005468 | Bacteria | 265003 |
| 79 | Ga0070707_100000434 | 3300005468 | Bacteria | 41451 |
| 80 | Ga0070707_100002828 | 3300005468 | Bacteria | 16510 |
| 81 | Ga0070707_100006967 | 3300005468 | Bacteria | 10476 |
| 82 | Ga0070707_100027594 | 3300005468 | Bacteria | 5402 |
| 83 | Ga0070707_100066689 | 3300005468 | Bacteria | 3459 |
| 84 | Ga0070707_100183776 | 3300005468 | Bacteria | 2038 |
| 85 | Ga0070698_100003377 | 3300005471 | Bacteria | 17558 |
| 86 | Ga0070698_100004957 | 3300005471 | Bacteria | 14587 |
| 87 | Ga0070698_100015120 | 3300005471 | Bacteria | 8160 |
| 88 | Ga0070699_100000042 | 3300005518 | Bacteria | 127464 |
| 89 | Ga0070699_100005835 | 3300005518 | Bacteria | 10763 |
| 90 | Ga0070699_100050609 | 3300005518 | Bacteria | 3597 |
| 91 | Ga0070699_100064723 | 3300005518 | Bacteria | 3171 |
| 92 | Ga0070679_100016249 | 3300005530 | Bacteria | 7171 |
| 93 | Ga0070679_100056515 | 3300005530 | Bacteria | 3910 |
| 94 | Ga0070684_100000345 | 3300005535 | Bacteria | 31913 |
| 95 | Ga0070697_100000006 | 3300005536 | Bacteria | 226483 |
| 96 | Ga0070697_100003316 | 3300005536 | Bacteria | 12369 |
| 97 | Ga0070697_100060273 | 3300005536 | Bacteria | 3092 |
| 98 | Ga0070697_100184769 | 3300005536 | Bacteria | 1768 |
| 99 | Ga0070695_100145339 | 3300005545 | Bacteria | 1649 |
| 100 | Ga0070696_100080143 | 3300005546 | Bacteria | 2311 |
| 101 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 102 | Ga0070665_100007667 | 3300005548 | Bacteria | 10966 |
| 103 | Ga0070704_100026011 | 3300005549 | Bacteria | 3861 |
| 104 | Ga0068855_100000002 | 3300005563 | Bacteria | 616881 |
| 105 | Ga0068855_100000005 | 3300005563 | Bacteria | 337711 |
| 106 | Ga0068855_100007933 | 3300005563 | Bacteria | 12829 |
| 107 | Ga0068855_100062267 | 3300005563 | Bacteria | 4356 |
| 108 | Ga0070664_100000721 | 3300005564 | Bacteria | 25354 |
| 109 | Ga0070664_100026141 | 3300005564 | Bacteria | 4840 |
| 110 | Ga0068857_100000057 | 3300005577 | Bacteria | 62388 |
| 111 | Ga0068857_100000066 | 3300005577 | Bacteria | 59014 |
| 112 | Ga0068857_100040042 | 3300005577 | Bacteria | 4155 |
| 113 | Ga0068857_100271286 | 3300005577 | Bacteria | 1559 |
| 114 | Ga0068857_100277832 | 3300005577 | Bacteria | 1540 |
| 115 | Ga0068856_100000029 | 3300005614 | Bacteria | 130205 |
| 116 | Ga0068856_100000122 | 3300005614 | Bacteria | 78134 |
| 117 | Ga0068856_100203100 | 3300005614 | Bacteria | 1996 |
| 118 | Ga0068856_100543657 | 3300005614 | Bacteria | 1183 |
| 119 | Ga0070702_100139784 | 3300005615 | Bacteria | 1541 |
| 120 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 121 | Ga0068852_100000011 | 3300005616 | Bacteria | 141147 |
| 122 | Ga0068859_100213391 | 3300005617 | Bacteria | 2017 |
| 123 | Ga0068864_100152392 | 3300005618 | Bacteria | 2095 |
| 124 | Ga0068866_10029123 | 3300005718 | Bacteria | 2638 |
| 125 | Ga0068860_100008228 | 3300005843 | Bacteria | 10381 |
| 126 | Ga0068860_100119400 | 3300005843 | Bacteria | 2524 |
| 127 | Ga0068862_100021245 | 3300005844 | Bacteria | 5425 |
| 128 | Ga0068862_100317353 | 3300005844 | Bacteria | 1437 |
| 129 | Ga0081455_10000008 | 3300005937 | Bacteria | 256558 |
| 130 | Ga0081538_10000568 | 3300005981 | Bacteria | 40894 |
| 131 | Ga0081538_10001762 | 3300005981 | Bacteria | 21919 |
| 132 | Ga0081538_10088914 | 3300005981 | Bacteria | 1606 |
| 133 | Ga0081539_10000597 | 3300005985 | Bacteria | 73805 |
| 134 | Ga0081539_10005727 | 3300005985 | Bacteria | 12427 |
| 135 | Ga0070717_10002899 | 3300006028 | Bacteria | 12180 |
| 136 | Ga0070717_10046717 | 3300006028 | Bacteria | 3544 |
| 137 | Ga0075365_10000083 | 3300006038 | Bacteria | 27773 |
| 138 | Ga0075365_10000103 | 3300006038 | Bacteria | 25003 |
| 139 | Ga0075365_10001489 | 3300006038 | Bacteria | 10671 |
| 140 | Ga0075365_10005957 | 3300006038 | Bacteria | 6647 |
| 141 | Ga0075365_10022550 | 3300006038 | Bacteria | 3947 |
| 142 | Ga0075365_10023067 | 3300006038 | Bacteria | 3909 |
| 143 | Ga0075365_10031136 | 3300006038 | Bacteria | 3421 |
| 144 | Ga0075368_10000052 | 3300006042 | Bacteria | 28370 |
| 145 | Ga0075368_10000058 | 3300006042 | Bacteria | 26490 |
| 146 | Ga0075363_100000017 | 3300006048 | Bacteria | 37366 |
| 147 | Ga0075363_100052852 | 3300006048 | Bacteria | 2169 |
| 148 | Ga0075364_10000818 | 3300006051 | Bacteria | 16408 |
| 149 | Ga0075364_10001226 | 3300006051 | Bacteria | 13804 |
| 150 | Ga0075364_10005917 | 3300006051 | Bacteria | 7149 |
| 151 | Ga0075364_10009157 | 3300006051 | Bacteria | 5931 |
| 152 | Ga0075367_10000026 | 3300006178 | Bacteria | 31428 |
| 153 | Ga0075367_10004148 | 3300006178 | Bacteria | 7030 |
| 154 | Ga0075369_10005866 | 3300006186 | Bacteria | 4614 |
| 155 | Ga0075427_10000444 | 3300006194 | Bacteria | 4706 |
| 156 | Ga0075366_10000002 | 3300006195 | Bacteria | 153795 |
| 157 | Ga0075366_10000007 | 3300006195 | Bacteria | 104412 |
| 158 | Ga0075366_10000028 | 3300006195 | Bacteria | 50296 |
| 159 | Ga0075366_10000695 | 3300006195 | Bacteria | 15902 |
| 160 | Ga0075366_10006952 | 3300006195 | Bacteria | 6231 |
| 161 | Ga0075366_10008696 | 3300006195 | Bacteria | 5654 |
| 162 | Ga0075366_10208846 | 3300006195 | Bacteria | 1188 |
| 163 | Ga0097621_100060979 | 3300006237 | Bacteria | 3093 |
| 164 | Ga0075370_10000025 | 3300006353 | Bacteria | 52081 |
| 165 | Ga0075370_10002100 | 3300006353 | Bacteria | 9088 |
| 166 | Ga0075370_10024603 | 3300006353 | Bacteria | 3328 |
| 167 | Ga0068871_100038215 | 3300006358 | Bacteria | 3832 |
| 168 | Ga0075428_100000608 | 3300006844 | Bacteria | 36522 |
| 169 | Ga0075428_100004454 | 3300006844 | Bacteria | 15454 |
| 170 | Ga0075428_100325265 | 3300006844 | Bacteria | 1652 |
| 171 | Ga0075428_100461906 | 3300006844 | Bacteria | 1359 |
| 172 | Ga0075430_100002441 | 3300006846 | Bacteria | 15477 |
| 173 | Ga0075431_100018973 | 3300006847 | Bacteria | 7006 |
| 174 | Ga0075431_100208585 | 3300006847 | Bacteria | 1997 |
| 175 | Ga0075434_100052531 | 3300006871 | Bacteria | 4050 |
| 176 | Ga0075429_100028737 | 3300006880 | Bacteria | 4829 |
| 177 | Ga0075429_100085547 | 3300006880 | Bacteria | 2748 |
| 178 | Ga0075429_100301891 | 3300006880 | Bacteria | 1402 |
| 179 | Ga0068865_100007409 | 3300006881 | Bacteria | 6752 |
| 180 | Ga0097620_100001903 | 3300006931 | Bacteria | 21274 |
| 181 | Ga0097620_100213392 | 3300006931 | Bacteria | 2017 |
| 182 | Ga0079104_1020960 | 3300006946 | Bacteria | 1788 |
| 183 | Ga0105240_10000554 | 3300009093 | Bacteria | 69214 |
| 184 | Ga0105240_10002029 | 3300009093 | Bacteria | 33399 |
| 185 | Ga0105240_10016535 | 3300009093 | Bacteria | 9986 |
| 186 | Ga0105240_10026773 | 3300009093 | Bacteria | 7562 |
| 187 | Ga0111539_10065395 | 3300009094 | Bacteria | 4297 |
| 188 | Ga0111539_10183257 | 3300009094 | Bacteria | 2446 |
| 189 | Ga0111539_10460569 | 3300009094 | Bacteria | 1481 |
| 190 | Ga0105245_10014297 | 3300009098 | Bacteria | 6917 |
| 191 | Ga0105247_10041511 | 3300009101 | Bacteria | 2816 |
| 192 | Ga0114129_10000238 | 3300009147 | Bacteria | 61413 |
| 193 | Ga0114129_10008060 | 3300009147 | Bacteria | 15011 |
| 194 | Ga0114129_10012935 | 3300009147 | Bacteria | 11877 |
| 195 | Ga0114129_10020433 | 3300009147 | Bacteria | 9417 |
| 196 | Ga0114129_10083569 | 3300009147 | Bacteria | 4434 |
| 197 | Ga0114129_10088530 | 3300009147 | Bacteria | 4292 |
| 198 | Ga0114129_10107423 | 3300009147 | Bacteria | 3855 |
| 199 | Ga0114129_10126724 | 3300009147 | Bacteria | 3510 |
| 200 | Ga0105243_10000202 | 3300009148 | Bacteria | 69670 |
| 201 | Ga0105241_10216967 | 3300009174 | Bacteria | 1606 |
| 202 | Ga0105242_10093166 | 3300009176 | Bacteria | 2539 |
| 203 | Ga0105248_10003194 | 3300009177 | Bacteria | 18164 |
| 204 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 205 | Ga0105237_10003197 | 3300009545 | Bacteria | 19653 |
| 206 | Ga0105238_10005238 | 3300009551 | Bacteria | 12819 |
| 207 | Ga0105238_10020637 | 3300009551 | Bacteria | 6711 |
| 208 | Ga0105238_10131474 | 3300009551 | Bacteria | 2481 |
| 209 | Ga0105238_10137152 | 3300009551 | Bacteria | 2424 |
| 210 | Ga0105249_10032980 | 3300009553 | Bacteria | 4687 |
| 211 | Ga0105249_10161045 | 3300009553 | Bacteria | 2168 |
| 212 | Ga0105032_100002 | 3300009979 | Bacteria | 303884 |
| 213 | Ga0105032_100013 | 3300009979 | Bacteria | 60280 |
| 214 | Ga0105032_102837 | 3300009979 | Bacteria | 1530 |
| 215 | Ga0105029_100084 | 3300009984 | Bacteria | 4504 |
| 216 | Ga0105033_100015 | 3300009986 | Bacteria | 17160 |
| 217 | Ga0105030_101827 | 3300009987 | Bacteria | 1874 |
| 218 | Ga0105239_10001282 | 3300010375 | Bacteria | 33954 |
| 219 | Ga0105239_10001890 | 3300010375 | Bacteria | 27386 |
| 220 | Ga0105246_10000260 | 3300011119 | Bacteria | 27386 |
| 221 | Ga0105246_10002918 | 3300011119 | Bacteria | 10347 |
| 222 | Ga0105246_10005815 | 3300011119 | Bacteria | 7520 |
| 223 | Ga0157373_10006247 | 3300013100 | Bacteria | 8901 |
| 224 | Ga0157373_10008975 | 3300013100 | Bacteria | 7397 |
| 225 | Ga0157373_10083103 | 3300013100 | Bacteria | 2257 |
| 226 | Ga0157371_10000024 | 3300013102 | Bacteria | 281202 |
| 227 | Ga0157371_10047312 | 3300013102 | Bacteria | 3058 |
| 228 | Ga0157370_10001378 | 3300013104 | Bacteria | 30046 |
| 229 | Ga0157370_10033569 | 3300013104 | Bacteria | 5003 |
| 230 | Ga0157370_10065233 | 3300013104 | Bacteria | 3445 |
| 231 | Ga0157370_10475909 | 3300013104 | Bacteria | 1148 |
| 232 | Ga0157369_10000026 | 3300013105 | Bacteria | 216023 |
| 233 | Ga0157369_10000634 | 3300013105 | Bacteria | 45464 |
| 234 | Ga0157369_10019267 | 3300013105 | Bacteria | 7633 |
| 235 | Ga0157374_10000709 | 3300013296 | Bacteria | 29221 |
| 236 | Ga0157374_10025003 | 3300013296 | Bacteria | 5358 |
| 237 | Ga0163162_10033432 | 3300013306 | Bacteria | 5111 |
| 238 | Ga0157372_10000106 | 3300013307 | Bacteria | 87935 |
| 239 | Ga0157372_10135225 | 3300013307 | Bacteria | 2838 |
| 240 | Ga0157372_10191699 | 3300013307 | Bacteria | 2367 |
| 241 | Ga0157372_10329715 | 3300013307 | Bacteria | 1777 |
| 242 | Ga0157514_104927 | 3300013874 | Bacteria | 1339 |
| 243 | Ga0163163_10178269 | 3300014325 | Bacteria | 2172 |
| 244 | Ga0157380_10089451 | 3300014326 | Bacteria | 2537 |
| 245 | Ga0157377_10000373 | 3300014745 | Bacteria | 19998 |
| 246 | Ga0157376_10000085 | 3300014969 | Bacteria | 70910 |
| 247 | Ga0157376_10007264 | 3300014969 | Bacteria | 7891 |
| 248 | Ga0197907_10284452 | 3300020069 | Bacteria | 1414 |
| 249 | Ga0213873_10005067 | 3300021358 | Bacteria | 2503 |
| 250 | Ga0213872_10087167 | 3300021361 | Bacteria | 1399 |
| 251 | Ga0213874_10003975 | 3300021377 | Bacteria | 3328 |
| 252 | Ga0224712_10122007 | 3300022467 | Bacteria | 1129 |
| 253 | Ga0207425_1000114 | 3300025245 | Bacteria | 77043 |
| 254 | Ga0209129_1003213 | 3300025258 | Bacteria | 7295 |
| 255 | Ga0209676_1000211 | 3300025292 | Bacteria | 129654 |
| 256 | Ga0209676_1012541 | 3300025292 | Bacteria | 3321 |
| 257 | Ga0209025_1007905 | 3300025294 | Bacteria | 7790 |
| 258 | Ga0209025_1007934 | 3300025294 | Bacteria | 7772 |
| 259 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 260 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 261 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 262 | Ga0209050_1005259 | 3300025298 | Bacteria | 8245 |
| 263 | Ga0207426_1018413 | 3300025302 | Bacteria | 2460 |
| 264 | Ga0209051_1000336 | 3300025303 | Bacteria | 70491 |
| 265 | Ga0209257_1000076 | 3300025304 | Bacteria | 324617 |
| 266 | Ga0209257_1001103 | 3300025304 | Bacteria | 35112 |
| 267 | Ga0207696_1007348 | 3300025711 | Bacteria | 4324 |
| 268 | Ga0207713_1007508 | 3300025735 | Bacteria | 6419 |
| 269 | Ga0207680_10105462 | 3300025903 | Bacteria | 1818 |
| 270 | Ga0207647_10001626 | 3300025904 | Bacteria | 17272 |
| 271 | Ga0207647_10003940 | 3300025904 | Bacteria | 11082 |
| 272 | Ga0207705_10000010 | 3300025909 | Bacteria | 518023 |
| 273 | Ga0207705_10000227 | 3300025909 | Bacteria | 55933 |
| 274 | Ga0207705_10000306 | 3300025909 | Bacteria | 45253 |
| 275 | Ga0207684_10000008 | 3300025910 | Bacteria | 601602 |
| 276 | Ga0207684_10000034 | 3300025910 | Bacteria | 291009 |
| 277 | Ga0207684_10013352 | 3300025910 | Bacteria | 7106 |
| 278 | Ga0207684_10078416 | 3300025910 | Bacteria | 2809 |
| 279 | Ga0207654_10000177 | 3300025911 | Bacteria | 39463 |
| 280 | Ga0207654_10008838 | 3300025911 | Bacteria | 5110 |
| 281 | Ga0207654_10058914 | 3300025911 | Bacteria | 2238 |
| 282 | Ga0207707_10018045 | 3300025912 | Bacteria | 6147 |
| 283 | Ga0207707_10039709 | 3300025912 | Bacteria | 4113 |
| 284 | Ga0207695_10001111 | 3300025913 | Bacteria | 46810 |
| 285 | Ga0207695_10016819 | 3300025913 | Bacteria | 8539 |
| 286 | Ga0207695_10042724 | 3300025913 | Bacteria | 4837 |
| 287 | Ga0207695_10075298 | 3300025913 | Bacteria | 3435 |
| 288 | Ga0207695_10079328 | 3300025913 | Bacteria | 3328 |
| 289 | Ga0207695_10129115 | 3300025913 | Bacteria | 2486 |
| 290 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 291 | Ga0207671_10007296 | 3300025914 | Bacteria | 9614 |
| 292 | Ga0207671_10008857 | 3300025914 | Bacteria | 8474 |
| 293 | Ga0207693_10021160 | 3300025915 | Bacteria | 5170 |
| 294 | Ga0207660_10024531 | 3300025917 | Bacteria | 4084 |
| 295 | Ga0207660_10106267 | 3300025917 | Bacteria | 2105 |
| 296 | Ga0207660_10173410 | 3300025917 | Bacteria | 1671 |
| 297 | Ga0207662_10199988 | 3300025918 | Bacteria | 1293 |
| 298 | Ga0207657_10041847 | 3300025919 | Bacteria | 4047 |
| 299 | Ga0207649_10000438 | 3300025920 | Bacteria | 30054 |
| 300 | Ga0207652_10007555 | 3300025921 | Bacteria | 8751 |
| 301 | Ga0207646_10000018 | 3300025922 | Bacteria | 291009 |
| 302 | Ga0207646_10000192 | 3300025922 | Bacteria | 83182 |
| 303 | Ga0207646_10001274 | 3300025922 | Bacteria | 31519 |
| 304 | Ga0207646_10009519 | 3300025922 | Bacteria | 9595 |
| 305 | Ga0207646_10031330 | 3300025922 | Bacteria | 4814 |
| 306 | Ga0207646_10037262 | 3300025922 | Bacteria | 4385 |
| 307 | Ga0207646_10068603 | 3300025922 | Bacteria | 3167 |
| 308 | Ga0207681_10000083 | 3300025923 | Bacteria | 83026 |
| 309 | Ga0207694_10039392 | 3300025924 | Bacteria | 3637 |
| 310 | Ga0207694_10113960 | 3300025924 | Bacteria | 2153 |
| 311 | Ga0207687_10008804 | 3300025927 | Bacteria | 6596 |
| 312 | Ga0207700_10129110 | 3300025928 | Bacteria | 2061 |
| 313 | Ga0207700_10241241 | 3300025928 | Bacteria | 1540 |
| 314 | Ga0207664_10000005 | 3300025929 | Bacteria | 485048 |
| 315 | Ga0207664_10001003 | 3300025929 | Bacteria | 18920 |
| 316 | Ga0207664_10046732 | 3300025929 | Bacteria | 3399 |
| 317 | Ga0207664_10149295 | 3300025929 | Bacteria | 1984 |
| 318 | Ga0207664_10231159 | 3300025929 | Bacteria | 1607 |
| 319 | Ga0207664_10235320 | 3300025929 | Bacteria | 1593 |
| 320 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 321 | Ga0207644_10002137 | 3300025931 | Bacteria | 12813 |
| 322 | Ga0207690_10005160 | 3300025932 | Bacteria | 7708 |
| 323 | Ga0207690_10006471 | 3300025932 | Bacteria | 6943 |
| 324 | Ga0207690_10033527 | 3300025932 | Bacteria | 3302 |
| 325 | Ga0207706_10000004 | 3300025933 | Bacteria | 280765 |
| 326 | Ga0207706_10192786 | 3300025933 | Bacteria | 1788 |
| 327 | Ga0207686_10009883 | 3300025934 | Bacteria | 5186 |
| 328 | Ga0207709_10000201 | 3300025935 | Bacteria | 78554 |
| 329 | Ga0207709_10093789 | 3300025935 | Bacteria | 1969 |
| 330 | Ga0207669_10000042 | 3300025937 | Bacteria | 65679 |
| 331 | Ga0207704_10003921 | 3300025938 | Bacteria | 6764 |
| 332 | Ga0207711_10002040 | 3300025941 | Bacteria | 18266 |
| 333 | Ga0207661_10000117 | 3300025944 | Bacteria | 50849 |
| 334 | Ga0207661_10003956 | 3300025944 | Bacteria | 10347 |
| 335 | Ga0207661_10111942 | 3300025944 | Bacteria | 2310 |
| 336 | Ga0207661_10191722 | 3300025944 | Bacteria | 1792 |
| 337 | Ga0207661_10396337 | 3300025944 | Bacteria | 1251 |
| 338 | Ga0207679_10000126 | 3300025945 | Bacteria | 62566 |
| 339 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 340 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 341 | Ga0207667_10000027 | 3300025949 | Bacteria | 337700 |
| 342 | Ga0207667_10007257 | 3300025949 | Bacteria | 13370 |
| 343 | Ga0207667_10080034 | 3300025949 | Bacteria | 3386 |
| 344 | Ga0207712_10140984 | 3300025961 | Bacteria | 1850 |
| 345 | Ga0207712_10222550 | 3300025961 | Bacteria | 1510 |
| 346 | Ga0207668_10019397 | 3300025972 | Bacteria | 4298 |
| 347 | Ga0207640_10023753 | 3300025981 | Bacteria | 3689 |
| 348 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 349 | Ga0207658_10000941 | 3300025986 | Bacteria | 24026 |
| 350 | Ga0207658_10017635 | 3300025986 | Bacteria | 4922 |
| 351 | Ga0207658_10056053 | 3300025986 | Bacteria | 2923 |
| 352 | Ga0207703_10001425 | 3300026035 | Bacteria | 21819 |
| 353 | Ga0207703_10158088 | 3300026035 | Bacteria | 1983 |
| 354 | Ga0207639_10346274 | 3300026041 | Bacteria | 1326 |
| 355 | Ga0207678_10002519 | 3300026067 | Bacteria | 16682 |
| 356 | Ga0207702_10000051 | 3300026078 | Bacteria | 139040 |
| 357 | Ga0207702_10000431 | 3300026078 | Bacteria | 47962 |
| 358 | Ga0207702_10019321 | 3300026078 | Bacteria | 5638 |
| 359 | Ga0207702_10022445 | 3300026078 | Bacteria | 5232 |
| 360 | Ga0207702_10120752 | 3300026078 | Bacteria | 2345 |
| 361 | Ga0207702_10122889 | 3300026078 | Bacteria | 2326 |
| 362 | Ga0207674_10000032 | 3300026116 | Bacteria | 142389 |
| 363 | Ga0207674_10000299 | 3300026116 | Bacteria | 62812 |
| 364 | Ga0207674_10061756 | 3300026116 | Bacteria | 3785 |
| 365 | Ga0207683_10000067 | 3300026121 | Bacteria | 79552 |
| 366 | Ga0207683_10043323 | 3300026121 | Bacteria | 3933 |
| 367 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 368 | Ga0207698_10000024 | 3300026142 | Bacteria | 123946 |
| 369 | Ga0207698_10028119 | 3300026142 | Bacteria | 4004 |
| 370 | Ga0209281_1008313 | 3300027111 | Bacteria | 2529 |
| 371 | Ga0209588_1050382 | 3300027671 | Bacteria | 1347 |
| 372 | Ga0209998_10016051 | 3300027717 | Bacteria | 1574 |
| 373 | Ga0209813_10000008 | 3300027866 | Bacteria | 102867 |
| 374 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 375 | Ga0268266_10006783 | 3300028379 | Bacteria | 10438 |
| 376 | Ga0268265_10125306 | 3300028380 | Bacteria | 2124 |
| 377 | Ga0268264_10007078 | 3300028381 | Bacteria | 9399 |
| 378 | Ga0268264_10028561 | 3300028381 | Bacteria | 4563 |
| 379 | Ga0265337_1000643 | 3300028556 | Bacteria | 18479 |
| 380 | Ga0265337_1001500 | 3300028556 | Bacteria | 11453 |
| 381 | Ga0265326_10001451 | 3300028558 | Bacteria | 8338 |
| 382 | Ga0265326_10004561 | 3300028558 | Bacteria | 4430 |
| 383 | Ga0265334_10000004 | 3300028573 | Bacteria | 243436 |
| 384 | Ga0265318_10031077 | 3300028577 | Bacteria | 2073 |
| 385 | Ga0265336_10003070 | 3300028666 | Bacteria | 6649 |
| 386 | Ga0307517_10042372 | 3300028786 | Bacteria | 4884 |
| 387 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 388 | Ga0265338_10000189 | 3300028800 | Bacteria | 115979 |
| 389 | Ga0265338_10009651 | 3300028800 | Bacteria | 11453 |
| 390 | Ga0265338_10023306 | 3300028800 | Bacteria | 6369 |
| 391 | Ga0307511_10012705 | 3300030521 | Bacteria | 8249 |
| 392 | Ga0314311_1009060 | 3300030733 | Bacteria | 4507 |
| 393 | Ga0316179_1097059 | 3300030734 | Bacteria | 15011 |
| 394 | Ga0316178_1074752 | 3300030735 | Bacteria | 1338 |
| 395 | Ga0316180_1104216 | 3300030736 | Bacteria | 8845 |
| 396 | Ga0316183_1035098 | 3300030742 | Bacteria | 17152 |
| 397 | Ga0316183_1134592 | 3300030742 | Bacteria | 11520 |
| 398 | Ga0316181_1116978 | 3300030744 | Bacteria | 53317 |
| 399 | Ga0316182_1038280 | 3300030745 | Bacteria | 21015 |
| 400 | Ga0316182_1110912 | 3300030745 | Bacteria | 16963 |
| 401 | Ga0316182_1123588 | 3300030745 | Bacteria | 3123 |
| 402 | Ga0265330_10042232 | 3300031235 | Bacteria | 2021 |
| 403 | Ga0265340_10008273 | 3300031247 | Bacteria | 5619 |
| 404 | Ga0265331_10009915 | 3300031250 | Bacteria | 5303 |
| 405 | Ga0265327_10009859 | 3300031251 | Bacteria | 6820 |
| 406 | Ga0265327_10011207 | 3300031251 | Bacteria | 6210 |
| 407 | Ga0265316_10003366 | 3300031344 | Bacteria | 16199 |
| 408 | Ga0307513_10073068 | 3300031456 | Bacteria | 3572 |
| 409 | Ga0307509_10000584 | 3300031507 | Bacteria | 62341 |
| 410 | Ga0307509_10002816 | 3300031507 | Bacteria | 27540 |
| 411 | Ga0307408_100203579 | 3300031548 | Bacteria | 1604 |
| 412 | Ga0265313_10017279 | 3300031595 | Bacteria | 4106 |
| 413 | Ga0316575_10008136 | 3300031665 | Bacteria | 3812 |
| 414 | Ga0316575_10041326 | 3300031665 | Bacteria | 1824 |
| 415 | Ga0316575_10045815 | 3300031665 | Bacteria | 1737 |
| 416 | Ga0316579_10055736 | 3300031691 | Bacteria | 1854 |
| 417 | Ga0316579_10082603 | 3300031691 | Bacteria | 1531 |
| 418 | Ga0265314_10114656 | 3300031711 | Bacteria | 1707 |
| 419 | Ga0316576_10002497 | 3300031727 | Bacteria | 10480 |
| 420 | Ga0316576_10050710 | 3300031727 | Bacteria | 3019 |
| 421 | Ga0316576_10057465 | 3300031727 | Bacteria | 2843 |
| 422 | Ga0316576_10061348 | 3300031727 | Bacteria | 2756 |
| 423 | Ga0316578_10000007 | 3300031728 | Bacteria | 46913 |
| 424 | Ga0316578_10027315 | 3300031728 | Bacteria | 3225 |
| 425 | Ga0316578_10106336 | 3300031728 | Bacteria | 1684 |
| 426 | Ga0307516_10106175 | 3300031730 | Bacteria | 2618 |
| 427 | Ga0316577_10002771 | 3300031733 | Bacteria | 8735 |
| 428 | Ga0316577_10008069 | 3300031733 | Bacteria | 5629 |
| 429 | Ga0316577_10090201 | 3300031733 | Bacteria | 1716 |
| 430 | Ga0307412_10007283 | 3300031911 | Bacteria | 6274 |
| 431 | Ga0307412_10046235 | 3300031911 | Bacteria | 2851 |
| 432 | Ga0307409_100066615 | 3300031995 | Bacteria | 2841 |
| 433 | Ga0316585_10012623 | 3300032137 | Bacteria | 2505 |
| 434 | Ga0316580_10029193 | 3300032139 | Bacteria | 1706 |
| 435 | Ga0316580_10044078 | 3300032139 | Bacteria | 1376 |
| 436 | Ga0316593_10069698 | 3300032168 | Bacteria | 1215 |
| 437 | Ga0316593_10076388 | 3300032168 | Bacteria | 1164 |
| 438 | Ga0316596_1046255 | 3300033541 | Bacteria | 1150 |
| 439 | Ga0373930_0001506 | 3300034816 | Bacteria | 3484 |
| 440 | Ga0373929_0004252 | 3300035085 | Bacteria | 2568 |
| 441 | Ga0373929_0013123 | 3300035085 | Bacteria | 1584 |
| 442 | Ga0316574_0009421 | 3300035398 | Bacteria | 5470 |
| 443 | Ga0316574_0216332 | 3300035398 | Bacteria | 1229 |
| 444 | Ga0373931_0017038 | 3300035691 | Bacteria | 3585 |
| 445 | Ga0316582_0000419 | 3300036647 | Bacteria | 15541 |
| 446 | Ga0316582_0003641 | 3300036647 | Bacteria | 7606 |
| 447 | Ga0316582_0040620 | 3300036647 | Bacteria | 2904 |
| 448 | Ga0316584_0001751 | 3300036712 | Bacteria | 13345 |
| 449 | Ga0316584_0006450 | 3300036712 | Bacteria | 7942 |
| 450 | Ga0316584_0008823 | 3300036712 | Bacteria | 6966 |
| 451 | Ga0316584_0009448 | 3300036712 | Bacteria | 6770 |
| 452 | Ga0316584_0097428 | 3300036712 | Bacteria | 2202 |
| 453 | Ga0316584_0108735 | 3300036712 | Bacteria | 2075 |
| 454 | Ga0316584_0126762 | 3300036712 | Bacteria | 1906 |
| 455 | Ga0316584_0154914 | 3300036712 | Bacteria | 1704 |
| 456 | Ga0373925_0164356 | 3300037068 | Bacteria | 1750 |
| 457 | Ga0395899_0015610 | 3300037312 | Bacteria | 5790 |
| 458 | Ga0395899_0045286 | 3300037312 | Bacteria | 3278 |
| 459 | Ga0395899_0055382 | 3300037312 | Bacteria | 2933 |
| 460 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 461 | Ga0395900_0022488 | 3300037418 | Bacteria | 6448 |
| 462 | Ga0395900_0215387 | 3300037418 | Bacteria | 1938 |
| 463 | Ga0395900_0288491 | 3300037418 | Bacteria | 1630 |
| 464 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 465 | Ga0395898_0003669 | 3300037466 | Bacteria | 17057 |
| 466 | Ga0395898_0005045 | 3300037466 | Bacteria | 14315 |
| 467 | Ga0395905_0000657 | 3300037471 | Bacteria | 45935 |
| 468 | Ga0395905_0011513 | 3300037471 | Bacteria | 8547 |
| 469 | Ga0316581_0000650 | 3300037588 | Bacteria | 6981 |
| 470 | Ga0316581_0007426 | 3300037588 | Bacteria | 2941 |
| 471 | Ga0316581_0022060 | 3300037588 | Bacteria | 1876 |
| 472 | Ga0316581_0055891 | 3300037588 | Bacteria | 1210 |
| 473 | Ga0436364_0082894 | 3300037853 | Bacteria | 2473 |
| 474 | Ga0436364_0273847 | 3300037853 | Bacteria | 5705 |
| 475 | Ga0395901_0000006 | 3300038443 | Bacteria | 514112 |
| 476 | Ga0395901_0017081 | 3300038443 | Bacteria | 7397 |
| 477 | Ga0395901_0017721 | 3300038443 | Bacteria | 7270 |
| 478 | Ga0395901_0019234 | 3300038443 | Bacteria | 6983 |
| 479 | Ga0395901_0034900 | 3300038443 | Bacteria | 5195 |
| 480 | Ga0400484_03334 | 3300038725 | Bacteria | 3005 |
| 481 | Ga0400484_40207 | 3300038725 | Bacteria | 8711 |
| 482 | Ga0400490_41921 | 3300038726 | Bacteria | 7533 |
| 483 | Ga0400483_150426 | 3300039062 | Bacteria | 2629 |
| 484 | Ga0400483_184323 | 3300039062 | Bacteria | 2835 |
| 485 | Ga0400483_203392 | 3300039062 | Bacteria | 5028 |
| 486 | Ga0400489_62630 | 3300039093 | Bacteria | 16168 |
| 487 | Ga0436360_1174518 | 3300039438 | Bacteria | 3461 |
| 488 | Ga0436363_0170025 | 3300039450 | Bacteria | 8219 |
| 489 | Ga0436363_0787171 | 3300039450 | Bacteria | 2622 |
| 490 | Ga0436362_0411973 | 3300039453 | Bacteria | 2758 |
| 491 | Ga0436362_0702278 | 3300039453 | Bacteria | 2332 |
| 492 | Ga0436362_0987544 | 3300039453 | Bacteria | 1427 |
| 493 | Ga0439438_005445 | 3300041405 | Bacteria | 4681 |
| 494 | Ga0439447_008552 | 3300041407 | Bacteria | 3165 |
| 495 | Ga0439461_0001436 | 3300041410 | Bacteria | 3679 |
| 496 | Ga0439461_0002116 | 3300041410 | Bacteria | 3142 |
| 497 | Ga0439466_0018840 | 3300041411 | Bacteria | 2473 |
| 498 | Ga0439432_001429 | 3300042006 | Bacteria | 8986 |
| 499 | Ga0439452_011374 | 3300042010 | Bacteria | 2560 |
| 500 | Ga0439463_016076 | 3300042016 | Bacteria | 1851 |
| 501 | Ga0439446_0012241 | 3300042156 | Bacteria | 2341 |
| 502 | Ga0439434_0009853 | 3300042435 | Bacteria | 2811 |
| 503 | Ga0439464_0000005 | 3300042439 | Bacteria | 45669 |
| 504 | Ga0451577_0003336 | 3300042876 | Bacteria | 18010 |
| 505 | Ga0451577_0003347 | 3300042876 | Bacteria | 17951 |
| 506 | Ga0451577_0005505 | 3300042876 | Bacteria | 12949 |
| 507 | Ga0451577_0006411 | 3300042876 | Bacteria | 11744 |
| 508 | Ga0451577_0051406 | 3300042876 | Bacteria | 3679 |
| 509 | Ga0451577_0061329 | 3300042876 | Bacteria | 3353 |
| 510 | Ga0451577_0122329 | 3300042876 | Bacteria | 2331 |
| 511 | Ga0451577_0190190 | 3300042876 | Bacteria | 1851 |
| 512 | Ga0451577_0219240 | 3300042876 | Bacteria | 1719 |
| 513 | Ga0451577_0286263 | 3300042876 | Bacteria | 1493 |
| 514 | Ga0453683_0000001 | 3300044673 | Bacteria | 1384965 |
| 515 | Ga0453683_0000006 | 3300044673 | Bacteria | 586638 |
| 516 | Ga0453683_0000012 | 3300044673 | Bacteria | 376341 |
| 517 | Ga0453683_0002267 | 3300044673 | Bacteria | 15193 |
| 518 | Ga0453683_0004035 | 3300044673 | Bacteria | 10578 |
| 519 | Ga0453683_0007613 | 3300044673 | Bacteria | 7334 |
| 520 | Ga0453683_0012486 | 3300044673 | Bacteria | 5566 |
| 521 | Ga0453683_0043974 | 3300044673 | Bacteria | 2802 |
| 522 | Ga0453683_0114676 | 3300044673 | Bacteria | 1695 |
| 523 | Ga0453683_0185910 | 3300044673 | Bacteria | 1318 |
| 524 | Ga0466963_0027972 | 3300044694 | Bacteria | 3615 |
| 525 | Ga0466963_0035342 | 3300044694 | Bacteria | 3255 |
| 526 | Ga0453684_0000041 | 3300044712 | Bacteria | 690022 |
| 527 | Ga0453684_0000055 | 3300044712 | Bacteria | 532014 |
| 528 | Ga0453684_0000318 | 3300044712 | Bacteria | 203553 |
| 529 | Ga0453684_0000505 | 3300044712 | Bacteria | 152407 |
| 530 | Ga0453684_0000548 | 3300044712 | Bacteria | 142109 |
| 531 | Ga0453684_0000763 | 3300044712 | Bacteria | 111862 |
| 532 | Ga0453684_0001495 | 3300044712 | Bacteria | 65841 |
| 533 | Ga0453684_0003175 | 3300044712 | Bacteria | 37731 |
| 534 | Ga0453684_0003680 | 3300044712 | Bacteria | 34010 |
| 535 | Ga0453684_0005515 | 3300044712 | Bacteria | 24970 |
| 536 | Ga0453684_0006071 | 3300044712 | Bacteria | 23344 |
| 537 | Ga0453684_0006242 | 3300044712 | Bacteria | 22837 |
| 538 | Ga0453684_0006753 | 3300044712 | Bacteria | 21593 |
| 539 | Ga0453684_0010308 | 3300044712 | Bacteria | 16004 |
| 540 | Ga0453684_0012287 | 3300044712 | Bacteria | 14173 |
| 541 | Ga0453684_0012937 | 3300044712 | Bacteria | 13663 |
| 542 | Ga0453684_0015120 | 3300044712 | Bacteria | 12246 |
| 543 | Ga0453684_0015944 | 3300044712 | Bacteria | 11815 |
| 544 | Ga0453684_0052906 | 3300044712 | Bacteria | 5304 |
| 545 | Ga0453684_0056174 | 3300044712 | Bacteria | 5109 |
| 546 | Ga0453684_0083223 | 3300044712 | Bacteria | 3983 |
| 547 | Ga0453684_0103885 | 3300044712 | Bacteria | 3470 |
| 548 | Ga0453684_0108890 | 3300044712 | Bacteria | 3371 |
| 549 | Ga0453684_0137737 | 3300044712 | Bacteria | 2919 |
| 550 | Ga0453684_0149919 | 3300044712 | Bacteria | 2773 |
| 551 | Ga0453684_0161821 | 3300044712 | Bacteria | 2646 |
| 552 | Ga0453684_0180571 | 3300044712 | Bacteria | 2478 |
| 553 | Ga0453684_0218393 | 3300044712 | Bacteria | 2210 |
| 554 | Ga0453684_0362184 | 3300044712 | Bacteria | 1632 |
| 555 | Ga0453684_0393530 | 3300044712 | Bacteria | 1553 |
| 556 | Ga0453684_0437803 | 3300044712 | Bacteria | 1457 |
| 557 | Ga0453684_0484016 | 3300044712 | Bacteria | 1372 |
| 558 | Ga0453684_0533426 | 3300044712 | Bacteria | 1295 |
| 559 | Ga0453684_0582136 | 3300044712 | Bacteria | 1229 |
| 560 | Ga0453684_0767322 | 3300044712 | Bacteria | 1042 |
| 561 | Ga0466971_0026847 | 3300044719 | Bacteria | 2576 |
| 562 | Ga0466959_0015089 | 3300045049 | Bacteria | 5628 |
| 563 | Ga0451576_0000008 | 3300045051 | Bacteria | 746156 |
| 564 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 565 | Ga0451576_0000026 | 3300045051 | Bacteria | 427585 |
| 566 | Ga0451576_0000038 | 3300045051 | Bacteria | 369709 |
| 567 | Ga0451576_0000048 | 3300045051 | Unclassified | 325145 |
| 568 | Ga0451576_0000054 | 3300045051 | Bacteria | 308162 |
| 569 | Ga0451576_0000142 | 3300045051 | Bacteria | 181506 |
| 570 | Ga0451576_0004232 | 3300045051 | Bacteria | 18845 |
| 571 | Ga0451576_0006528 | 3300045051 | Bacteria | 14273 |
| 572 | Ga0451576_0006943 | 3300045051 | Bacteria | 13709 |
| 573 | Ga0451576_0010423 | 3300045051 | Bacteria | 10663 |
| 574 | Ga0451576_0020602 | 3300045051 | Bacteria | 7176 |
| 575 | Ga0451576_0025596 | 3300045051 | Bacteria | 6356 |
| 576 | Ga0451576_0034858 | 3300045051 | Bacteria | 5343 |
| 577 | Ga0451576_0036412 | 3300045051 | Bacteria | 5217 |
| 578 | Ga0451576_0067571 | 3300045051 | Bacteria | 3721 |
| 579 | Ga0451576_0104691 | 3300045051 | Bacteria | 2943 |
| 580 | Ga0451576_0180271 | 3300045051 | Bacteria | 2205 |
| 581 | Ga0451576_0412618 | 3300045051 | Bacteria | 1416 |
| 582 | Ga0451576_0449187 | 3300045051 | Bacteria | 1353 |
| 583 | Ga0495629_0018692 | 3300046459 | Bacteria | 4954 |
| 584 | Ga0495629_0135179 | 3300046459 | Bacteria | 1717 |
| 585 | Ga0495638_0000061 | 3300046460 | Bacteria | 188551 |
| 586 | Ga0495638_0000167 | 3300046460 | Bacteria | 102139 |
| 587 | Ga0495650_0000467 | 3300046471 | Bacteria | 62422 |
| 588 | Ga0495596_0008118 | 3300046500 | Bacteria | 4688 |
| 589 | Ga0495583_0017674 | 3300046506 | Bacteria | 3780 |
| 590 | Ga0495648_0000166 | 3300046524 | Bacteria | 77879 |
| 591 | Ga0495663_0003723 | 3300046525 | Bacteria | 4359 |
| 592 | Ga0495622_0000008 | 3300046557 | Bacteria | 232461 |
| 593 | Ga0495668_0000261 | 3300046616 | Bacteria | 74577 |
| 594 | Ga0495625_0002648 | 3300046660 | Bacteria | 19090 |
| 595 | Ga0495659_0001994 | 3300046664 | Bacteria | 6705 |
| 596 | Ga0495659_0013183 | 3300046664 | Bacteria | 2689 |
| 597 | Ga0495659_0040264 | 3300046664 | Bacteria | 1664 |
| 598 | Ga0495658_0002026 | 3300046683 | Bacteria | 10311 |
| 599 | Ga0495649_0000100 | 3300046694 | Bacteria | 75606 |
| 600 | Ga0495604_0034265 | 3300047317 | Bacteria | 4018 |
| 601 | Ga0495674_0215893 | 3300047319 | Bacteria | 1587 |
| 602 | Ga0495672_0000010 | 3300047320 | Bacteria | 545038 |
| 603 | Ga0496101_0020431 | 3300048904 | Bacteria | 4533 |
| 604 | Ga0496101_0115381 | 3300048904 | Bacteria | 2026 |
| 605 | Ga0496101_0318358 | 3300048904 | Bacteria | 1220 |
| 606 | Ga0496102_0000577 | 3300048905 | Bacteria | 38948 |
| 607 | Ga0496102_0197826 | 3300048905 | Bacteria | 1894 |
| 608 | Ga0496103_0001103 | 3300048906 | Bacteria | 18811 |
| 609 | Ga0496104_0001960 | 3300048907 | Bacteria | 17821 |
| 610 | Ga0496104_0029554 | 3300048907 | Bacteria | 5084 |
| 611 | Ga0496104_0050871 | 3300048907 | Bacteria | 3909 |
| 612 | Ga0496104_0123706 | 3300048907 | Bacteria | 2483 |
| 613 | Ga0496104_0143370 | 3300048907 | Bacteria | 2295 |
| 614 | Ga0496105_0005203 | 3300048908 | Bacteria | 9856 |
| 615 | Ga0496105_0024366 | 3300048908 | Bacteria | 4916 |
| 616 | Ga0496105_0127370 | 3300048908 | Bacteria | 2099 |
| 617 | Ga0496107_0112433 | 3300048910 | Bacteria | 2002 |
| 618 | Ga0496109_0122864 | 3300048912 | Bacteria | 2419 |
| 619 | Ga0496110_0313507 | 3300048913 | Bacteria | 1428 |
| 620 | Ga0496111_0200396 | 3300048914 | Bacteria | 1484 |
| 621 | Ga0496113_0010304 | 3300048916 | Bacteria | 6176 |
| 622 | Ga0496114_0017367 | 3300048917 | Bacteria | 5806 |
| 623 | Ga0496115_0000001 | 3300048918 | Bacteria | 367230 |
| 624 | Ga0496115_0000382 | 3300048918 | Bacteria | 36611 |
| 625 | Ga0496115_0000423 | 3300048918 | Bacteria | 34595 |
| 626 | Ga0496115_0089623 | 3300048918 | Bacteria | 2512 |
| 627 | Ga0496117_0000320 | 3300048920 | Bacteria | 84189 |
| 628 | Ga0496118_0000144 | 3300048921 | Bacteria | 124411 |
| 629 | Ga0496118_0005674 | 3300048921 | Bacteria | 14069 |
| 630 | Ga0496119_0006832 | 3300048922 | Bacteria | 10460 |
| 631 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 632 | Ga0496121_0039799 | 3300048924 | Bacteria | 4134 |
| 633 | Ga0496122_0008273 | 3300048925 | Bacteria | 11281 |
| 634 | Ga0496123_0010797 | 3300048926 | Bacteria | 8014 |
| 635 | Ga0496124_0005475 | 3300048927 | Bacteria | 14262 |
| 636 | Ga0496124_0023302 | 3300048927 | Bacteria | 5654 |
| 637 | Ga0496124_0129986 | 3300048927 | Bacteria | 2002 |
| 638 | Ga0496126_0000505 | 3300048929 | Bacteria | 76567 |
| 639 | Ga0496126_0000696 | 3300048929 | Bacteria | 61450 |
| 640 | Ga0496126_0071597 | 3300048929 | Bacteria | 3086 |
| 641 | Ga0501031_0000777 | 3300049568 | Bacteria | 19155 |
| 642 | Ga0501032_0000641 | 3300049569 | Bacteria | 28409 |
| 643 | Ga0501034_0000028 | 3300049571 | Bacteria | 255803 |
| 644 | Ga0501034_0001066 | 3300049571 | Bacteria | 38868 |
| 645 | Ga0501034_0001383 | 3300049571 | Bacteria | 32637 |
| 646 | Ga0501034_0175821 | 3300049571 | Bacteria | 2107 |
| 647 | Ga0501034_0422894 | 3300049571 | Bacteria | 1253 |
| 648 | Ga0501036_0001678 | 3300049572 | Bacteria | 17176 |
| 649 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 650 | Ga0501037_0000138 | 3300049573 | Bacteria | 68040 |
| 651 | Ga0501038_0000863 | 3300049574 | Bacteria | 26878 |
| 652 | Ga0501038_0061888 | 3300049574 | Bacteria | 3200 |
| 653 | Ga0501042_0145426 | 3300049578 | Bacteria | 1709 |
| 654 | Ga0501043_0000062 | 3300049579 | Bacteria | 95664 |
| 655 | Ga0501046_0000059 | 3300049580 | Bacteria | 126801 |
| 656 | Ga0501047_0000032 | 3300049581 | Bacteria | 208294 |
| 657 | Ga0501047_0033489 | 3300049581 | Bacteria | 4960 |
| 658 | Ga0501047_0141318 | 3300049581 | Bacteria | 2286 |
| 659 | Ga0501048_0000001 | 3300049582 | Bacteria | 132132 |
| 660 | Ga0501070_0066407 | 3300049586 | Bacteria | 2987 |
| 661 | Ga0501072_0067678 | 3300049588 | Bacteria | 2818 |
| 662 | Ga0501072_0240505 | 3300049588 | Bacteria | 1442 |
| 663 | Ga0501075_0300726 | 3300049591 | Bacteria | 1223 |
| 664 | Ga0501076_0049781 | 3300049592 | Bacteria | 3314 |
| 665 | Ga0501076_0103933 | 3300049592 | Bacteria | 2291 |
| 666 | Ga0501076_0204966 | 3300049592 | Bacteria | 1611 |
| 667 | Ga0501079_0010737 | 3300049741 | Bacteria | 6974 |
| 668 | Ga0501080_0020371 | 3300049742 | Bacteria | 6138 |
| 669 | Ga0501083_0002809 | 3300049744 | Bacteria | 12017 |
| 670 | Ga0501035_0001735 | 3300049822 | Bacteria | 22038 |
| 671 | Ga0501044_0032556 | 3300049823 | Bacteria | 5480 |
| 672 | Ga0501045_0069229 | 3300049824 | Bacteria | 2594 |
| 673 | nmdc:mga03683_209_c1 | 3300050489 | Bacteria | 19230 |
| 674 | nmdc:mga03683_3956_c2 | 3300050489 | Bacteria | 4539 |
| 675 | nmdc:mga03n38_11_c1 | 3300050490 | Bacteria | 47454 |
| 676 | nmdc:mga00v17_13247_c1 | 3300050491 | Bacteria | 4571 |
| 677 | nmdc:mga00v17_143_c1 | 3300050491 | Bacteria | 41277 |
| 678 | nmdc:mga00v17_201301_c1 | 3300050491 | Bacteria | 1287 |
| 679 | nmdc:mga00v17_3385_c2 | 3300050491 | Bacteria | 5944 |
| 680 | nmdc:mga00v17_40179_c1 | 3300050491 | Bacteria | 2805 |
| 681 | nmdc:mga00v17_96758_c1 | 3300050491 | Bacteria | 1860 |
| 682 | nmdc:mga0yw44_12970_c1 | 3300050492 | Bacteria | 3947 |
| 683 | nmdc:mga0yw44_14_c1 | 3300050492 | Bacteria | 86738 |
| 684 | nmdc:mga0yw44_296_c1 | 3300050492 | Bacteria | 17171 |
| 685 | nmdc:mga0yw44_4033_c1 | 3300050492 | Bacteria | 6645 |
| 686 | nmdc:mga0yw44_4_c1 | 3300050492 | Bacteria | 450247 |
| 687 | nmdc:mga0yw44_8_c1 | 3300050492 | Bacteria | 237802 |
| 688 | nmdc:mga0k408_164_c1 | 3300050493 | Bacteria | 20604 |
| 689 | nmdc:mga0k408_194276_c1 | 3300050493 | Bacteria | 1211 |
| 690 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 691 | nmdc:mga0k408_29_c1 | 3300050493 | Bacteria | 89645 |
| 692 | nmdc:mga0k408_6447_c1 | 3300050493 | Bacteria | 6258 |
| 693 | nmdc:mga0k408_69_c2 | 3300050493 | Bacteria | 50340 |
| 694 | nmdc:mga0k408_924_c1 | 3300050493 | Bacteria | 16077 |
| 695 | nmdc:mga06z11_483_c1 | 3300050494 | Bacteria | 14692 |
| 696 | nmdc:mga06z11_5_c1 | 3300050494 | Bacteria | 61643 |
| 697 | nmdc:mga04h51_7988_c1 | 3300050495 | Bacteria | 2817 |
| 698 | nmdc:mga04h51_9_c1 | 3300050495 | Bacteria | 107099 |
| 699 | nmdc:mga07m45_1009_c1 | 3300050496 | Bacteria | 12437 |
| 700 | nmdc:mga07m45_1611_c1 | 3300050496 | Bacteria | 10390 |
| 701 | nmdc:mga07m45_31_c1 | 3300050496 | Bacteria | 81959 |
| 702 | nmdc:mga07m45_36150_c1 | 3300050496 | Bacteria | 2750 |
| 703 | nmdc:mga07m45_73623_c1 | 3300050496 | Bacteria | 1945 |
| 704 | nmdc:mga05p37_107395_c1 | 3300050507 | Bacteria | 3434 |
| 705 | nmdc:mga05p37_145822_c1 | 3300050507 | Bacteria | 2899 |
| 706 | nmdc:mga05p37_164535_c1 | 3300050507 | Bacteria | 2708 |
| 707 | nmdc:mga05p37_289387_c1 | 3300050507 | Bacteria | 1950 |
| 708 | nmdc:mga05p37_39914_c1 | 3300050507 | Bacteria | 5764 |
| 709 | nmdc:mga05p37_6974_c1 | 3300050507 | Bacteria | 13317 |
| 710 | nmdc:mga09592_10685_c1 | 3300050508 | Bacteria | 7473 |
| 711 | nmdc:mga09592_304400_c1 | 3300050508 | Bacteria | 1382 |
| 712 | nmdc:mga09592_73388_c1 | 3300050508 | Bacteria | 2907 |
| 713 | nmdc:mga09592_8433_c1 | 3300050508 | Bacteria | 8378 |
| 714 | nmdc:mga0qj67_1812_c1 | 3300050509 | Bacteria | 15112 |
| 715 | nmdc:mga06r32_3537_c1 | 3300050510 | Bacteria | 13956 |
| 716 | nmdc:mga08y16_1493_c1 | 3300050511 | Bacteria | 22465 |
| 717 | nmdc:mga08y16_218815_c1 | 3300050511 | Bacteria | 1972 |
| 718 | nmdc:mga0n895_82487_c1 | 3300050512 | Bacteria | 3205 |
| 719 | nmdc:mga0a205_303244_c1 | 3300050515 | Bacteria | 1470 |
| 720 | nmdc:mga0sz30_3_c4 | 3300050516 | Bacteria | 4873 |
| 721 | Ga0500610_0000389 | 3300053079 | Bacteria | 13347 |
| 722 | Ga0495619_0000084 | 3300053085 | Bacteria | 70164 |
| 723 | Ga0500643_000034 | 3300053087 | Bacteria | 185705 |
| 724 | Ga0500643_000495 | 3300053087 | Bacteria | 28427 |
| 725 | Ga0500644_0008364 | 3300053088 | Bacteria | 2730 |
| 726 | Ga0500583_0007071 | 3300053092 | Bacteria | 3918 |
| 727 | Ga0500583_0008403 | 3300053092 | Bacteria | 3703 |
| 728 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 729 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 730 | Ga0500555_000009 | 3300053103 | Bacteria | 263998 |
| 731 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 732 | Ga0500569_000001 | 3300053109 | Bacteria | 137852 |
| 733 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 734 | Ga0500593_027461 | 3300053117 | Bacteria | 2540 |
| 735 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 736 | Ga0500642_0123628 | 3300053130 | Bacteria | 1211 |
| 737 | Ga0500655_000483 | 3300053133 | Bacteria | 8070 |
| 738 | Ga0500559_0021462 | 3300053136 | Bacteria | 2737 |
| 739 | Ga0500561_0000002 | 3300053137 | Bacteria | 394147 |
| 740 | Ga0500568_0003924 | 3300053139 | Bacteria | 8098 |
| 741 | Ga0500577_0003518 | 3300053142 | Bacteria | 4070 |
| 742 | Ga0500588_0000027 | 3300053146 | Bacteria | 35097 |
| 743 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 744 | Ga0500616_0023868 | 3300053153 | Bacteria | 3403 |
| 745 | Ga0500616_0026398 | 3300053153 | Bacteria | 3215 |
| 746 | Ga0500616_0086596 | 3300053153 | Bacteria | 1562 |
| 747 | Ga0500649_000039 | 3300053722 | Bacteria | 15061 |
| 748 | Ga0500611_000481 | 3300053727 | Bacteria | 4036 |
| 749 | Ga0500611_002005 | 3300053727 | Bacteria | 2365 |
| 750 | Ga0500645_000062 | 3300053730 | Bacteria | 85561 |
| 751 | Ga0501084_0009937 | 3300054114 | Bacteria | 7866 |
| 752 | Ga0501084_0016042 | 3300054114 | Bacteria | 6217 |
| 753 | Ga0501084_0084007 | 3300054114 | Bacteria | 2673 |
| 754 | Ga0501084_0140552 | 3300054114 | Bacteria | 2033 |
| 755 | Ga0501084_0266423 | 3300054114 | Bacteria | 1446 |
| 756 | 2512734540 | 2512564039 | Bacteria | 8739048 |
| 757 | 2600226200 | 2599185359 | Bacteria | 4772316 |
| 758 | 2819712753 | 2818991466 | Bacteria | 4748179 |
| 759 | 2864997678 | 2864997549 | Bacteria | 5139696 |
| 760 | 2865006008 | 2865002811 | Bacteria | 6333767 |
| 761 | 2879166984 | 2879163058 | Bacteria | 4223965 |
| 762 | 2928102683 | 2928100450 | Bacteria | 4837635 |
| 763 | 2928527354 | 2928526807 | Bacteria | 4760224 |
| 764 | 2928969165 | 2928968154 | Bacteria | 4633371 |
| 765 | 8007376455 | 8007375930 | Bacteria | 4080554 |
| 766 | 8022893510 | 8022893055 | Bacteria | 5300455 |
| 767 | 8057978663 | 8057977335 | Bacteria | 5694872 |
| 768 | Ga0501084_0002155 | |||
| 769 | SwRhRL2b_contig_2039187 | |||
| 770 | JGI24741J21665_1000172 | |||
| 771 | JGI24741J21665_1000432 | |||
| 772 | JGI24740J21852_10006184 | |||
| 773 | JGI24740J21852_10008985 | |||
| 774 | JGI24739J22299_10002774 | |||
| 775 | JGI24739J22299_10003084 | |||
| 776 | JGI24737J22298_10000010 | |||
| 777 | JGI24737J22298_10000043 | |||
| 778 | JGI24743J22301_10001560 | |||
| 779 | JGI24735J21928_10000052 | |||
| 780 | JGI24735J21928_10000104 | |||
| 781 | JGI24738J21930_10000355 | |||
| 782 | JGI24738J21930_10008934 | |||
| 783 | JGI24033J26618_1000732 | |||
| 784 | JGI25150J39212_1000657 | |||
| 785 | JGI25151J46595_10029487 | |||
| 786 | JGI25406J46586_10026712 | |||
| 787 | JGI25153J46596_10000266 | |||
| 788 | rootH1_10009329 | |||
| 789 | rootH2_10006821 | |||
| 790 | rootH1_10012137 | |||
| 791 | Ga0055526_1006177 | |||
| 792 | Ga0055540_1000692 | |||
| 793 | Ga0065704_10000250 | |||
| 794 | Ga0065704_10000296 | |||
| 795 | Ga0065712_10160842 | |||
| 796 | Ga0065707_10082246 | |||
| 797 | Ga0065707_10105175 | |||
| 798 | Ga0070658_10000009 | |||
| 799 | Ga0070658_10000110 | |||
| 800 | Ga0070658_10000385 | |||
| 801 | Ga0070683_100000184 | |||
| 802 | Ga0070683_100063971 | |||
| 803 | Ga0070683_100113090 | |||
| 804 | Ga0070690_100015025 | |||
| 805 | Ga0070670_100115038 | |||
| 806 | Ga0070666_10095755 | |||
| 807 | Ga0070680_100244075 | |||
| 808 | Ga0070660_100010369 | |||
| 809 | Ga0070660_100183842 | |||
| 810 | Ga0070669_100000068 | |||
| 811 | Ga0070675_100115022 | |||
| 812 | Ga0070671_100000001 | |||
| 813 | Ga0070671_100001336 | |||
| 814 | Ga0070674_100046632 | |||
| 815 | Ga0070659_100012416 | |||
| 816 | Ga0070667_100000001 | |||
| 817 | Ga0070667_100000157 | |||
| 818 | Ga0070667_100006733 | |||
| 819 | Ga0070667_100019440 | |||
| 820 | Ga0070667_100044275 | |||
| 821 | Ga0070714_100000082 | |||
| 822 | Ga0070714_100001000 | |||
| 823 | Ga0070714_100031012 | |||
| 824 | Ga0070713_100051150 | |||
| 825 | Ga0070713_100059589 | |||
| 826 | Ga0070713_100129400 | |||
| 827 | Ga0070713_100264606 | |||
| 828 | Ga0070701_10161699 | |||
| 829 | Ga0070694_100198343 | |||
| 830 | Ga0070708_100000018 | |||
| 831 | Ga0070708_100004468 | |||
| 832 | Ga0070708_100084659 | |||
| 833 | Ga0070708_100089745 | |||
| 834 | Ga0070708_100130313 | |||
| 835 | Ga0070678_100000104 | |||
| 836 | Ga0070678_100015475 | |||
| 837 | Ga0070662_100006047 | |||
| 838 | Ga0070681_10160778 | |||
| 839 | Ga0070706_100000026 | |||
| 840 | Ga0070706_100000548 | |||
| 841 | Ga0070706_100006587 | |||
| 842 | Ga0070706_100088844 | |||
| 843 | Ga0070706_100143741 | |||
| 844 | Ga0070706_100164761 | |||
| 845 | Ga0070707_100000004 | |||
| 846 | Ga0070707_100000434 | |||
| 847 | Ga0070707_100002828 | |||
| 848 | Ga0070707_100006967 | |||
| 849 | Ga0070707_100027594 | |||
| 850 | Ga0070707_100066689 | |||
| 851 | Ga0070707_100183776 | |||
| 852 | Ga0070698_100003377 | |||
| 853 | Ga0070698_100004957 | |||
| 854 | Ga0070698_100015120 | |||
| 855 | Ga0070699_100000042 | |||
| 856 | Ga0070699_100005835 | |||
| 857 | Ga0070699_100050609 | |||
| 858 | Ga0070699_100064723 | |||
| 859 | Ga0070679_100016249 | |||
| 860 | Ga0070679_100056515 | |||
| 861 | Ga0070684_100000345 | |||
| 862 | Ga0070697_100000006 | |||
| 863 | Ga0070697_100003316 | |||
| 864 | Ga0070697_100060273 | |||
| 865 | Ga0070697_100184769 | |||
| 866 | Ga0070695_100145339 | |||
| 867 | Ga0070696_100080143 | |||
| 868 | Ga0070665_100000086 | |||
| 869 | Ga0070665_100007667 | |||
| 870 | Ga0070704_100026011 | |||
| 871 | Ga0068855_100000002 | |||
| 872 | Ga0068855_100000005 | |||
| 873 | Ga0068855_100007933 | |||
| 874 | Ga0068855_100062267 | |||
| 875 | Ga0070664_100000721 | |||
| 876 | Ga0070664_100026141 | |||
| 877 | Ga0068857_100000057 | |||
| 878 | Ga0068857_100000066 | |||
| 879 | Ga0068857_100040042 | |||
| 880 | Ga0068857_100271286 | |||
| 881 | Ga0068857_100277832 | |||
| 882 | Ga0068856_100000029 | |||
| 883 | Ga0068856_100000122 | |||
| 884 | Ga0068856_100203100 | |||
| 885 | Ga0068856_100543657 | |||
| 886 | Ga0070702_100139784 | |||
| 887 | Ga0068852_100000001 | |||
| 888 | Ga0068852_100000011 | |||
| 889 | Ga0068859_100213391 | |||
| 890 | Ga0068864_100152392 | |||
| 891 | Ga0068866_10029123 | |||
| 892 | Ga0068860_100008228 | |||
| 893 | Ga0068860_100119400 | |||
| 894 | Ga0068862_100021245 | |||
| 895 | Ga0068862_100317353 | |||
| 896 | Ga0081455_10000008 | |||
| 897 | Ga0081538_10000568 | |||
| 898 | Ga0081538_10001762 | |||
| 899 | Ga0081538_10088914 | |||
| 900 | Ga0081539_10000597 | |||
| 901 | Ga0081539_10005727 | |||
| 902 | Ga0070717_10002899 | |||
| 903 | Ga0070717_10046717 | |||
| 904 | Ga0075365_10000083 | |||
| 905 | Ga0075365_10000103 | |||
| 906 | Ga0075365_10001489 | |||
| 907 | Ga0075365_10005957 | |||
| 908 | Ga0075365_10022550 | |||
| 909 | Ga0075365_10023067 | |||
| 910 | Ga0075365_10031136 | |||
| 911 | Ga0075368_10000052 | |||
| 912 | Ga0075368_10000058 | |||
| 913 | Ga0075363_100000017 | |||
| 914 | Ga0075363_100052852 | |||
| 915 | Ga0075364_10000818 | |||
| 916 | Ga0075364_10001226 | |||
| 917 | Ga0075364_10005917 | |||
| 918 | Ga0075364_10009157 | |||
| 919 | Ga0075367_10000026 | |||
| 920 | Ga0075367_10004148 | |||
| 921 | Ga0075369_10005866 | |||
| 922 | Ga0075427_10000444 | |||
| 923 | Ga0075366_10000002 | |||
| 924 | Ga0075366_10000007 | |||
| 925 | Ga0075366_10000028 | |||
| 926 | Ga0075366_10000695 | |||
| 927 | Ga0075366_10006952 | |||
| 928 | Ga0075366_10008696 | |||
| 929 | Ga0075366_10208846 | |||
| 930 | Ga0097621_100060979 | |||
| 931 | Ga0075370_10000025 | |||
| 932 | Ga0075370_10002100 | |||
| 933 | Ga0075370_10024603 | |||
| 934 | Ga0068871_100038215 | |||
| 935 | Ga0075428_100000608 | |||
| 936 | Ga0075428_100004454 | |||
| 937 | Ga0075428_100325265 | |||
| 938 | Ga0075428_100461906 | |||
| 939 | Ga0075430_100002441 | |||
| 940 | Ga0075431_100018973 | |||
| 941 | Ga0075431_100208585 | |||
| 942 | Ga0075434_100052531 | |||
| 943 | Ga0075429_100028737 | |||
| 944 | Ga0075429_100085547 | |||
| 945 | Ga0075429_100301891 | |||
| 946 | Ga0068865_100007409 | |||
| 947 | Ga0097620_100001903 | |||
| 948 | Ga0097620_100213392 | |||
| 949 | Ga0079104_1020960 | |||
| 950 | Ga0105240_10000554 | |||
| 951 | Ga0105240_10002029 | |||
| 952 | Ga0105240_10016535 | |||
| 953 | Ga0105240_10026773 | |||
| 954 | Ga0111539_10065395 | |||
| 955 | Ga0111539_10183257 | |||
| 956 | Ga0111539_10460569 | |||
| 957 | Ga0105245_10014297 | |||
| 958 | Ga0105247_10041511 | |||
| 959 | Ga0114129_10000238 | |||
| 960 | Ga0114129_10008060 | |||
| 961 | Ga0114129_10012935 | |||
| 962 | Ga0114129_10020433 | |||
| 963 | Ga0114129_10083569 | |||
| 964 | Ga0114129_10088530 | |||
| 965 | Ga0114129_10107423 | |||
| 966 | Ga0114129_10126724 | |||
| 967 | Ga0105243_10000202 | |||
| 968 | Ga0105241_10216967 | |||
| 969 | Ga0105242_10093166 | |||
| 970 | Ga0105248_10003194 | |||
| 971 | Ga0105237_10000002 | |||
| 972 | Ga0105237_10003197 | |||
| 973 | Ga0105238_10005238 | |||
| 974 | Ga0105238_10020637 | |||
| 975 | Ga0105238_10131474 | |||
| 976 | Ga0105238_10137152 | |||
| 977 | Ga0105249_10032980 | |||
| 978 | Ga0105249_10161045 | |||
| 979 | Ga0105032_100002 | |||
| 980 | Ga0105032_100013 | |||
| 981 | Ga0105032_102837 | |||
| 982 | Ga0105029_100084 | |||
| 983 | Ga0105033_100015 | |||
| 984 | Ga0105030_101827 | |||
| 985 | Ga0105239_10001282 | |||
| 986 | Ga0105239_10001890 | |||
| 987 | Ga0105246_10000260 | |||
| 988 | Ga0105246_10002918 | |||
| 989 | Ga0105246_10005815 | |||
| 990 | Ga0157373_10006247 | |||
| 991 | Ga0157373_10008975 | |||
| 992 | Ga0157373_10083103 | |||
| 993 | Ga0157371_10000024 | |||
| 994 | Ga0157371_10047312 | |||
| 995 | Ga0157370_10001378 | |||
| 996 | Ga0157370_10033569 | |||
| 997 | Ga0157370_10065233 | |||
| 998 | Ga0157370_10475909 | |||
| 999 | Ga0157369_10000026 | |||
| 1000 | Ga0157369_10000634 | |||
| 1001 | Ga0157369_10019267 | |||
| 1002 | Ga0157374_10000709 | |||
| 1003 | Ga0157374_10025003 | |||
| 1004 | Ga0163162_10033432 | |||
| 1005 | Ga0157372_10000106 | |||
| 1006 | Ga0157372_10135225 | |||
| 1007 | Ga0157372_10191699 | |||
| 1008 | Ga0157372_10329715 | |||
| 1009 | Ga0157514_104927 | |||
| 1010 | Ga0163163_10178269 | |||
| 1011 | Ga0157380_10089451 | |||
| 1012 | Ga0157377_10000373 | |||
| 1013 | Ga0157376_10000085 | |||
| 1014 | Ga0157376_10007264 | |||
| 1015 | Ga0197907_10284452 | |||
| 1016 | Ga0213873_10005067 | |||
| 1017 | Ga0213872_10087167 | |||
| 1018 | Ga0213874_10003975 | |||
| 1019 | Ga0224712_10122007 | |||
| 1020 | Ga0207425_1000114 | |||
| 1021 | Ga0209129_1003213 | |||
| 1022 | Ga0209676_1000211 | |||
| 1023 | Ga0209676_1012541 | |||
| 1024 | Ga0209025_1007905 | |||
| 1025 | Ga0209025_1007934 | |||
| 1026 | Ga0209758_1000004 | |||
| 1027 | Ga0209050_1000001 | |||
| 1028 | Ga0209050_1000047 | |||
| 1029 | Ga0209050_1005259 | |||
| 1030 | Ga0207426_1018413 | |||
| 1031 | Ga0209051_1000336 | |||
| 1032 | Ga0209257_1000076 | |||
| 1033 | Ga0209257_1001103 | |||
| 1034 | Ga0207696_1007348 | |||
| 1035 | Ga0207713_1007508 | |||
| 1036 | Ga0207680_10105462 | |||
| 1037 | Ga0207647_10001626 | |||
| 1038 | Ga0207647_10003940 | |||
| 1039 | Ga0207705_10000010 | |||
| 1040 | Ga0207705_10000227 | |||
| 1041 | Ga0207705_10000306 | |||
| 1042 | Ga0207684_10000008 | |||
| 1043 | Ga0207684_10000034 | |||
| 1044 | Ga0207684_10013352 | |||
| 1045 | Ga0207684_10078416 | |||
| 1046 | Ga0207654_10000177 | |||
| 1047 | Ga0207654_10008838 | |||
| 1048 | Ga0207654_10058914 | |||
| 1049 | Ga0207707_10018045 | |||
| 1050 | Ga0207707_10039709 | |||
| 1051 | Ga0207695_10001111 | |||
| 1052 | Ga0207695_10016819 | |||
| 1053 | Ga0207695_10042724 | |||
| 1054 | Ga0207695_10075298 | |||
| 1055 | Ga0207695_10079328 | |||
| 1056 | Ga0207695_10129115 | |||
| 1057 | Ga0207671_10000008 | |||
| 1058 | Ga0207671_10007296 | |||
| 1059 | Ga0207671_10008857 | |||
| 1060 | Ga0207693_10021160 | |||
| 1061 | Ga0207660_10024531 | |||
| 1062 | Ga0207660_10106267 | |||
| 1063 | Ga0207660_10173410 | |||
| 1064 | Ga0207662_10199988 | |||
| 1065 | Ga0207657_10041847 | |||
| 1066 | Ga0207649_10000438 | |||
| 1067 | Ga0207652_10007555 | |||
| 1068 | Ga0207646_10000018 | |||
| 1069 | Ga0207646_10000192 | |||
| 1070 | Ga0207646_10001274 | |||
| 1071 | Ga0207646_10009519 | |||
| 1072 | Ga0207646_10031330 | |||
| 1073 | Ga0207646_10037262 | |||
| 1074 | Ga0207646_10068603 | |||
| 1075 | Ga0207681_10000083 | |||
| 1076 | Ga0207694_10039392 | |||
| 1077 | Ga0207694_10113960 | |||
| 1078 | Ga0207687_10008804 | |||
| 1079 | Ga0207700_10129110 | |||
| 1080 | Ga0207700_10241241 | |||
| 1081 | Ga0207664_10000005 | |||
| 1082 | Ga0207664_10001003 | |||
| 1083 | Ga0207664_10046732 | |||
| 1084 | Ga0207664_10149295 | |||
| 1085 | Ga0207664_10231159 | |||
| 1086 | Ga0207664_10235320 | |||
| 1087 | Ga0207644_10000001 | |||
| 1088 | Ga0207644_10002137 | |||
| 1089 | Ga0207690_10005160 | |||
| 1090 | Ga0207690_10006471 | |||
| 1091 | Ga0207690_10033527 | |||
| 1092 | Ga0207706_10000004 | |||
| 1093 | Ga0207706_10192786 | |||
| 1094 | Ga0207686_10009883 | |||
| 1095 | Ga0207709_10000201 | |||
| 1096 | Ga0207709_10093789 | |||
| 1097 | Ga0207669_10000042 | |||
| 1098 | Ga0207704_10003921 | |||
| 1099 | Ga0207711_10002040 | |||
| 1100 | Ga0207661_10000117 | |||
| 1101 | Ga0207661_10003956 | |||
| 1102 | Ga0207661_10111942 | |||
| 1103 | Ga0207661_10191722 | |||
| 1104 | Ga0207661_10396337 | |||
| 1105 | Ga0207679_10000126 | |||
| 1106 | Ga0207667_10000005 | |||
| 1107 | Ga0207667_10000010 | |||
| 1108 | Ga0207667_10000027 | |||
| 1109 | Ga0207667_10007257 | |||
| 1110 | Ga0207667_10080034 | |||
| 1111 | Ga0207712_10140984 | |||
| 1112 | Ga0207712_10222550 | |||
| 1113 | Ga0207668_10019397 | |||
| 1114 | Ga0207640_10023753 | |||
| 1115 | Ga0207658_10000003 | |||
| 1116 | Ga0207658_10000941 | |||
| 1117 | Ga0207658_10017635 | |||
| 1118 | Ga0207658_10056053 | |||
| 1119 | Ga0207703_10001425 | |||
| 1120 | Ga0207703_10158088 | |||
| 1121 | Ga0207639_10346274 | |||
| 1122 | Ga0207678_10002519 | |||
| 1123 | Ga0207702_10000051 | |||
| 1124 | Ga0207702_10000431 | |||
| 1125 | Ga0207702_10019321 | |||
| 1126 | Ga0207702_10022445 | |||
| 1127 | Ga0207702_10120752 | |||
| 1128 | Ga0207702_10122889 | |||
| 1129 | Ga0207674_10000032 | |||
| 1130 | Ga0207674_10000299 | |||
| 1131 | Ga0207674_10061756 | |||
| 1132 | Ga0207683_10000067 | |||
| 1133 | Ga0207683_10043323 | |||
| 1134 | Ga0207698_10000001 | |||
| 1135 | Ga0207698_10000024 | |||
| 1136 | Ga0207698_10028119 | |||
| 1137 | Ga0209281_1008313 | |||
| 1138 | Ga0209588_1050382 | |||
| 1139 | Ga0209998_10016051 | |||
| 1140 | Ga0209813_10000008 | |||
| 1141 | Ga0268266_10000002 | |||
| 1142 | Ga0268266_10006783 | |||
| 1143 | Ga0268265_10125306 | |||
| 1144 | Ga0268264_10007078 | |||
| 1145 | Ga0268264_10028561 | |||
| 1146 | Ga0265337_1000643 | |||
| 1147 | Ga0265337_1001500 | |||
| 1148 | Ga0265326_10001451 | |||
| 1149 | Ga0265326_10004561 | |||
| 1150 | Ga0265334_10000004 | |||
| 1151 | Ga0265318_10031077 | |||
| 1152 | Ga0265336_10003070 | |||
| 1153 | Ga0307517_10042372 | |||
| 1154 | Ga0265338_10000003 | |||
| 1155 | Ga0265338_10000189 | |||
| 1156 | Ga0265338_10009651 | |||
| 1157 | Ga0265338_10023306 | |||
| 1158 | Ga0307511_10012705 | |||
| 1159 | Ga0314311_1009060 | |||
| 1160 | Ga0316179_1097059 | |||
| 1161 | Ga0316178_1074752 | |||
| 1162 | Ga0316180_1104216 | |||
| 1163 | Ga0316183_1035098 | |||
| 1164 | Ga0316183_1134592 | |||
| 1165 | Ga0316181_1116978 | |||
| 1166 | Ga0316182_1038280 | |||
| 1167 | Ga0316182_1110912 | |||
| 1168 | Ga0316182_1123588 | |||
| 1169 | Ga0265330_10042232 | |||
| 1170 | Ga0265340_10008273 | |||
| 1171 | Ga0265331_10009915 | |||
| 1172 | Ga0265327_10009859 | |||
| 1173 | Ga0265327_10011207 | |||
| 1174 | Ga0265316_10003366 | |||
| 1175 | Ga0307513_10073068 | |||
| 1176 | Ga0307509_10000584 | |||
| 1177 | Ga0307509_10002816 | |||
| 1178 | Ga0307408_100203579 | |||
| 1179 | Ga0265313_10017279 | |||
| 1180 | Ga0316575_10008136 | |||
| 1181 | Ga0316575_10041326 | |||
| 1182 | Ga0316575_10045815 | |||
| 1183 | Ga0316579_10055736 | |||
| 1184 | Ga0316579_10082603 | |||
| 1185 | Ga0265314_10114656 | |||
| 1186 | Ga0316576_10002497 | |||
| 1187 | Ga0316576_10050710 | |||
| 1188 | Ga0316576_10057465 | |||
| 1189 | Ga0316576_10061348 | |||
| 1190 | Ga0316578_10000007 | |||
| 1191 | Ga0316578_10027315 | |||
| 1192 | Ga0316578_10106336 | |||
| 1193 | Ga0307516_10106175 | |||
| 1194 | Ga0316577_10002771 | |||
| 1195 | Ga0316577_10008069 | |||
| 1196 | Ga0316577_10090201 | |||
| 1197 | Ga0307412_10007283 | |||
| 1198 | Ga0307412_10046235 | |||
| 1199 | Ga0307409_100066615 | |||
| 1200 | Ga0316585_10012623 | |||
| 1201 | Ga0316580_10029193 | |||
| 1202 | Ga0316580_10044078 | |||
| 1203 | Ga0316593_10069698 | |||
| 1204 | Ga0316593_10076388 | |||
| 1205 | Ga0316596_1046255 | |||
| 1206 | Ga0373930_0001506 | |||
| 1207 | Ga0373929_0004252 | |||
| 1208 | Ga0373929_0013123 | |||
| 1209 | Ga0316574_0009421 | |||
| 1210 | Ga0316574_0216332 | |||
| 1211 | Ga0373931_0017038 | |||
| 1212 | Ga0316582_0000419 | |||
| 1213 | Ga0316582_0003641 | |||
| 1214 | Ga0316582_0040620 | |||
| 1215 | Ga0316584_0001751 | |||
| 1216 | Ga0316584_0006450 | |||
| 1217 | Ga0316584_0008823 | |||
| 1218 | Ga0316584_0009448 | |||
| 1219 | Ga0316584_0097428 | |||
| 1220 | Ga0316584_0108735 | |||
| 1221 | Ga0316584_0126762 | |||
| 1222 | Ga0316584_0154914 | |||
| 1223 | Ga0373925_0164356 | |||
| 1224 | Ga0395899_0015610 | |||
| 1225 | Ga0395899_0045286 | |||
| 1226 | Ga0395899_0055382 | |||
| 1227 | Ga0395900_0000001 | |||
| 1228 | Ga0395900_0022488 | |||
| 1229 | Ga0395900_0215387 | |||
| 1230 | Ga0395900_0288491 | |||
| 1231 | Ga0395898_0000002 | |||
| 1232 | Ga0395898_0003669 | |||
| 1233 | Ga0395898_0005045 | |||
| 1234 | Ga0395905_0000657 | |||
| 1235 | Ga0395905_0011513 | |||
| 1236 | Ga0316581_0000650 | |||
| 1237 | Ga0316581_0007426 | |||
| 1238 | Ga0316581_0022060 | |||
| 1239 | Ga0316581_0055891 | |||
| 1240 | Ga0436364_0082894 | |||
| 1241 | Ga0436364_0273847 | |||
| 1242 | Ga0395901_0000006 | |||
| 1243 | Ga0395901_0017081 | |||
| 1244 | Ga0395901_0017721 | |||
| 1245 | Ga0395901_0019234 | |||
| 1246 | Ga0395901_0034900 | |||
| 1247 | Ga0400484_03334 | |||
| 1248 | Ga0400484_40207 | |||
| 1249 | Ga0400490_41921 | |||
| 1250 | Ga0400483_150426 | |||
| 1251 | Ga0400483_184323 | |||
| 1252 | Ga0400483_203392 | |||
| 1253 | Ga0400489_62630 | |||
| 1254 | Ga0436360_1174518 | |||
| 1255 | Ga0436363_0170025 | |||
| 1256 | Ga0436363_0787171 | |||
| 1257 | Ga0436362_0411973 | |||
| 1258 | Ga0436362_0702278 | |||
| 1259 | Ga0436362_0987544 | |||
| 1260 | Ga0439438_005445 | |||
| 1261 | Ga0439447_008552 | |||
| 1262 | Ga0439461_0001436 | |||
| 1263 | Ga0439461_0002116 | |||
| 1264 | Ga0439466_0018840 | |||
| 1265 | Ga0439432_001429 | |||
| 1266 | Ga0439452_011374 | |||
| 1267 | Ga0439463_016076 | |||
| 1268 | Ga0439446_0012241 | |||
| 1269 | Ga0439434_0009853 | |||
| 1270 | Ga0439464_0000005 | |||
| 1271 | Ga0451577_0003336 | |||
| 1272 | Ga0451577_0003347 | |||
| 1273 | Ga0451577_0005505 | |||
| 1274 | Ga0451577_0006411 | |||
| 1275 | Ga0451577_0051406 | |||
| 1276 | Ga0451577_0061329 | |||
| 1277 | Ga0451577_0122329 | |||
| 1278 | Ga0451577_0190190 | |||
| 1279 | Ga0451577_0219240 | |||
| 1280 | Ga0451577_0286263 | |||
| 1281 | Ga0453683_0000001 | |||
| 1282 | Ga0453683_0000006 | |||
| 1283 | Ga0453683_0000012 | |||
| 1284 | Ga0453683_0002267 | |||
| 1285 | Ga0453683_0004035 | |||
| 1286 | Ga0453683_0007613 | |||
| 1287 | Ga0453683_0012486 | |||
| 1288 | Ga0453683_0043974 | |||
| 1289 | Ga0453683_0114676 | |||
| 1290 | Ga0453683_0185910 | |||
| 1291 | Ga0466963_0027972 | |||
| 1292 | Ga0466963_0035342 | |||
| 1293 | Ga0453684_0000041 | |||
| 1294 | Ga0453684_0000055 | |||
| 1295 | Ga0453684_0000318 | |||
| 1296 | Ga0453684_0000505 | |||
| 1297 | Ga0453684_0000548 | |||
| 1298 | Ga0453684_0000763 | |||
| 1299 | Ga0453684_0001495 | |||
| 1300 | Ga0453684_0003175 | |||
| 1301 | Ga0453684_0003680 | |||
| 1302 | Ga0453684_0005515 | |||
| 1303 | Ga0453684_0006071 | |||
| 1304 | Ga0453684_0006242 | |||
| 1305 | Ga0453684_0006753 | |||
| 1306 | Ga0453684_0010308 | |||
| 1307 | Ga0453684_0012287 | |||
| 1308 | Ga0453684_0012937 | |||
| 1309 | Ga0453684_0015120 | |||
| 1310 | Ga0453684_0015944 | |||
| 1311 | Ga0453684_0052906 | |||
| 1312 | Ga0453684_0056174 | |||
| 1313 | Ga0453684_0083223 | |||
| 1314 | Ga0453684_0103885 | |||
| 1315 | Ga0453684_0108890 | |||
| 1316 | Ga0453684_0137737 | |||
| 1317 | Ga0453684_0149919 | |||
| 1318 | Ga0453684_0161821 | |||
| 1319 | Ga0453684_0180571 | |||
| 1320 | Ga0453684_0218393 | |||
| 1321 | Ga0453684_0362184 | |||
| 1322 | Ga0453684_0393530 | |||
| 1323 | Ga0453684_0437803 | |||
| 1324 | Ga0453684_0484016 | |||
| 1325 | Ga0453684_0533426 | |||
| 1326 | Ga0453684_0582136 | |||
| 1327 | Ga0453684_0767322 | |||
| 1328 | Ga0466971_0026847 | |||
| 1329 | Ga0466959_0015089 | |||
| 1330 | Ga0451576_0000008 | |||
| 1331 | Ga0451576_0000023 | |||
| 1332 | Ga0451576_0000026 | |||
| 1333 | Ga0451576_0000038 | |||
| 1334 | Ga0451576_0000048 | |||
| 1335 | Ga0451576_0000054 | |||
| 1336 | Ga0451576_0000142 | |||
| 1337 | Ga0451576_0004232 | |||
| 1338 | Ga0451576_0006528 | |||
| 1339 | Ga0451576_0006943 | |||
| 1340 | Ga0451576_0010423 | |||
| 1341 | Ga0451576_0020602 | |||
| 1342 | Ga0451576_0025596 | |||
| 1343 | Ga0451576_0034858 | |||
| 1344 | Ga0451576_0036412 | |||
| 1345 | Ga0451576_0067571 | |||
| 1346 | Ga0451576_0104691 | |||
| 1347 | Ga0451576_0180271 | |||
| 1348 | Ga0451576_0412618 | |||
| 1349 | Ga0451576_0449187 | |||
| 1350 | Ga0495629_0018692 | |||
| 1351 | Ga0495629_0135179 | |||
| 1352 | Ga0495638_0000061 | |||
| 1353 | Ga0495638_0000167 | |||
| 1354 | Ga0495650_0000467 | |||
| 1355 | Ga0495596_0008118 | |||
| 1356 | Ga0495583_0017674 | |||
| 1357 | Ga0495648_0000166 | |||
| 1358 | Ga0495663_0003723 | |||
| 1359 | Ga0495622_0000008 | |||
| 1360 | Ga0495668_0000261 | |||
| 1361 | Ga0495625_0002648 | |||
| 1362 | Ga0495659_0001994 | |||
| 1363 | Ga0495659_0013183 | |||
| 1364 | Ga0495659_0040264 | |||
| 1365 | Ga0495658_0002026 | |||
| 1366 | Ga0495649_0000100 | |||
| 1367 | Ga0495604_0034265 | |||
| 1368 | Ga0495674_0215893 | |||
| 1369 | Ga0495672_0000010 | |||
| 1370 | Ga0496101_0020431 | |||
| 1371 | Ga0496101_0115381 | |||
| 1372 | Ga0496101_0318358 | |||
| 1373 | Ga0496102_0000577 | |||
| 1374 | Ga0496102_0197826 | |||
| 1375 | Ga0496103_0001103 | |||
| 1376 | Ga0496104_0001960 | |||
| 1377 | Ga0496104_0029554 | |||
| 1378 | Ga0496104_0050871 | |||
| 1379 | Ga0496104_0123706 | |||
| 1380 | Ga0496104_0143370 | |||
| 1381 | Ga0496105_0005203 | |||
| 1382 | Ga0496105_0024366 | |||
| 1383 | Ga0496105_0127370 | |||
| 1384 | Ga0496107_0112433 | |||
| 1385 | Ga0496109_0122864 | |||
| 1386 | Ga0496110_0313507 | |||
| 1387 | Ga0496111_0200396 | |||
| 1388 | Ga0496113_0010304 | |||
| 1389 | Ga0496114_0017367 | |||
| 1390 | Ga0496115_0000001 | |||
| 1391 | Ga0496115_0000382 | |||
| 1392 | Ga0496115_0000423 | |||
| 1393 | Ga0496115_0089623 | |||
| 1394 | Ga0496117_0000320 | |||
| 1395 | Ga0496118_0000144 | |||
| 1396 | Ga0496118_0005674 | |||
| 1397 | Ga0496119_0006832 | |||
| 1398 | Ga0496121_0000070 | |||
| 1399 | Ga0496121_0039799 | |||
| 1400 | Ga0496122_0008273 | |||
| 1401 | Ga0496123_0010797 | |||
| 1402 | Ga0496124_0005475 | |||
| 1403 | Ga0496124_0023302 | |||
| 1404 | Ga0496124_0129986 | |||
| 1405 | Ga0496126_0000505 | |||
| 1406 | Ga0496126_0000696 | |||
| 1407 | Ga0496126_0071597 | |||
| 1408 | Ga0501031_0000777 | |||
| 1409 | Ga0501032_0000641 | |||
| 1410 | Ga0501034_0000028 | |||
| 1411 | Ga0501034_0001066 | |||
| 1412 | Ga0501034_0001383 | |||
| 1413 | Ga0501034_0175821 | |||
| 1414 | Ga0501034_0422894 | |||
| 1415 | Ga0501036_0001678 | |||
| 1416 | Ga0501037_0000001 | |||
| 1417 | Ga0501037_0000138 | |||
| 1418 | Ga0501038_0000863 | |||
| 1419 | Ga0501038_0061888 | |||
| 1420 | Ga0501042_0145426 | |||
| 1421 | Ga0501043_0000062 | |||
| 1422 | Ga0501046_0000059 | |||
| 1423 | Ga0501047_0000032 | |||
| 1424 | Ga0501047_0033489 | |||
| 1425 | Ga0501047_0141318 | |||
| 1426 | Ga0501048_0000001 | |||
| 1427 | Ga0501070_0066407 | |||
| 1428 | Ga0501072_0067678 | |||
| 1429 | Ga0501072_0240505 | |||
| 1430 | Ga0501075_0300726 | |||
| 1431 | Ga0501076_0049781 | |||
| 1432 | Ga0501076_0103933 | |||
| 1433 | Ga0501076_0204966 | |||
| 1434 | Ga0501079_0010737 | |||
| 1435 | Ga0501080_0020371 | |||
| 1436 | Ga0501083_0002809 | |||
| 1437 | Ga0501035_0001735 | |||
| 1438 | Ga0501044_0032556 | |||
| 1439 | Ga0501045_0069229 | |||
| 1440 | nmdc:mga03683_209_c1 | |||
| 1441 | nmdc:mga03683_3956_c2 | |||
| 1442 | nmdc:mga03n38_11_c1 | |||
| 1443 | nmdc:mga00v17_13247_c1 | |||
| 1444 | nmdc:mga00v17_143_c1 | |||
| 1445 | nmdc:mga00v17_201301_c1 | |||
| 1446 | nmdc:mga00v17_3385_c2 | |||
| 1447 | nmdc:mga00v17_40179_c1 | |||
| 1448 | nmdc:mga00v17_96758_c1 | |||
| 1449 | nmdc:mga0yw44_12970_c1 | |||
| 1450 | nmdc:mga0yw44_14_c1 | |||
| 1451 | nmdc:mga0yw44_296_c1 | |||
| 1452 | nmdc:mga0yw44_4033_c1 | |||
| 1453 | nmdc:mga0yw44_4_c1 | |||
| 1454 | nmdc:mga0yw44_8_c1 | |||
| 1455 | nmdc:mga0k408_164_c1 | |||
| 1456 | nmdc:mga0k408_194276_c1 | |||
| 1457 | nmdc:mga0k408_1_c1 | |||
| 1458 | nmdc:mga0k408_29_c1 | |||
| 1459 | nmdc:mga0k408_6447_c1 | |||
| 1460 | nmdc:mga0k408_69_c2 | |||
| 1461 | nmdc:mga0k408_924_c1 | |||
| 1462 | nmdc:mga06z11_483_c1 | |||
| 1463 | nmdc:mga06z11_5_c1 | |||
| 1464 | nmdc:mga04h51_7988_c1 | |||
| 1465 | nmdc:mga04h51_9_c1 | |||
| 1466 | nmdc:mga07m45_1009_c1 | |||
| 1467 | nmdc:mga07m45_1611_c1 | |||
| 1468 | nmdc:mga07m45_31_c1 | |||
| 1469 | nmdc:mga07m45_36150_c1 | |||
| 1470 | nmdc:mga07m45_73623_c1 | |||
| 1471 | nmdc:mga05p37_107395_c1 | |||
| 1472 | nmdc:mga05p37_145822_c1 | |||
| 1473 | nmdc:mga05p37_164535_c1 | |||
| 1474 | nmdc:mga05p37_289387_c1 | |||
| 1475 | nmdc:mga05p37_39914_c1 | |||
| 1476 | nmdc:mga05p37_6974_c1 | |||
| 1477 | nmdc:mga09592_10685_c1 | |||
| 1478 | nmdc:mga09592_304400_c1 | |||
| 1479 | nmdc:mga09592_73388_c1 | |||
| 1480 | nmdc:mga09592_8433_c1 | |||
| 1481 | nmdc:mga0qj67_1812_c1 | |||
| 1482 | nmdc:mga06r32_3537_c1 | |||
| 1483 | nmdc:mga08y16_1493_c1 | |||
| 1484 | nmdc:mga08y16_218815_c1 | |||
| 1485 | nmdc:mga0n895_82487_c1 | |||
| 1486 | nmdc:mga0a205_303244_c1 | |||
| 1487 | nmdc:mga0sz30_3_c4 | |||
| 1488 | Ga0500610_0000389 | |||
| 1489 | Ga0495619_0000084 | |||
| 1490 | Ga0500643_000034 | |||
| 1491 | Ga0500643_000495 | |||
| 1492 | Ga0500644_0008364 | |||
| 1493 | Ga0500583_0007071 | |||
| 1494 | Ga0500583_0008403 | |||
| 1495 | Ga0500566_0000001 | |||
| 1496 | Ga0500555_000001 | |||
| 1497 | Ga0500555_000009 | |||
| 1498 | Ga0500562_000002 | |||
| 1499 | Ga0500569_000001 | |||
| 1500 | Ga0500593_000001 | |||
| 1501 | Ga0500593_027461 | |||
| 1502 | Ga0500614_000001 | |||
| 1503 | Ga0500642_0123628 | |||
| 1504 | Ga0500655_000483 | |||
| 1505 | Ga0500559_0021462 | |||
| 1506 | Ga0500561_0000002 | |||
| 1507 | Ga0500568_0003924 | |||
| 1508 | Ga0500577_0003518 | |||
| 1509 | Ga0500588_0000027 | |||
| 1510 | Ga0500616_0000012 | |||
| 1511 | Ga0500616_0023868 | |||
| 1512 | Ga0500616_0026398 | |||
| 1513 | Ga0500616_0086596 | |||
| 1514 | Ga0500649_000039 | |||
| 1515 | Ga0500611_000481 | |||
| 1516 | Ga0500611_002005 | |||
| 1517 | Ga0500645_000062 | |||
| 1518 | Ga0501084_0009937 | |||
| 1519 | Ga0501084_0016042 | |||
| 1520 | Ga0501084_0084007 | |||
| 1521 | Ga0501084_0140552 | |||
| 1522 | Ga0501084_0266423 | |||
| 1523 | 2512734540 | |||
| 1524 | 2600226200 | |||
| 1525 | 2819712753 | |||
| 1526 | 2864997678 | |||
| 1527 | 2865006008 | |||
| 1528 | 2879166984 | |||
| 1529 | 2928102683 | |||
| 1530 | 2928527354 | |||
| 1531 | 2928969165 | |||
| 1532 | 8007376455 | |||
| 1533 | 8022893510 | |||
| 1534 | 8057978663 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jy9-assembly1.cif.gz_I | structure of a 9 base pair reca-d loop complex | 0.9016 | 46 | 351 |
| 7jy9-assembly1.cif.gz_I | structure of a 9 base pair reca-d loop complex | 0.8958 | 46 | 351 |
| 3cmw-assembly1.cif.gz_A | mechanism of homologous recombination from the reca-ssdna/dsdna structures | 0.8869 | 15 | 337 |
| 3cmu-assembly1.cif.gz_A | mechanism of homologous recombination from the reca-ssdna/dsdna structures | 0.8854 | 15 | 337 |
| 2zrb-assembly1.cif.gz_A | msreca q196e form ii' | 0.8851 | 19 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0HJ69_348_406_3.30.250.10 | Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain | 0.9998 | 281 | 337 | 3.30.250.10 |
| 2zrcA02 | Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain | 0.9891 | 281 | 338 | 3.30.250.10 |
| 2zr7A02 | Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain | 0.9797 | 281 | 336 | 3.30.250.10 |
| 2zrgA02 | Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain | 0.9732 | 281 | 336 | 3.30.250.10 |
| 1ubgA02 | Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain | 0.973 | 281 | 338 | 3.30.250.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0SUS0-F1-model_v4 | Protein RecA (Recombinase A) | 0.9877 | 224 | 337 |
GO:0003697
GO:0005524 GO:0005829 GO:0006281 GO:0006310 GO:0008094 GO:0009432 |
| AF-A0A7X7FRA9-F1-model_v4 | Protein RecA | 0.9872 | 223 | 338 |
GO:0003697
GO:0005524 GO:0006281 GO:0006310 GO:0008094 |
| AF-A0A7K1AUX1-F1-model_v4 | Protein RecA (Recombinase A) | 0.9858 | 247 | 336 |
GO:0003697
GO:0005524 GO:0005829 GO:0006281 GO:0006310 GO:0008094 GO:0009432 |
| AF-A0A259DHC6-F1-model_v4 | Protein RecA | 0.9822 | 236 | 340 |
GO:0003697
GO:0005524 GO:0005829 GO:0006281 GO:0006310 GO:0008094 |
| AF-A0A7C1IHX8-F1-model_v4 | DNA recombination/repair protein RecA | 0.981 | 255 | 338 |
GO:0003697
GO:0005524 GO:0006281 GO:0006310 GO:0008094 |