F479800

General Info

Members Datasets Scaffolds Average Seq Length
765 436 710 241

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000068|Ga0495606_0000068_171168_171959
Length 263
Sequence MTSTIFCNGAGKERNMNESKNLSVLVTGSSRGIGKAIALRLARDGYDLVLHCRSRRADAEGVAQQISTLGRAVRVLQFDIGDRAASAAALAADVADNGCYYGVVCNAGVAADNAFPAMSGEDWDLVLKTNLDGFYNVLNPLIMPMVQRRKPGRIVTLSSVSGVIGNRGQVNYSAAKAGIIGATKALALELAKRAITVNCVAPGLIDTDMIDGLDPAAREEALKMVPLRRVGQAGEVAGAVSFLIGDDASYITRQVISVNGGMA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
8 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
12 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
13 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
14 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
15 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
16 2738543012 Acidovorax sp. CF301 Isolate Unclassified
17 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
18 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
19 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
20 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
21 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
22 2818991436 Collimonas arenae 515 Isolate Unclassified
23 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
24 2842711865 Duganella sp. R-73148 Isolate Unclassified
25 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
26 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
27 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
28 2857564685 Duganella sp. R-74599 Isolate Unclassified
29 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
30 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
31 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
32 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
33 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
34 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
35 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
36 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
37 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
38 2919085039 Luteibacter sp. 1214 Isolate Unclassified
39 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
40 2919404418 Luteibacter sp. 3190 Isolate Unclassified
41 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
42 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
43 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
44 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
45 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
46 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
47 2941471342 Luteibacter sp. 621 Isolate Unclassified
48 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
49 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
50 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
51 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
52 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
57 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
58 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
59 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
60 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
63 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
66 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
67 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
68 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
69 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
78 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
101 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
102 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
108 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
112 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
124 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
136 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
137 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
175 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
185 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
186 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
250 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
251 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
254 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
255 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
256 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
257 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
258 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
259 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
260 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
265 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
271 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
272 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
273 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
282 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
283 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
284 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
285 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
291 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
292 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
293 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
294 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
295 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
302 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
305 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
312 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
313 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
326 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
327 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
328 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
329 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
330 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
334 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
335 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
371 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
374 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
375 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
376 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
377 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
380 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
381 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
382 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
408 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
409 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
410 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
414 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
426 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
429 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
430 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
434 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
435 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
436 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 0
Isolates 7.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 9.67
Nodule 0.52
Rhizoplane 2.22
Rhizosphere 77.12
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021400 3300001979 Bacteria 2242
2 JGI25155J39150_1000301 3300002704 Bacteria 16893
3 JGI25156J39149_1000038 3300002705 Bacteria 108421
4 JGI25156J39149_1004474 3300002705 Bacteria 4255
5 JGI25162J39368_1000015 3300002737 Bacteria 316381
6 JGI25162J39368_1011161 3300002737 Bacteria 1094
7 JGI25154J39366_1001243 3300002738 Bacteria 9588
8 JGI25154J39366_1001369 3300002738 Bacteria 8859
9 JGI25157J39369_1000127 3300002741 Bacteria 65070
10 JGI25157J39369_1001386 3300002741 Bacteria 9364
11 JGI25163J39215_1001748 3300002771 Bacteria 3035
12 JGI25150J39212_1000643 3300002774 Bacteria 13163
13 JGI25150J39212_1008972 3300002774 Bacteria 1928
14 JGI25151J46595_10023515 3300003187 Bacteria 2537
15 JGI25165J46597_1000001 3300003214 Bacteria 1111887
16 JGI25153J46596_10018456 3300003215 Bacteria 2709
17 rootH1_10009899 3300003323 Bacteria 26612
18 rootH1_10012135 3300003323 Bacteria 10558
19 Ga0055538_1000001 3300003751 Bacteria 1111887
20 Ga0055539_1000001 3300003752 Bacteria 1111887
21 Ga0055539_1002307 3300003752 Bacteria 2990
22 Ga0055539_1005513 3300003752 Bacteria 1642
23 Ga0055533_1000003 3300003756 Bacteria 1111887
24 Ga0055533_1001462 3300003756 Bacteria 6233
25 Ga0055525_1000027 3300003759 Bacteria 340506
26 Ga0055525_1000087 3300003759 Bacteria 149803
27 Ga0055527_1000199 3300003760 Bacteria 39633
28 Ga0055527_1000212 3300003760 Bacteria 37749
29 Ga0055535_1000585 3300003761 Bacteria 30486
30 Ga0055535_1000854 3300003761 Bacteria 21603
31 Ga0055535_1001004 3300003761 Bacteria 18069
32 Ga0055542_1000647 3300003762 Bacteria 28749
33 Ga0055542_1000687 3300003762 Bacteria 26887
34 Ga0055542_1000693 3300003762 Bacteria 26579
35 Ga0055529_1000590 3300003763 Bacteria 28472
36 Ga0055529_1001016 3300003763 Bacteria 13476
37 Ga0055526_1000066 3300003771 Bacteria 101329
38 Ga0055524_1017692 3300003775 Bacteria 2505
39 Ga0055531_10021626 3300003794 Bacteria 2487
40 Ga0055541_1000001 3300003841 Bacteria 1111887
41 Ga0058692_1000008 3300003856 Bacteria 361583
42 Ga0065703_1000102 3300005272 Bacteria 57788
43 Ga0065714_10078862 3300005288 Bacteria 2563
44 Ga0065714_10092344 3300005288 Bacteria 1881
45 Ga0065704_10000329 3300005289 Bacteria 32689
46 Ga0065704_10011917 3300005289 Bacteria 1635
47 Ga0065704_10017134 3300005289 Bacteria 1499
48 Ga0065704_10021739 3300005289 Bacteria 1515
49 Ga0070690_100002403 3300005330 Bacteria 10054
50 Ga0070670_100124570 3300005331 Bacteria 2224
51 Ga0070670_100480735 3300005331 Bacteria 1103
52 Ga0068869_100026093 3300005334 Bacteria 4064
53 Ga0070682_100025981 3300005337 Bacteria 3499
54 Ga0070682_100204144 3300005337 Bacteria 1396
55 Ga0070682_100472669 3300005337 Bacteria 965
56 Ga0068868_100015104 3300005338 Bacteria 5704
57 Ga0070660_100096503 3300005339 Bacteria 2338
58 Ga0070660_100167128 3300005339 Bacteria 1775
59 Ga0070689_100000069 3300005340 Bacteria 61455
60 Ga0070687_100003030 3300005343 Bacteria 6461
61 Ga0070661_100003084 3300005344 Bacteria 11465
62 Ga0070692_10008974 3300005345 Bacteria 4485
63 Ga0070669_100000284 3300005353 Bacteria 39974
64 Ga0070669_100001965 3300005353 Bacteria 14852
65 Ga0070669_100105807 3300005353 Bacteria 2129
66 Ga0070669_100113047 3300005353 Bacteria 2063
67 Ga0070669_100614449 3300005353 Bacteria 912
68 Ga0070675_100003503 3300005354 Bacteria 11907
69 Ga0070675_100023546 3300005354 Bacteria 4925
70 Ga0070675_100129920 3300005354 Bacteria 2146
71 Ga0070671_100019760 3300005355 Bacteria 5487
72 Ga0070674_100036098 3300005356 Bacteria 3316
73 Ga0070673_100000741 3300005364 Bacteria 18095
74 Ga0070673_100144447 3300005364 Bacteria 2010
75 Ga0070688_100008091 3300005365 Bacteria 5695
76 Ga0070659_100289505 3300005366 Bacteria 1364
77 Ga0070710_10029220 3300005437 Bacteria 2956
78 Ga0070711_100039163 3300005439 Bacteria 3191
79 Ga0070705_100012699 3300005440 Bacteria 4290
80 Ga0070700_100018379 3300005441 Bacteria 4018
81 Ga0070694_100183238 3300005444 Bacteria 1550
82 Ga0070678_100005340 3300005456 Bacteria 7414
83 Ga0070685_10003995 3300005466 Bacteria 7452
84 Ga0070698_100199509 3300005471 Bacteria 1937
85 Ga0070679_100255993 3300005530 Bacteria 1706
86 Ga0070684_100000781 3300005535 Bacteria 22094
87 Ga0070684_100716953 3300005535 Bacteria 933
88 Ga0070697_100238764 3300005536 Bacteria 1551
89 Ga0068853_100112756 3300005539 Bacteria 2417
90 Ga0070672_100016820 3300005543 Bacteria 5246
91 Ga0070672_100171541 3300005543 Bacteria 1804
92 Ga0070686_100000961 3300005544 Bacteria 16601
93 Ga0070696_100300039 3300005546 Bacteria 1230
94 Ga0070665_100003202 3300005548 Bacteria 17609
95 Ga0070665_100038519 3300005548 Bacteria 4806
96 Ga0070665_100721120 3300005548 Bacteria 1010
97 Ga0068855_100002195 3300005563 Bacteria 24130
98 Ga0068855_100046672 3300005563 Bacteria 5120
99 Ga0068855_100066169 3300005563 Bacteria 4213
100 Ga0068855_100107181 3300005563 Bacteria 3211
101 Ga0068855_100432521 3300005563 Bacteria 1438
102 Ga0070664_100014986 3300005564 Bacteria 6326
103 Ga0068857_100001885 3300005577 Bacteria 16897
104 Ga0068857_100308190 3300005577 Bacteria 1460
105 Ga0068857_100582795 3300005577 Bacteria 1056
106 Ga0068854_100370055 3300005578 Bacteria 1178
107 Ga0068856_100001666 3300005614 Bacteria 23262
108 Ga0068856_100005894 3300005614 Bacteria 12076
109 Ga0068856_100289864 3300005614 Bacteria 1654
110 Ga0070702_100002116 3300005615 Bacteria 8429
111 Ga0068852_100125934 3300005616 Bacteria 2352
112 Ga0068852_100225294 3300005616 Bacteria 1785
113 Ga0068859_100000317 3300005617 Bacteria 48140
114 Ga0068864_100001409 3300005618 Bacteria 19883
115 Ga0068866_10026887 3300005718 Bacteria 2723
116 Ga0068861_100002710 3300005719 Bacteria 11591
117 Ga0068861_100043657 3300005719 Bacteria 3367
118 Ga0068870_10002367 3300005840 Bacteria 7843
119 Ga0068863_100001571 3300005841 Bacteria 22583
120 Ga0068858_100010524 3300005842 Bacteria 8760
121 Ga0068860_100495030 3300005843 Bacteria 1220
122 Ga0068862_100003232 3300005844 Bacteria 14103
123 Ga0068862_100010476 3300005844 Bacteria 7655
124 Ga0068862_100071209 3300005844 Bacteria 3002
125 Ga0075364_10191044 3300006051 Bacteria 1387
126 Ga0070716_100052090 3300006173 Bacteria 2330
127 Ga0070716_100216682 3300006173 Bacteria 1283
128 Ga0097621_100636088 3300006237 Bacteria 978
129 Ga0068871_100053807 3300006358 Bacteria 3264
130 Ga0068871_100057038 3300006358 Bacteria 3176
131 Ga0075428_100019852 3300006844 Bacteria 7439
132 Ga0075428_100026168 3300006844 Bacteria 6462
133 Ga0075430_100027879 3300006846 Bacteria 4797
134 Ga0075431_100034434 3300006847 Bacteria 5218
135 Ga0075431_100142209 3300006847 Bacteria 2473
136 Ga0075433_10082756 3300006852 Bacteria 2831
137 Ga0075433_10097948 3300006852 Bacteria 2596
138 Ga0075433_10169031 3300006852 Bacteria 1946
139 Ga0075433_10228962 3300006852 Bacteria 1651
140 Ga0075434_100010704 3300006871 Bacteria 8612
141 Ga0075434_100148522 3300006871 Bacteria 2364
142 Ga0075429_100257238 3300006880 Bacteria 1529
143 Ga0068865_100234637 3300006881 Bacteria 1441
144 Ga0075436_100086434 3300006914 Bacteria 2178
145 Ga0097620_100000317 3300006931 Bacteria 48140
146 Ga0075435_100323353 3300007076 Bacteria 1320
147 Ga0105251_10019832 3300009011 Bacteria 3541
148 Ga0105244_10002091 3300009036 Bacteria 15355
149 Ga0105244_10010768 3300009036 Bacteria 5526
150 Ga0105244_10012197 3300009036 Bacteria 5097
151 Ga0105244_10201406 3300009036 Bacteria 938
152 Ga0105244_10223513 3300009036 Bacteria 882
153 Ga0105250_10003510 3300009092 Bacteria 7403
154 Ga0105240_10001226 3300009093 Bacteria 44605
155 Ga0105240_10006451 3300009093 Bacteria 17243
156 Ga0105240_10078269 3300009093 Bacteria 4072
157 Ga0105240_10247730 3300009093 Bacteria 2062
158 Ga0111539_10016158 3300009094 Bacteria 9260
159 Ga0111539_10050989 3300009094 Bacteria 4930
160 Ga0111539_11203802 3300009094 Bacteria 880
161 Ga0105245_10243483 3300009098 Bacteria 1744
162 Ga0105245_10383942 3300009098 Bacteria 1399
163 Ga0105247_10024284 3300009101 Bacteria 3652
164 Ga0114129_10002450 3300009147 Bacteria 25774
165 Ga0114129_10141222 3300009147 Bacteria 3301
166 Ga0114129_10152994 3300009147 Bacteria 3156
167 Ga0114129_10223215 3300009147 Bacteria 2541
168 Ga0105243_10000041 3300009148 Bacteria 159516
169 Ga0105243_10129664 3300009148 Bacteria 2138
170 Ga0105241_10002206 3300009174 Bacteria 14650
171 Ga0105241_10134780 3300009174 Bacteria 2004
172 Ga0105242_10012557 3300009176 Bacteria 6522
173 Ga0105248_10004710 3300009177 Bacteria 15097
174 Ga0105238_10025802 3300009551 Bacteria 5991
175 Ga0105238_10030636 3300009551 Bacteria 5476
176 Ga0105238_10071473 3300009551 Bacteria 3467
177 Ga0105238_10626828 3300009551 Bacteria 1084
178 Ga0105249_10004745 3300009553 Bacteria 11733
179 Ga0105249_10057978 3300009553 Bacteria 3549
180 Ga0105249_10234890 3300009553 Bacteria 1810
181 Ga0105239_10079565 3300010375 Bacteria 3606
182 Ga0157373_10397048 3300013100 Bacteria 988
183 Ga0157371_10187003 3300013102 Bacteria 1482
184 Ga0157371_10469304 3300013102 Bacteria 927
185 Ga0157370_10024113 3300013104 Bacteria 6031
186 Ga0157370_10168583 3300013104 Bacteria 2036
187 Ga0157369_10059033 3300013105 Bacteria 4138
188 Ga0163162_10037464 3300013306 Bacteria 4840
189 Ga0157372_10255786 3300013307 Bacteria 2033
190 Ga0157372_10459518 3300013307 Bacteria 1484
191 Ga0157375_10041689 3300013308 Bacteria 4435
192 Ga0163163_10000326 3300014325 Bacteria 46149
193 Ga0157380_10130310 3300014326 Bacteria 2144
194 Ga0157377_10001044 3300014745 Bacteria 11734
195 Ga0157379_10038697 3300014968 Bacteria 4255
196 Ga0157376_10214509 3300014969 Bacteria 1779
197 Ga0157376_10412447 3300014969 Bacteria 1309
198 Ga0182006_1004510 3300015261 Bacteria 6855
199 Ga0182007_10010952 3300015262 Bacteria 3554
200 Ga0182005_1000070 3300015265 Bacteria 85687
201 Ga0182005_1000227 3300015265 Bacteria 37208
202 Ga0213872_10004418 3300021361 Bacteria 7469
203 Ga0209760_103071 3300025207 Bacteria 1503
204 Ga0209784_100004 3300025224 Bacteria 1378156
205 Ga0209566_100004 3300025225 Bacteria 1531866
206 Ga0209674_100006 3300025226 Bacteria 1531866
207 Ga0209674_100086 3300025226 Bacteria 187776
208 Ga0209674_100654 3300025226 Bacteria 12445
209 Ga0209672_100005 3300025228 Bacteria 1069303
210 Ga0209672_100029 3300025228 Bacteria 339298
211 Ga0209672_101479 3300025228 Bacteria 8284
212 Ga0209563_100009 3300025230 Bacteria 1378156
213 Ga0209563_100023 3300025230 Bacteria 636844
214 Ga0207427_103252 3300025231 Bacteria 3542
215 Ga0209437_100004 3300025233 Bacteria 1378156
216 Ga0209437_101634 3300025233 Bacteria 5107
217 Ga0209258_100006 3300025242 Bacteria 1069303
218 Ga0209258_100053 3300025242 Bacteria 339233
219 Ga0209258_100064 3300025242 Bacteria 293837
220 Ga0207425_1000484 3300025245 Bacteria 25043
221 Ga0209646_1000094 3300025246 Bacteria 182874
222 Ga0209026_1000009 3300025250 Bacteria 531812
223 Ga0209026_1000074 3300025250 Bacteria 203820
224 Ga0209677_100005 3300025253 Bacteria 1378156
225 Ga0209677_100097 3300025253 Bacteria 97418
226 Ga0209677_101749 3300025253 Bacteria 9020
227 Ga0209148_1000009 3300025254 Bacteria 1395625
228 Ga0209148_1000012 3300025254 Bacteria 1069303
229 Ga0209148_1000142 3300025254 Bacteria 163404
230 Ga0209148_1002194 3300025254 Bacteria 7199
231 Ga0209759_1000065 3300025256 Bacteria 187612
232 Ga0209759_1003009 3300025256 Bacteria 6979
233 Ga0209759_1003887 3300025256 Bacteria 5766
234 Ga0209759_1019935 3300025256 Bacteria 1574
235 Ga0209233_1000005 3300025261 Bacteria 1531866
236 Ga0209455_1000008 3300025272 Bacteria 1069303
237 Ga0209455_1000060 3300025272 Bacteria 339298
238 Ga0209455_1007600 3300025272 Bacteria 3038
239 Ga0209676_1005920 3300025292 Bacteria 6193
240 Ga0209025_1002077 3300025294 Bacteria 22739
241 Ga0209564_1000009 3300025295 Bacteria 950196
242 Ga0209758_1000489 3300025297 Bacteria 64758
243 Ga0209050_1011592 3300025298 Bacteria 4155
244 Ga0209051_1037524 3300025303 Bacteria 1775
245 Ga0209051_1045522 3300025303 Bacteria 1517
246 Ga0207696_1009948 3300025711 Bacteria 3517
247 Ga0207655_1000951 3300025728 Bacteria 30002
248 Ga0207655_1001090 3300025728 Bacteria 26757
249 Ga0207655_1001100 3300025728 Bacteria 26470
250 Ga0207655_1011371 3300025728 Bacteria 5304
251 Ga0207642_10002405 3300025899 Bacteria 5830
252 Ga0207710_10000021 3300025900 Bacteria 336166
253 Ga0207645_10041524 3300025907 Bacteria 2944
254 Ga0207643_10002940 3300025908 Bacteria 9200
255 Ga0207654_10011436 3300025911 Bacteria 4529
256 Ga0207695_10003589 3300025913 Bacteria 21707
257 Ga0207695_10036390 3300025913 Bacteria 5322
258 Ga0207695_10166765 3300025913 Bacteria 2130
259 Ga0207671_10371265 3300025914 Bacteria 1136
260 Ga0207693_10077952 3300025915 Bacteria 2594
261 Ga0207662_10018978 3300025918 Bacteria 3907
262 Ga0207657_10007271 3300025919 Bacteria 11373
263 Ga0207657_10014943 3300025919 Bacteria 7544
264 Ga0207657_10108673 3300025919 Bacteria 2292
265 Ga0207649_10077159 3300025920 Bacteria 2146
266 Ga0207649_10114636 3300025920 Bacteria 1806
267 Ga0207649_10165720 3300025920 Bacteria 1535
268 Ga0207652_10213965 3300025921 Bacteria 1736
269 Ga0207681_10000437 3300025923 Bacteria 29108
270 Ga0207681_10047262 3300025923 Bacteria 2898
271 Ga0207681_10306878 3300025923 Bacteria 1257
272 Ga0207694_10030681 3300025924 Bacteria 4105
273 Ga0207694_10098659 3300025924 Bacteria 2313
274 Ga0207650_10118468 3300025925 Bacteria 2058
275 Ga0207659_10004743 3300025926 Bacteria 8246
276 Ga0207659_10048719 3300025926 Bacteria 3003
277 Ga0207690_10488643 3300025932 Bacteria 994
278 Ga0207706_10007482 3300025933 Bacteria 10098
279 Ga0207706_10015852 3300025933 Bacteria 6814
280 Ga0207686_10006292 3300025934 Bacteria 6386
281 Ga0207709_10000023 3300025935 Bacteria 369407
282 Ga0207709_10014130 3300025935 Bacteria 4407
283 Ga0207670_10003260 3300025936 Bacteria 8603
284 Ga0207669_10043554 3300025937 Bacteria 2630
285 Ga0207704_10219976 3300025938 Bacteria 1404
286 Ga0207704_10278258 3300025938 Bacteria 1271
287 Ga0207665_10073551 3300025939 Bacteria 2337
288 Ga0207691_10013436 3300025940 Bacteria 7838
289 Ga0207691_10118786 3300025940 Bacteria 2345
290 Ga0207711_10003822 3300025941 Bacteria 12952
291 Ga0207689_10003105 3300025942 Bacteria 15264
292 Ga0207667_10000120 3300025949 Bacteria 123800
293 Ga0207667_10007649 3300025949 Bacteria 12943
294 Ga0207667_10015507 3300025949 Bacteria 8648
295 Ga0207667_10149506 3300025949 Bacteria 2404
296 Ga0207712_10003212 3300025961 Bacteria 10388
297 Ga0207712_10037163 3300025961 Bacteria 3321
298 Ga0207712_10136360 3300025961 Bacteria 1877
299 Ga0207640_10030508 3300025981 Bacteria 3321
300 Ga0207658_10008297 3300025986 Bacteria 7076
301 Ga0207677_10058547 3300026023 Bacteria 2653
302 Ga0207703_10033193 3300026035 Bacteria 4089
303 Ga0207639_10055568 3300026041 Bacteria 3031
304 Ga0207708_10032862 3300026075 Bacteria 3939
305 Ga0207702_10000610 3300026078 Bacteria 39489
306 Ga0207702_10001392 3300026078 Bacteria 24120
307 Ga0207702_10068751 3300026078 Bacteria 3043
308 Ga0207641_10003999 3300026088 Bacteria 12871
309 Ga0207648_10023478 3300026089 Bacteria 5524
310 Ga0207648_10134412 3300026089 Bacteria 2178
311 Ga0207676_10001771 3300026095 Bacteria 15825
312 Ga0207674_10045014 3300026116 Bacteria 4542
313 Ga0207675_100009624 3300026118 Bacteria 9043
314 Ga0207675_100065976 3300026118 Bacteria 3382
315 Ga0207683_10156162 3300026121 Bacteria 2061
316 Ga0207683_10249688 3300026121 Bacteria 1619
317 Ga0207698_10095893 3300026142 Bacteria 2443
318 Ga0207698_10169060 3300026142 Bacteria 1923
319 Ga0207698_10329580 3300026142 Bacteria 1433
320 Ga0209371_1000038 3300027312 Bacteria 361802
321 Ga0209974_10022065 3300027876 Bacteria 2108
322 Ga0207428_10368226 3300027907 Bacteria 1056
323 Ga0268266_10002128 3300028379 Bacteria 21854
324 Ga0268266_10021170 3300028379 Bacteria 5540
325 Ga0268265_10003134 3300028380 Bacteria 12053
326 Ga0268265_10007277 3300028380 Bacteria 7479
327 Ga0268265_10071349 3300028380 Bacteria 2705
328 Ga0268264_10266016 3300028381 Bacteria 1600
329 Ga0265334_10000500 3300028573 Bacteria 20148
330 Ga0265318_10102895 3300028577 Bacteria 1050
331 Ga0265336_10000061 3300028666 Bacteria 102829
332 Ga0265336_10035474 3300028666 Bacteria 1538
333 Ga0307515_10072544 3300028794 Bacteria 4643
334 Ga0265324_10001696 3300029957 Bacteria 12114
335 Ga0268256_1000038 3300030500 Bacteria 361762
336 Ga0316178_1028084 3300030735 Bacteria 1148
337 Ga0316183_1175186 3300030742 Bacteria 4962
338 Ga0316181_1163091 3300030744 Bacteria 1407
339 Ga0265329_10022329 3300031242 Bacteria 2118
340 Ga0265327_10001649 3300031251 Bacteria 26951
341 Ga0265327_10102697 3300031251 Bacteria 1377
342 Ga0265316_10059388 3300031344 Bacteria 2974
343 Ga0307513_10058089 3300031456 Bacteria 4115
344 Ga0307509_10141183 3300031507 Bacteria 2344
345 Ga0307508_10078804 3300031616 Bacteria 2875
346 Ga0316575_10000758 3300031665 Bacteria 9722
347 Ga0307516_10003991 3300031730 Bacteria 18527
348 Ga0307413_10088180 3300031824 Bacteria 2012
349 Ga0307412_10000595 3300031911 Bacteria 21371
350 Ga0307409_100710376 3300031995 Bacteria 1005
351 Ga0307416_100883448 3300032002 Bacteria 993
352 Ga0307414_10196823 3300032004 Bacteria 1636
353 Ga0307411_10139350 3300032005 Bacteria 1786
354 Ga0373958_0004705 3300034819 Bacteria 2033
355 Ga0373924_0191022 3300035410 Bacteria 902
356 Ga0373931_0004051 3300035691 Bacteria 6642
357 Ga0373937_0080873 3300036401 Bacteria 3006
358 Ga0373937_0097205 3300036401 Bacteria 2731
359 Ga0395899_0000108 3300037312 Bacteria 142347
360 Ga0395899_0004137 3300037312 Bacteria 11407
361 Ga0395899_0011520 3300037312 Bacteria 6769
362 Ga0395899_0014968 3300037312 Bacteria 5916
363 Ga0395899_0069039 3300037312 Bacteria 2589
364 Ga0395900_0000343 3300037418 Bacteria 68342
365 Ga0395900_0000755 3300037418 Bacteria 42995
366 Ga0395900_0013133 3300037418 Bacteria 8463
367 Ga0395900_0038690 3300037418 Bacteria 4916
368 Ga0395900_0167389 3300037418 Bacteria 2239
369 Ga0395900_0267722 3300037418 Bacteria 1704
370 Ga0395898_0000018 3300037466 Bacteria 418600
371 Ga0395898_0000049 3300037466 Bacteria 284792
372 Ga0395898_0140996 3300037466 Bacteria 2307
373 Ga0395898_0467517 3300037466 Bacteria 1200
374 Ga0395905_0119887 3300037471 Bacteria 2472
375 Ga0395901_0000033 3300038443 Bacteria 232357
376 Ga0395901_0010919 3300038443 Bacteria 9204
377 Ga0395901_0014131 3300038443 Bacteria 8128
378 Ga0395901_0106514 3300038443 Bacteria 2942
379 Ga0395901_0117270 3300038443 Bacteria 2797
380 Ga0395901_0149159 3300038443 Bacteria 2457
381 Ga0395901_0239271 3300038443 Bacteria 1893
382 Ga0395901_0343105 3300038443 Bacteria 1543
383 Ga0237816_00313 3300039145 Bacteria 4149
384 Ga0436361_0009597 3300039447 Bacteria 38752
385 Ga0436361_0809540 3300039447 Bacteria 3675
386 Ga0439436_0030789 3300041404 Bacteria 1559
387 Ga0439461_0044219 3300041410 Bacteria 971
388 Ga0439466_0045527 3300041411 Bacteria 1450
389 Ga0439465_0000949 3300041413 Bacteria 9197
390 Ga0451837_0176909 3300041494 Bacteria 905
391 Ga0439448_0000301 3300042005 Bacteria 10911
392 Ga0439449_0000014 3300042007 Bacteria 50794
393 Ga0439449_0037619 3300042007 Bacteria 1800
394 Ga0439449_0058479 3300042007 Bacteria 1423
395 Ga0439450_007864 3300042008 Bacteria 1969
396 Ga0439455_0007174 3300042012 Bacteria 2348
397 Ga0450911_008483 3300042115 Bacteria 1461
398 Ga0450911_018912 3300042115 Bacteria 904
399 Ga0439458_0152058 3300042157 Bacteria 620
400 Ga0451577_0117106 3300042876 Bacteria 2386
401 Ga0451577_0232380 3300042876 Bacteria 1668
402 Ga0451577_0665839 3300042876 Bacteria 944
403 Ga0466969_0014958 3300044656 Bacteria 4070
404 Ga0466969_0015853 3300044656 Bacteria 3949
405 Ga0466969_0203000 3300044656 Bacteria 904
406 Ga0466965_0015129 3300044683 Bacteria 3662
407 Ga0466966_0019976 3300044684 Bacteria 4406
408 Ga0466966_0093765 3300044684 Bacteria 1861
409 Ga0466961_0000617 3300044693 Bacteria 22343
410 Ga0466961_0020355 3300044693 Bacteria 4267
411 Ga0466963_0081589 3300044694 Bacteria 2191
412 Ga0466964_0000727 3300044706 Bacteria 10691
413 Ga0466964_0051920 3300044706 Bacteria 1684
414 Ga0453684_0006727 3300044712 Bacteria 21662
415 Ga0453684_0256310 3300044712 Bacteria 2006
416 Ga0453684_0452472 3300044712 Bacteria 1429
417 Ga0466971_0098234 3300044719 Bacteria 1344
418 Ga0466971_0196298 3300044719 Bacteria 952
419 Ga0466957_0001593 3300044842 Bacteria 11926
420 Ga0466957_0029147 3300044842 Bacteria 3290
421 Ga0466957_0139197 3300044842 Bacteria 1562
422 Ga0466960_0080842 3300044901 Bacteria 1637
423 Ga0466959_0000347 3300045049 Bacteria 27371
424 Ga0466959_0001870 3300045049 Bacteria 13231
425 Ga0466959_0146293 3300045049 Bacteria 1667
426 Ga0451576_0034629 3300045051 Bacteria 5362
427 Ga0451576_0572900 3300045051 Bacteria 1186
428 Ga0451576_0587255 3300045051 Bacteria 1171
429 Ga0451576_0957821 3300045051 Bacteria 897
430 Ga0466958_0026361 3300045836 Bacteria 3434
431 Ga0466958_0038431 3300045836 Bacteria 2872
432 Ga0466967_0010517 3300045976 Bacteria 6948
433 Ga0495617_003902 3300046452 Bacteria 5494
434 Ga0495617_006705 3300046452 Bacteria 4026
435 Ga0495592_0013806 3300046454 Bacteria 6141
436 Ga0495592_0141801 3300046454 Bacteria 1671
437 Ga0495592_0202844 3300046454 Bacteria 1337
438 Ga0495592_0451578 3300046454 Bacteria 805
439 Ga0495603_0136661 3300046455 Bacteria 1426
440 Ga0495590_0000003 3300046457 Bacteria 478593
441 Ga0495590_0044275 3300046457 Bacteria 1552
442 Ga0495638_0000091 3300046460 Bacteria 146548
443 Ga0495638_0004653 3300046460 Bacteria 10379
444 Ga0495651_0018176 3300046462 Bacteria 5442
445 Ga0495653_0004499 3300046463 Bacteria 11259
446 Ga0495650_0000097 3300046471 Bacteria 216051
447 Ga0495650_0001058 3300046471 Bacteria 30529
448 Ga0495582_0000880 3300046473 Bacteria 16656
449 Ga0495582_0064202 3300046473 Bacteria 2027
450 Ga0495605_0000251 3300046474 Bacteria 63553
451 Ga0495605_0008057 3300046474 Bacteria 5965
452 Ga0495639_0010865 3300046475 Bacteria 3921
453 Ga0495639_0075418 3300046475 Bacteria 1563
454 Ga0495584_0000021 3300046491 Bacteria 130377
455 Ga0495584_0019130 3300046491 Bacteria 3478
456 Ga0495584_0029967 3300046491 Bacteria 2757
457 Ga0495584_0065432 3300046491 Bacteria 1828
458 Ga0495584_0072788 3300046491 Bacteria 1727
459 Ga0495585_0000772 3300046492 Bacteria 28287
460 Ga0495585_0008458 3300046492 Bacteria 6237
461 Ga0495585_0024974 3300046492 Bacteria 3424
462 Ga0495585_0027981 3300046492 Bacteria 3217
463 Ga0495585_0039317 3300046492 Bacteria 2659
464 Ga0495585_0174666 3300046492 Bacteria 1107
465 Ga0495594_0008636 3300046499 Bacteria 5248
466 Ga0495594_0044138 3300046499 Bacteria 2445
467 Ga0495596_0001477 3300046500 Bacteria 13428
468 Ga0495607_0000298 3300046501 Bacteria 51955
469 Ga0495607_0001875 3300046501 Bacteria 17831
470 Ga0495607_0006297 3300046501 Bacteria 8368
471 Ga0495607_0007143 3300046501 Bacteria 7761
472 Ga0495607_0031071 3300046501 Bacteria 3272
473 Ga0495607_0066327 3300046501 Bacteria 2031
474 Ga0495583_0000060 3300046506 Bacteria 199091
475 Ga0495583_0000155 3300046506 Bacteria 114870
476 Ga0495583_0000197 3300046506 Bacteria 101236
477 Ga0495583_0002755 3300046506 Bacteria 14519
478 Ga0495583_0202825 3300046506 Bacteria 805
479 Ga0495606_0000068 3300046507 Bacteria 179653
480 Ga0495606_0000141 3300046507 Bacteria 123586
481 Ga0495606_0000371 3300046507 Bacteria 76806
482 Ga0495606_0000461 3300046507 Bacteria 66807
483 Ga0495606_0001419 3300046507 Bacteria 32193
484 Ga0495606_0002328 3300046507 Bacteria 22395
485 Ga0495606_0008626 3300046507 Bacteria 8810
486 Ga0495606_0018254 3300046507 Bacteria 5268
487 Ga0495606_0253326 3300046507 Bacteria 975
488 Ga0495608_0018979 3300046511 Bacteria 4738
489 Ga0495610_0000003 3300046512 Bacteria 1203910
490 Ga0495610_0001476 3300046512 Bacteria 20720
491 Ga0495610_0004645 3300046512 Bacteria 10042
492 Ga0495610_0010298 3300046512 Bacteria 5821
493 Ga0495616_0000036 3300046513 Bacteria 128264
494 Ga0495616_0005947 3300046513 Bacteria 7441
495 Ga0495616_0041033 3300046513 Bacteria 2362
496 Ga0495616_0197999 3300046513 Bacteria 884
497 Ga0495618_0011571 3300046514 Bacteria 5354
498 Ga0495628_0002796 3300046516 Bacteria 15660
499 Ga0495628_0052698 3300046516 Bacteria 3213
500 Ga0495631_0004837 3300046518 Bacteria 7100
501 Ga0495632_0001532 3300046519 Bacteria 19084
502 Ga0495632_0004109 3300046519 Bacteria 10026
503 Ga0495632_0074080 3300046519 Bacteria 1631
504 Ga0495637_0001597 3300046520 Bacteria 13157
505 Ga0495643_0000179 3300046522 Bacteria 100406
506 Ga0495643_0000287 3300046522 Bacteria 72080
507 Ga0495643_0011258 3300046522 Bacteria 5460
508 Ga0495643_0069626 3300046522 Bacteria 1849
509 Ga0495643_0091541 3300046522 Bacteria 1568
510 Ga0495644_0002342 3300046523 Bacteria 7553
511 Ga0495644_0003908 3300046523 Bacteria 5868
512 Ga0495644_0034344 3300046523 Bacteria 1914
513 Ga0495644_0077710 3300046523 Bacteria 1250
514 Ga0495648_0000058 3300046524 Bacteria 156717
515 Ga0495648_0012123 3300046524 Bacteria 6453
516 Ga0495648_0032542 3300046524 Bacteria 3419
517 Ga0495663_0000299 3300046525 Bacteria 18832
518 Ga0495663_0006649 3300046525 Bacteria 3190
519 Ga0495666_0040246 3300046526 Bacteria 2267
520 Ga0495642_0000223 3300046528 Bacteria 32585
521 Ga0495642_0006585 3300046528 Bacteria 4457
522 Ga0495642_0195445 3300046528 Bacteria 881
523 Ga0495652_0038065 3300046529 Bacteria 4169
524 Ga0495652_0049372 3300046529 Bacteria 3602
525 Ga0495652_0184547 3300046529 Bacteria 1597
526 Ga0495609_0000039 3300046538 Bacteria 179384
527 Ga0495609_0016132 3300046538 Bacteria 3485
528 Ga0495609_0080768 3300046538 Bacteria 1421
529 Ga0495609_0084539 3300046538 Bacteria 1384
530 Ga0495597_0000209 3300046542 Bacteria 53295
531 Ga0495597_0000242 3300046542 Bacteria 49561
532 Ga0495645_0009101 3300046543 Bacteria 6939
533 Ga0495645_0020795 3300046543 Bacteria 4741
534 Ga0495622_0000468 3300046557 Bacteria 25821
535 Ga0495622_0037101 3300046557 Bacteria 2270
536 Ga0495633_0000119 3300046558 Bacteria 106455
537 Ga0495633_0000249 3300046558 Bacteria 64232
538 Ga0495633_0001297 3300046558 Bacteria 19748
539 Ga0495633_0002317 3300046558 Bacteria 13558
540 Ga0495633_0009262 3300046558 Bacteria 5455
541 Ga0495633_0034772 3300046558 Bacteria 2422
542 Ga0495633_0117770 3300046558 Bacteria 1230
543 Ga0495656_0052552 3300046615 Bacteria 1747
544 Ga0495668_0000337 3300046616 Bacteria 63494
545 Ga0495611_0004289 3300046648 Bacteria 6194
546 Ga0495611_0019241 3300046648 Bacteria 2933
547 Ga0495611_0023655 3300046648 Bacteria 2667
548 Ga0495611_0082418 3300046648 Bacteria 1480
549 Ga0495625_0000132 3300046660 Bacteria 115728
550 Ga0495625_0000139 3300046660 Bacteria 112271
551 Ga0495625_0001396 3300046660 Bacteria 29588
552 Ga0495625_0002129 3300046660 Bacteria 22079
553 Ga0495625_0002623 3300046660 Bacteria 19215
554 Ga0495625_0003498 3300046660 Bacteria 15570
555 Ga0495659_0000054 3300046664 Bacteria 51199
556 Ga0495659_0001118 3300046664 Bacteria 9335
557 Ga0495659_0068463 3300046664 Bacteria 1326
558 Ga0495661_0000094 3300046665 Bacteria 109394
559 Ga0495661_0027405 3300046665 Bacteria 3658
560 Ga0495661_0035739 3300046665 Bacteria 3115
561 Ga0495661_0036819 3300046665 Bacteria 3059
562 Ga0495588_0000110 3300046674 Bacteria 142825
563 Ga0495588_0026084 3300046674 Bacteria 2915
564 Ga0495599_0000399 3300046678 Bacteria 24819
565 Ga0495623_0005943 3300046679 Bacteria 7955
566 Ga0495646_0000446 3300046680 Bacteria 21847
567 Ga0495669_0000041 3300046684 Bacteria 88966
568 Ga0495613_0109713 3300046689 Bacteria 1989
569 Ga0495624_0019179 3300046690 Bacteria 4569
570 Ga0495670_0010366 3300046691 Bacteria 4579
571 Ga0495670_0028609 3300046691 Bacteria 2762
572 Ga0495670_0039030 3300046691 Bacteria 2368
573 Ga0495670_0062625 3300046691 Bacteria 1872
574 Ga0495671_0000314 3300046692 Bacteria 41125
575 Ga0495671_0000582 3300046692 Bacteria 27065
576 Ga0495671_0001195 3300046692 Bacteria 17789
577 Ga0495671_0092095 3300046692 Bacteria 1483
578 Ga0495649_0140133 3300046694 Bacteria 1273
579 Ga0495589_0000019 3300046794 Bacteria 200814
580 Ga0495589_0002079 3300046794 Bacteria 11326
581 Ga0495600_0002038 3300046809 Bacteria 11377
582 Ga0495660_0004026 3300046810 Bacteria 8972
583 Ga0495660_0009308 3300046810 Bacteria 5728
584 Ga0495581_0014620 3300047315 Bacteria 4550
585 Ga0495581_0319056 3300047315 Bacteria 908
586 Ga0495604_0002313 3300047317 Bacteria 15272
587 Ga0495636_0071636 3300047318 Bacteria 1480
588 Ga0495636_0168335 3300047318 Bacteria 990
589 Ga0495672_0000263 3300047320 Bacteria 72879
590 Ga0495672_0016756 3300047320 Bacteria 4921
591 Ga0495672_0028738 3300047320 Bacteria 3512
592 Ga0495683_0003113 3300047323 Bacteria 9722
593 Ga0495683_0003818 3300047323 Bacteria 8693
594 Ga0495683_0017927 3300047323 Bacteria 3665
595 Ga0495683_0028091 3300047323 Bacteria 2876
596 Ga0495683_0223067 3300047323 Bacteria 839
597 Ga0495687_000059 3300047443 Bacteria 179357
598 Ga0495687_000296 3300047443 Bacteria 65626
599 Ga0495687_001591 3300047443 Bacteria 20510
600 Ga0495687_030413 3300047443 Bacteria 2486
601 Ga0495675_0097764 3300047444 Bacteria 1839
602 Ga0495677_0000006 3300047445 Bacteria 199230
603 Ga0495677_0000590 3300047445 Bacteria 14890
604 Ga0495677_0010069 3300047445 Bacteria 3478
605 Ga0495677_0112482 3300047445 Bacteria 1035
606 Ga0495679_031183 3300047446 Bacteria 1722
607 Ga0495685_000416 3300047447 Bacteria 13459
608 Ga0495685_039173 3300047447 Bacteria 1622
609 Ga0495685_052210 3300047447 Bacteria 1385
610 Ga0495673_0000006 3300047469 Bacteria 908691
611 Ga0495673_0000024 3300047469 Bacteria 521349
612 Ga0495681_0007045 3300047470 Bacteria 7258
613 Ga0495686_0000295 3300047472 Bacteria 86824
614 Ga0495686_0001364 3300047472 Bacteria 27253
615 Ga0495686_0059195 3300047472 Bacteria 2385
616 Ga0495602_0040199 3300048088 Bacteria 4293
617 Ga0495602_0227554 3300048088 Bacteria 1403
618 Ga0495614_0199754 3300048089 Bacteria 904
619 Ga0495626_0000494 3300048091 Bacteria 39727
620 Ga0495626_0000711 3300048091 Bacteria 31405
621 Ga0495626_0008460 3300048091 Bacteria 5639
622 Ga0495626_0039518 3300048091 Bacteria 2232
623 Ga0495626_0074916 3300048091 Bacteria 1513
624 Ga0495626_0109991 3300048091 Bacteria 1194
625 Ga0496100_0003016 3300048903 Bacteria 8684
626 Ga0496101_0002894 3300048904 Bacteria 10563
627 Ga0496102_0038216 3300048905 Bacteria 4331
628 Ga0496102_0077507 3300048905 Bacteria 3059
629 Ga0496104_0681864 3300048907 Bacteria 936
630 Ga0496106_0037602 3300048909 Bacteria 3622
631 Ga0496106_0179271 3300048909 Bacteria 1681
632 Ga0496108_0198824 3300048911 Bacteria 1739
633 Ga0496109_0020721 3300048912 Bacteria 5807
634 Ga0496109_0208907 3300048912 Bacteria 1836
635 Ga0496110_0069311 3300048913 Bacteria 3123
636 Ga0496111_0305982 3300048914 Bacteria 1178
637 Ga0496112_0046686 3300048915 Bacteria 4249
638 Ga0496113_0198113 3300048916 Bacteria 1596
639 Ga0496114_0000701 3300048917 Bacteria 24988
640 Ga0496114_0018872 3300048917 Bacteria 5584
641 Ga0496116_0003933 3300048919 Bacteria 14459
642 Ga0496116_0064539 3300048919 Bacteria 2353
643 Ga0496118_0151056 3300048921 Bacteria 1454
644 Ga0496121_0000372 3300048924 Bacteria 92348
645 Ga0496121_0005323 3300048924 Bacteria 16544
646 Ga0496121_0016968 3300048924 Bacteria 7479
647 Ga0496121_0061327 3300048924 Bacteria 3087
648 Ga0496121_0279831 3300048924 Bacteria 1142
649 Ga0496122_0000165 3300048925 Bacteria 157612
650 Ga0496122_0000887 3300048925 Bacteria 55765
651 Ga0496122_0067755 3300048925 Bacteria 2568
652 Ga0496123_0000180 3300048926 Bacteria 127726
653 Ga0496123_0000471 3300048926 Bacteria 70580
654 Ga0496123_0008827 3300048926 Bacteria 9186
655 Ga0496123_0043490 3300048926 Bacteria 3084
656 Ga0496124_0041418 3300048927 Bacteria 3974
657 Ga0496125_0005042 3300048928 Bacteria 14901
658 Ga0496125_0074638 3300048928 Bacteria 2628
659 Ga0496125_0143265 3300048928 Bacteria 1657
660 Ga0496126_0007665 3300048929 Bacteria 11782
661 Ga0496126_0170497 3300048929 Bacteria 1854
662 Ga0495678_000283 3300049459 Bacteria 55712
663 Ga0495678_000365 3300049459 Bacteria 46300
664 Ga0495678_003240 3300049459 Bacteria 10196
665 Ga0495678_041790 3300049459 Bacteria 1831
666 Ga0495682_0000188 3300049460 Bacteria 50664
667 Ga0501033_0059786 3300049570 Bacteria 2814
668 Ga0501034_0000321 3300049571 Bacteria 84273
669 Ga0501034_0128376 3300049571 Bacteria 2520
670 Ga0501039_0544289 3300049575 Bacteria 911
671 Ga0501068_0361300 3300049584 Bacteria 934
672 Ga0501077_0151048 3300049593 Bacteria 1474
673 Ga0501249_003568 3300049679 Bacteria 3128
674 Ga0501225_0037693 3300049705 Bacteria 1332
675 Ga0501080_0167775 3300049742 Bacteria 2025
676 Ga0501083_0041654 3300049744 Bacteria 3114
677 Ga0501263_007207 3300049760 Bacteria 1304
678 Ga0501269_000017 3300049766 Bacteria 57974
679 Ga0501035_0000652 3300049822 Bacteria 38210
680 Ga0501035_0028900 3300049822 Bacteria 5059
681 Ga0501044_0000065 3300049823 Bacteria 130072
682 Ga0501044_0071447 3300049823 Bacteria 3529
683 nmdc:mga05p37_267918_c1 3300050507 Bacteria 2042
684 nmdc:mga05p37_404326_c1 3300050507 Bacteria 1593
685 nmdc:mga0qj67_11460_c1 3300050509 Bacteria 6643
686 nmdc:mga06r32_284767_c1 3300050510 Bacteria 1639
687 nmdc:mga06r32_7200_c1 3300050510 Bacteria 10027
688 nmdc:mga08y16_152674_c1 3300050511 Bacteria 2400
689 nmdc:mga08y16_37616_c1 3300050511 Bacteria 5081
690 nmdc:mga08y16_620848_c1 3300050511 Bacteria 1088
691 nmdc:mga0n895_135667_c1 3300050512 Bacteria 2487
692 nmdc:mga0n895_2762_c1 3300050512 Bacteria 13867
693 nmdc:mga0rr50_476448_c1 3300050513 Bacteria 1060
694 nmdc:mga0a205_179577_c1 3300050515 Bacteria 2011
695 nmdc:mga0a205_248209_c1 3300050515 Bacteria 1660
696 nmdc:mga0a205_52399_c1 3300050515 Bacteria 3938
697 nmdc:mga0a205_56645_c1 3300050515 Bacteria 3784
698 Ga0495601_0011605 3300053077 Bacteria 5278
699 Ga0495601_0019691 3300053077 Bacteria 4118
700 Ga0495601_0123067 3300053077 Bacteria 1686
701 Ga0500635_0000026 3300053080 Bacteria 104983
702 Ga0500660_170555 3300053100 Unclassified 806
703 Ga0500594_0035457 3300053118 Bacteria 1338
704 Ga0500595_002138 3300053119 Bacteria 10061
705 Ga0500564_081302 3300053138 Bacteria 1452
706 Ga0500619_010923 3300053154 Bacteria 2317
707 Ga0500636_0060106 3300053177 Bacteria 2219
708 Ga0501082_0042873 3300060353 Bacteria 3900
709 Ga0466962_0016392 3300061719 Bacteria 3574
710 Ga0466962_0107047 3300061719 Bacteria 1345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042157 Ga0439458_0152058 Ga0439458_0152058_11_610 199
2 3300046492 Ga0495585_0027981 Ga0495585_0027981_1160_1906 207
3 3300039145 Ga0237816_00313 Ga0237816_00313_1215_1949 210
4 3300053100 Ga0500660_170555 Ga0500660_170555_149_787 211
5 3300047323 Ga0495683_0028091 Ga0495683_0028091_2153_2794 213
6 3300048924 Ga0496121_0016968 Ga0496121_0016968_2277_3008 213
7 3300048925 Ga0496122_0000165 Ga0496122_0000165_91220_91951 213
8 3300048926 Ga0496123_0000471 Ga0496123_0000471_18413_19144 213
9 3300048927 Ga0496124_0041418 Ga0496124_0041418_50_781 213
10 3300048928 Ga0496125_0143265 Ga0496125_0143265_155_886 213
11 3300048929 Ga0496126_0170497 Ga0496126_0170497_970_1701 213
12 3300025292 Ga0209676_1005920 Ga0209676_10059208 214
13 3300025298 Ga0209050_1011592 Ga0209050_10115922 214
14 3300025303 Ga0209051_1037524 Ga0209051_10375243 214
15 3300041404 Ga0439436_0030789 Ga0439436_0030789_815_1549 215
16 3300048919 Ga0496116_0003933 Ga0496116_0003933_1504_2235 215
17 3300041413 Ga0439465_0000949 Ga0439465_0000949_833_1567 217
18 3300042007 Ga0439449_0000014 Ga0439449_0000014_43334_44068 217
19 3300048924 Ga0496121_0279831 Ga0496121_0279831_72_803 217
20 3300031911 Ga0307412_10000595 Ga0307412_1000059518 218
21 3300002774 JGI25150J39212_1000643 JGI25150J39212_10006432 220
22 3300003187 JGI25151J46595_10023515 JGI25151J46595_100235153 220
23 3300003215 JGI25153J46596_10018456 JGI25153J46596_100184561 220
24 3300025245 Ga0207425_1000484 Ga0207425_10004847 220
25 3300025294 Ga0209025_1002077 Ga0209025_100207720 220
26 3300025297 Ga0209758_1000489 Ga0209758_100048940 220
27 3300049584 Ga0501068_0361300 Ga0501068_0361300_164_889 220
28 3300053138 Ga0500564_081302 Ga0500564_081302_490_1242 221
29 3300053177 Ga0500636_0060106 Ga0500636_0060106_1026_1778 221
30 3300038443 Ga0395901_0343105 Ga0395901_0343105_18_689 222
31 3300042007 Ga0439449_0037619 Ga0439449_0037619_678_1412 222
32 3300042115 Ga0450911_018912 Ga0450911_018912_144_878 222
33 3300046454 Ga0495592_0451578 Ga0495592_0451578_126_794 222
34 3300002705 JGI25156J39149_1000038 JGI25156J39149_1000038116 223
35 3300002738 JGI25154J39366_1001243 JGI25154J39366_10012436 223
36 3300002741 JGI25157J39369_1000127 JGI25157J39369_100012717 223
37 3300003752 Ga0055539_1002307 Ga0055539_10023072 223
38 3300005339 Ga0070660_100096503 Ga0070660_1000965032 223
39 3300005539 Ga0068853_100112756 Ga0068853_1001127562 223
40 3300005563 Ga0068855_100432521 Ga0068855_1004325212 223
41 3300005577 Ga0068857_100001885 Ga0068857_10000188513 223
42 3300005614 Ga0068856_100005894 Ga0068856_1000058949 223
43 3300009093 Ga0105240_10247730 Ga0105240_102477302 223
44 3300009174 Ga0105241_10134780 Ga0105241_101347802 223
45 3300009551 Ga0105238_10071473 Ga0105238_100714734 223
46 3300013105 Ga0157369_10059033 Ga0157369_100590336 223
47 3300013307 Ga0157372_10459518 Ga0157372_104595182 223
48 3300025246 Ga0209646_1000094 Ga0209646_100009454 223
49 3300025250 Ga0209026_1000009 Ga0209026_1000009147 223
50 3300025253 Ga0209677_100097 Ga0209677_10009788 223
51 3300025256 Ga0209759_1000065 Ga0209759_1000065147 223
52 3300025913 Ga0207695_10166765 Ga0207695_101667652 223
53 3300025914 Ga0207671_10371265 Ga0207671_103712652 223
54 3300025919 Ga0207657_10108673 Ga0207657_101086732 223
55 3300025924 Ga0207694_10030681 Ga0207694_100306812 223
56 3300025949 Ga0207667_10149506 Ga0207667_101495062 223
57 3300025981 Ga0207640_10030508 Ga0207640_100305084 223
58 3300026041 Ga0207639_10055568 Ga0207639_100555682 223
59 3300026078 Ga0207702_10000610 Ga0207702_1000061033 223
60 3300028666 Ga0265336_10035474 Ga0265336_100354742 223
61 3300025256 Ga0209759_1003887 Ga0209759_10038872 224
62 3300046501 Ga0495607_0006297 Ga0495607_0006297_1387_2124 224
63 3300046507 Ga0495606_0000141 Ga0495606_0000141_83343_84080 224
64 3300046558 Ga0495633_0009262 Ga0495633_0009262_1581_2318 224
65 3300047444 Ga0495675_0097764 Ga0495675_0097764_227_961 224
66 3300048089 Ga0495614_0199754 Ga0495614_0199754_88_822 224
67 3300046526 Ga0495666_0040246 Ga0495666_0040246_1197_1931 225
68 3300003771 Ga0055526_1000066 Ga0055526_100006639 226
69 3300025295 Ga0209564_1000009 Ga0209564_1000009603 226
70 3300046491 Ga0495584_0000021 Ga0495584_0000021_120132_120866 227
71 3300046507 Ga0495606_0001419 Ga0495606_0001419_26161_26895 227
72 3300014969 Ga0157376_10412447 Ga0157376_104124472 228
73 3300032002 Ga0307416_100883448 Ga0307416_1008834482 228
74 3300046457 Ga0495590_0044275 Ga0495590_0044275_409_1143 228
75 3300046492 Ga0495585_0024974 Ga0495585_0024974_1906_2640 228
76 3300046501 Ga0495607_0031071 Ga0495607_0031071_239_973 228
77 3300046506 Ga0495583_0000060 Ga0495583_0000060_166364_167098 228
78 3300046513 Ga0495616_0041033 Ga0495616_0041033_1309_2043 228
79 3300046518 Ga0495631_0004837 Ga0495631_0004837_1957_2691 228
80 3300046519 Ga0495632_0004109 Ga0495632_0004109_1039_1773 228
81 3300046523 Ga0495644_0003908 Ga0495644_0003908_3093_3827 228
82 3300046538 Ga0495609_0016132 Ga0495609_0016132_388_1122 228
83 3300046648 Ga0495611_0004289 Ga0495611_0004289_2313_3047 228
84 3300046665 Ga0495661_0036819 Ga0495661_0036819_369_1103 228
85 3300046694 Ga0495649_0140133 Ga0495649_0140133_10_744 228
86 3300046794 Ga0495589_0002079 Ga0495589_0002079_6102_6836 228
87 3300046810 Ga0495660_0004026 Ga0495660_0004026_466_1200 228
88 3300047323 Ga0495683_0017927 Ga0495683_0017927_2491_3225 228
89 3300047470 Ga0495681_0007045 Ga0495681_0007045_980_1714 228
90 3300049459 Ga0495678_003240 Ga0495678_003240_5501_6235 228
91 3300028573 Ga0265334_10000500 Ga0265334_1000050019 229
92 3300044842 Ga0466957_0029147 Ga0466957_0029147_1319_2041 230
93 3300046474 Ga0495605_0000251 Ga0495605_0000251_42058_42795 230
94 3300046474 Ga0495605_0008057 Ga0495605_0008057_3929_4663 230
95 3300046491 Ga0495584_0019130 Ga0495584_0019130_466_1200 230
96 3300046501 Ga0495607_0007143 Ga0495607_0007143_3759_4493 230
97 3300046513 Ga0495616_0005947 Ga0495616_0005947_6082_6816 230
98 3300046528 Ga0495642_0195445 Ga0495642_0195445_42_776 230
99 3300046538 Ga0495609_0000039 Ga0495609_0000039_101070_101804 230
100 3300046665 Ga0495661_0000094 Ga0495661_0000094_5765_6499 230
101 3300046794 Ga0495589_0000019 Ga0495589_0000019_102841_103575 230
102 3300047443 Ga0495687_000059 Ga0495687_000059_101070_101804 230
103 3300047445 Ga0495677_0000006 Ga0495677_0000006_97427_98161 230
104 3300047445 Ga0495677_0000590 Ga0495677_0000590_8868_9602 230
105 3300048091 Ga0495626_0000494 Ga0495626_0000494_22129_22863 230
106 3300037418 Ga0395900_0000343 Ga0395900_0000343_45451_46185 231
107 3300038443 Ga0395901_0000033 Ga0395901_0000033_18734_19468 231
108 3300048091 Ga0495626_0008460 Ga0495626_0008460_424_1158 231
109 3300049760 Ga0501263_007207 Ga0501263_007207_451_1179 231
110 3300028666 Ga0265336_10000061 Ga0265336_1000006143 232
111 3300029957 Ga0265324_10001696 Ga0265324_100016969 232
112 3300049705 Ga0501225_0037693 Ga0501225_0037693_427_1161 232
113 3300030744 Ga0316181_1163091 Ga0316181_11630912 233
114 3300044706 Ga0466964_0000727 Ga0466964_0000727_9869_10603 233
115 3300044712 Ga0453684_0452472 Ga0453684_0452472_335_1069 233
116 3300045976 Ga0466967_0010517 Ga0466967_0010517_596_1330 233
117 3300046522 Ga0495643_0011258 Ga0495643_0011258_759_1493 233
118 3300048091 Ga0495626_0039518 Ga0495626_0039518_84_818 233
119 3300009036 Ga0105244_10010768 Ga0105244_100107684 235
120 3300009092 Ga0105250_10003510 Ga0105250_100035105 235
121 3300009553 Ga0105249_10004745 Ga0105249_100047456 235
122 3300013102 Ga0157371_10187003 Ga0157371_101870032 235
123 3300035410 Ga0373924_0191022 Ga0373924_0191022_156_884 235
124 3300036401 Ga0373937_0080873 Ga0373937_0080873_312_1040 235
125 3300042007 Ga0439449_0058479 Ga0439449_0058479_694_1404 236
126 3300048907 Ga0496104_0681864 Ga0496104_0681864_16_726 236
127 3300050513 nmdc:mga0rr50_476448_c1 nmdc:mga0rr50_476448_c1_61_771 236
128 iso_pu_bacteria 2597490356 2599105455 236
129 iso_pu_bacteria 2648501241 2649122548 236
130 iso_pu_bacteria 2651869818 2652976069 236
131 iso_pu_bacteria 2846952575 2846954861 236
132 iso_pu_bacteria 2848858292 2848860465 236
133 iso_pu_bacteria 2883354860 2883357790 236
134 iso_pu_bacteria 2919493220 2919493772 236
135 iso_pu_bacteria 2919497567 2919500914 236
136 iso_pu_bacteria 2919543075 2919545656 236
137 3300005564 Ga0070664_100014986 Ga0070664_1000149862 237
138 3300005578 Ga0068854_100370055 Ga0068854_1003700552 237
139 3300005614 Ga0068856_100289864 Ga0068856_1002898643 237
140 3300005616 Ga0068852_100225294 Ga0068852_1002252943 237
141 3300009551 Ga0105238_10025802 Ga0105238_100258024 237
142 3300009551 Ga0105238_10626828 Ga0105238_106268282 237
143 3300013100 Ga0157373_10397048 Ga0157373_103970482 237
144 3300013102 Ga0157371_10469304 Ga0157371_104693042 237
145 3300025303 Ga0209051_1045522 Ga0209051_10455222 237
146 3300025920 Ga0207649_10077159 Ga0207649_100771593 237
147 3300026078 Ga0207702_10068751 Ga0207702_100687513 237
148 3300026142 Ga0207698_10169060 Ga0207698_101690602 237
149 3300037312 Ga0395899_0014968 Ga0395899_0014968_4422_5135 237
150 3300037312 Ga0395899_0069039 Ga0395899_0069039_1347_2063 237
151 3300037418 Ga0395900_0038690 Ga0395900_0038690_93_809 237
152 3300037466 Ga0395898_0140996 Ga0395898_0140996_332_1045 237
153 3300038443 Ga0395901_0010919 Ga0395901_0010919_1442_2158 237
154 iso_pu_bacteria 2511231010 2511288796 237
155 iso_pu_bacteria 2593339238 2595446876 237
156 iso_pu_bacteria 2639762793 2640736784 237
157 iso_pu_bacteria 2643221621 2644123872 237
158 iso_pu_bacteria 2643221665 2644364163 237
159 iso_pu_bacteria 2675903507 2678230175 237
160 iso_pu_bacteria 2744054655 2745159466 237
161 iso_pu_bacteria 2773857761 2774390699 237
162 iso_pu_bacteria 2773857770 2774438268 237
163 iso_pu_bacteria 2811994881 2812370169 237
164 iso_pu_bacteria 2842914999 2842917581 237
165 iso_pu_bacteria 2916699645 2916700014 237
166 iso_pu_bacteria 2919063839 2919066162 237
167 iso_pu_bacteria 2919085039 2919088251 237
168 iso_pu_bacteria 2919182534 2919184900 237
169 iso_pu_bacteria 2919404418 2919406162 237
170 iso_pu_bacteria 2923519811 2923524260 237
171 iso_pu_bacteria 2941471342 2941472999 237
172 iso_pu_bacteria 2984568884 2984570869 237
173 iso_pu_bacteria 2990196909 2990199589 237
174 iso_pu_bacteria 3007718800 3007721213 237
175 3300046475 Ga0495639_0075418 Ga0495639_0075418_793_1509 238
176 3300046558 Ga0495633_0034772 Ga0495633_0034772_1229_1948 238
177 3300047469 Ga0495673_0000006 Ga0495673_0000006_613793_614512 238
178 3300047469 Ga0495673_0000024 Ga0495673_0000024_252596_253315 238
179 3300048914 Ga0496111_0305982 Ga0496111_0305982_211_930 238
180 iso_pu_bacteria 2599185292 2599906823 238
181 iso_pu_bacteria 2891633521 2891634702 238
182 iso_pu_bacteria 2989392574 2989393238 238
183 iso_pu_bacteria 8001522603 8001522611 238
184 3300006852 Ga0075433_10082756 Ga0075433_100827563 239
185 3300048917 Ga0496114_0018872 Ga0496114_0018872_3445_4167 239
186 3300050515 nmdc:mga0a205_52399_c1 nmdc:mga0a205_52399_c1_365_1087 239
187 iso_pu_bacteria 2816332141 2816517960 239
188 iso_pu_bacteria 2842391507 2842394079 239
189 iso_pu_bacteria 2842711865 2842714484 239
190 iso_pu_bacteria 2857564685 2857565153 239
191 iso_pu_bacteria 2961064222 2961064387 239
192 iso_pu_bacteria 8057160832 8057163249 239
193 3300003323 rootH1_10012135 rootH1_1001213511 240
194 3300003775 Ga0055524_1017692 Ga0055524_10176922 240
195 3300003794 Ga0055531_10021626 Ga0055531_100216262 240
196 3300005288 Ga0065714_10078862 Ga0065714_100788622 240
197 3300005354 Ga0070675_100129920 Ga0070675_1001299203 240
198 3300006358 Ga0068871_100053807 Ga0068871_1000538072 240
199 3300009098 Ga0105245_10383942 Ga0105245_103839421 240
200 3300031456 Ga0307513_10058089 Ga0307513_100580893 240
201 3300031616 Ga0307508_10078804 Ga0307508_100788043 240
202 3300031824 Ga0307413_10088180 Ga0307413_100881802 240
203 3300031995 Ga0307409_100710376 Ga0307409_1007103761 240
204 3300032005 Ga0307411_10139350 Ga0307411_101393502 240
205 3300036401 Ga0373937_0097205 Ga0373937_0097205_1251_1976 240
206 3300041494 Ga0451837_0176909 Ga0451837_0176909_51_791 240
207 3300042876 Ga0451577_0232380 Ga0451577_0232380_933_1658 240
208 3300044712 Ga0453684_0006727 Ga0453684_0006727_20512_21237 240
209 3300045836 Ga0466958_0026361 Ga0466958_0026361_808_1533 240
210 3300046454 Ga0495592_0141801 Ga0495592_0141801_289_1014 240
211 3300046499 Ga0495594_0044138 Ga0495594_0044138_1469_2194 240
212 3300047315 Ga0495581_0319056 Ga0495581_0319056_16_741 240
213 3300049571 Ga0501034_0128376 Ga0501034_0128376_1674_2399 240
214 3300049575 Ga0501039_0544289 Ga0501039_0544289_78_806 240
215 3300049593 Ga0501077_0151048 Ga0501077_0151048_532_1260 240
216 3300049742 Ga0501080_0167775 Ga0501080_0167775_827_1552 240
217 3300049744 Ga0501083_0041654 Ga0501083_0041654_1373_2098 240
218 3300053077 Ga0495601_0011605 Ga0495601_0011605_4169_4894 240
219 3300060353 Ga0501082_0042873 Ga0501082_0042873_1249_1974 240
220 iso_pu_bacteria 2643221581 2643916617 240
221 iso_pu_bacteria 2738541276 2738714087 240
222 iso_pu_bacteria 2917832318 2917836389 240
223 iso_pu_bacteria 2923516293 2923518393 240
224 3300002705 JGI25156J39149_1004474 JGI25156J39149_10044743 241
225 3300002741 JGI25157J39369_1001386 JGI25157J39369_10013863 241
226 3300003752 Ga0055539_1005513 Ga0055539_10055132 241
227 3300003756 Ga0055533_1001462 Ga0055533_10014622 241
228 3300003759 Ga0055525_1000027 Ga0055525_1000027232 241
229 3300003760 Ga0055527_1000199 Ga0055527_100019914 241
230 3300003760 Ga0055527_1000212 Ga0055527_100021214 241
231 3300003761 Ga0055535_1000585 Ga0055535_100058517 241
232 3300003761 Ga0055535_1000854 Ga0055535_100085418 241
233 3300003761 Ga0055535_1001004 Ga0055535_100100420 241
234 3300003762 Ga0055542_1000647 Ga0055542_100064722 241
235 3300003762 Ga0055542_1000687 Ga0055542_10006875 241
236 3300003762 Ga0055542_1000693 Ga0055542_10006936 241
237 3300003763 Ga0055529_1000590 Ga0055529_100059023 241
238 3300003763 Ga0055529_1001016 Ga0055529_10010163 241
239 3300003856 Ga0058692_1000008 Ga0058692_100000898 241
240 3300005272 Ga0065703_1000102 Ga0065703_100010234 241
241 3300005288 Ga0065714_10092344 Ga0065714_100923443 241
242 3300005289 Ga0065704_10011917 Ga0065704_100119172 241
243 3300005289 Ga0065704_10017134 Ga0065704_100171342 241
244 3300005289 Ga0065704_10021739 Ga0065704_100217392 241
245 3300005330 Ga0070690_100002403 Ga0070690_1000024037 241
246 3300005331 Ga0070670_100124570 Ga0070670_1001245702 241
247 3300005331 Ga0070670_100480735 Ga0070670_1004807351 241
248 3300005334 Ga0068869_100026093 Ga0068869_1000260936 241
249 3300005337 Ga0070682_100025981 Ga0070682_1000259815 241
250 3300005337 Ga0070682_100204144 Ga0070682_1002041442 241
251 3300005337 Ga0070682_100472669 Ga0070682_1004726692 241
252 3300005338 Ga0068868_100015104 Ga0068868_1000151045 241
253 3300005340 Ga0070689_100000069 Ga0070689_10000006932 241
254 3300005343 Ga0070687_100003030 Ga0070687_1000030307 241
255 3300005344 Ga0070661_100003084 Ga0070661_1000030848 241
256 3300005345 Ga0070692_10008974 Ga0070692_100089742 241
257 3300005353 Ga0070669_100000284 Ga0070669_10000028417 241
258 3300005353 Ga0070669_100001965 Ga0070669_1000019653 241
259 3300005353 Ga0070669_100105807 Ga0070669_1001058072 241
260 3300005353 Ga0070669_100113047 Ga0070669_1001130472 241
261 3300005353 Ga0070669_100614449 Ga0070669_1006144492 241
262 3300005354 Ga0070675_100003503 Ga0070675_1000035038 241
263 3300005354 Ga0070675_100023546 Ga0070675_1000235466 241
264 3300005355 Ga0070671_100019760 Ga0070671_1000197602 241
265 3300005356 Ga0070674_100036098 Ga0070674_1000360983 241
266 3300005364 Ga0070673_100000741 Ga0070673_1000007412 241
267 3300005364 Ga0070673_100144447 Ga0070673_1001444472 241
268 3300005365 Ga0070688_100008091 Ga0070688_1000080916 241
269 3300005437 Ga0070710_10029220 Ga0070710_100292203 241
270 3300005439 Ga0070711_100039163 Ga0070711_1000391633 241
271 3300005440 Ga0070705_100012699 Ga0070705_1000126995 241
272 3300005441 Ga0070700_100018379 Ga0070700_1000183795 241
273 3300005444 Ga0070694_100183238 Ga0070694_1001832382 241
274 3300005456 Ga0070678_100005340 Ga0070678_1000053402 241
275 3300005466 Ga0070685_10003995 Ga0070685_100039956 241
276 3300005471 Ga0070698_100199509 Ga0070698_1001995091 241
277 3300005530 Ga0070679_100255993 Ga0070679_1002559932 241
278 3300005535 Ga0070684_100000781 Ga0070684_10000078114 241
279 3300005535 Ga0070684_100716953 Ga0070684_1007169532 241
280 3300005536 Ga0070697_100238764 Ga0070697_1002387642 241
281 3300005543 Ga0070672_100016820 Ga0070672_1000168206 241
282 3300005543 Ga0070672_100171541 Ga0070672_1001715412 241
283 3300005544 Ga0070686_100000961 Ga0070686_1000009618 241
284 3300005546 Ga0070696_100300039 Ga0070696_1003000392 241
285 3300005548 Ga0070665_100003202 Ga0070665_1000032022 241
286 3300005548 Ga0070665_100038519 Ga0070665_1000385196 241
287 3300005548 Ga0070665_100721120 Ga0070665_1007211202 241
288 3300005577 Ga0068857_100308190 Ga0068857_1003081902 241
289 3300005614 Ga0068856_100001666 Ga0068856_1000016668 241
290 3300005615 Ga0070702_100002116 Ga0070702_1000021164 241
291 3300005617 Ga0068859_100000317 Ga0068859_10000031736 241
292 3300005618 Ga0068864_100001409 Ga0068864_1000014096 241
293 3300005718 Ga0068866_10026887 Ga0068866_100268872 241
294 3300005719 Ga0068861_100002710 Ga0068861_10000271011 241
295 3300005719 Ga0068861_100043657 Ga0068861_1000436574 241
296 3300005840 Ga0068870_10002367 Ga0068870_100023676 241
297 3300005841 Ga0068863_100001571 Ga0068863_1000015716 241
298 3300005842 Ga0068858_100010524 Ga0068858_1000105248 241
299 3300005843 Ga0068860_100495030 Ga0068860_1004950302 241
300 3300005844 Ga0068862_100003232 Ga0068862_1000032326 241
301 3300005844 Ga0068862_100010476 Ga0068862_1000104762 241
302 3300005844 Ga0068862_100071209 Ga0068862_1000712093 241
303 3300006051 Ga0075364_10191044 Ga0075364_101910442 241
304 3300006173 Ga0070716_100052090 Ga0070716_1000520903 241
305 3300006173 Ga0070716_100216682 Ga0070716_1002166822 241
306 3300006237 Ga0097621_100636088 Ga0097621_1006360882 241
307 3300006358 Ga0068871_100057038 Ga0068871_1000570384 241
308 3300006844 Ga0075428_100019852 Ga0075428_1000198522 241
309 3300006844 Ga0075428_100026168 Ga0075428_1000261684 241
310 3300006846 Ga0075430_100027879 Ga0075430_1000278796 241
311 3300006847 Ga0075431_100034434 Ga0075431_1000344341 241
312 3300006847 Ga0075431_100142209 Ga0075431_1001422092 241
313 3300006852 Ga0075433_10097948 Ga0075433_100979483 241
314 3300006852 Ga0075433_10169031 Ga0075433_101690312 241
315 3300006852 Ga0075433_10228962 Ga0075433_102289622 241
316 3300006871 Ga0075434_100010704 Ga0075434_1000107042 241
317 3300006871 Ga0075434_100148522 Ga0075434_1001485222 241
318 3300006880 Ga0075429_100257238 Ga0075429_1002572382 241
319 3300006881 Ga0068865_100234637 Ga0068865_1002346371 241
320 3300006914 Ga0075436_100086434 Ga0075436_1000864342 241
321 3300006931 Ga0097620_100000317 Ga0097620_10000031736 241
322 3300007076 Ga0075435_100323353 Ga0075435_1003233531 241
323 3300009011 Ga0105251_10019832 Ga0105251_100198323 241
324 3300009036 Ga0105244_10012197 Ga0105244_100121975 241
325 3300009036 Ga0105244_10201406 Ga0105244_102014062 241
326 3300009036 Ga0105244_10223513 Ga0105244_102235132 241
327 3300009093 Ga0105240_10006451 Ga0105240_1000645118 241
328 3300009094 Ga0111539_10016158 Ga0111539_100161586 241
329 3300009094 Ga0111539_10050989 Ga0111539_100509894 241
330 3300009094 Ga0111539_11203802 Ga0111539_112038021 241
331 3300009098 Ga0105245_10243483 Ga0105245_102434833 241
332 3300009101 Ga0105247_10024284 Ga0105247_100242843 241
333 3300009147 Ga0114129_10002450 Ga0114129_100024504 241
334 3300009147 Ga0114129_10141222 Ga0114129_101412225 241
335 3300009147 Ga0114129_10152994 Ga0114129_101529944 241
336 3300009147 Ga0114129_10223215 Ga0114129_102232152 241
337 3300009148 Ga0105243_10000041 Ga0105243_1000004152 241
338 3300009148 Ga0105243_10129664 Ga0105243_101296642 241
339 3300009177 Ga0105248_10004710 Ga0105248_1000471013 241
340 3300009553 Ga0105249_10057978 Ga0105249_100579784 241
341 3300009553 Ga0105249_10234890 Ga0105249_102348902 241
342 3300010375 Ga0105239_10079565 Ga0105239_100795654 241
343 3300013104 Ga0157370_10024113 Ga0157370_100241133 241
344 3300013104 Ga0157370_10168583 Ga0157370_101685831 241
345 3300013306 Ga0163162_10037464 Ga0163162_100374645 241
346 3300013308 Ga0157375_10041689 Ga0157375_100416892 241
347 3300014325 Ga0163163_10000326 Ga0163163_100003265 241
348 3300014326 Ga0157380_10130310 Ga0157380_101303102 241
349 3300014745 Ga0157377_10001044 Ga0157377_100010445 241
350 3300014968 Ga0157379_10038697 Ga0157379_100386973 241
351 3300014969 Ga0157376_10214509 Ga0157376_102145092 241
352 3300015262 Ga0182007_10010952 Ga0182007_100109522 241
353 3300015265 Ga0182005_1000070 Ga0182005_100007050 241
354 3300025226 Ga0209674_100086 Ga0209674_100086124 241
355 3300025226 Ga0209674_100654 Ga0209674_10065412 241
356 3300025228 Ga0209672_100005 Ga0209672_100005733 241
357 3300025228 Ga0209672_100029 Ga0209672_100029237 241
358 3300025228 Ga0209672_101479 Ga0209672_1014792 241
359 3300025230 Ga0209563_100023 Ga0209563_100023392 241
360 3300025233 Ga0209437_101634 Ga0209437_1016344 241
361 3300025242 Ga0209258_100006 Ga0209258_100006733 241
362 3300025242 Ga0209258_100053 Ga0209258_10005393 241
363 3300025242 Ga0209258_100064 Ga0209258_100064263 241
364 3300025250 Ga0209026_1000074 Ga0209026_1000074189 241
365 3300025253 Ga0209677_101749 Ga0209677_1017493 241
366 3300025254 Ga0209148_1000009 Ga0209148_1000009237 241
367 3300025254 Ga0209148_1000012 Ga0209148_1000012733 241
368 3300025254 Ga0209148_1000142 Ga0209148_100014224 241
369 3300025254 Ga0209148_1002194 Ga0209148_10021947 241
370 3300025256 Ga0209759_1003009 Ga0209759_10030093 241
371 3300025272 Ga0209455_1000008 Ga0209455_1000008733 241
372 3300025272 Ga0209455_1000060 Ga0209455_1000060237 241
373 3300025272 Ga0209455_1007600 Ga0209455_10076002 241
374 3300025711 Ga0207696_1009948 Ga0207696_10099482 241
375 3300025728 Ga0207655_1000951 Ga0207655_100095112 241
376 3300025728 Ga0207655_1001090 Ga0207655_100109022 241
377 3300025728 Ga0207655_1001100 Ga0207655_100110022 241
378 3300025899 Ga0207642_10002405 Ga0207642_100024054 241
379 3300025900 Ga0207710_10000021 Ga0207710_1000002173 241
380 3300025907 Ga0207645_10041524 Ga0207645_100415242 241
381 3300025908 Ga0207643_10002940 Ga0207643_100029407 241
382 3300025913 Ga0207695_10036390 Ga0207695_100363905 241
383 3300025915 Ga0207693_10077952 Ga0207693_100779522 241
384 3300025918 Ga0207662_10018978 Ga0207662_100189783 241
385 3300025919 Ga0207657_10014943 Ga0207657_100149439 241
386 3300025920 Ga0207649_10165720 Ga0207649_101657202 241
387 3300025921 Ga0207652_10213965 Ga0207652_102139652 241
388 3300025923 Ga0207681_10000437 Ga0207681_100004375 241
389 3300025923 Ga0207681_10047262 Ga0207681_100472623 241
390 3300025923 Ga0207681_10306878 Ga0207681_103068782 241
391 3300025925 Ga0207650_10118468 Ga0207650_101184682 241
392 3300025926 Ga0207659_10004743 Ga0207659_100047436 241
393 3300025926 Ga0207659_10048719 Ga0207659_100487192 241
394 3300025933 Ga0207706_10007482 Ga0207706_1000748211 241
395 3300025933 Ga0207706_10015852 Ga0207706_100158524 241
396 3300025935 Ga0207709_10000023 Ga0207709_10000023254 241
397 3300025935 Ga0207709_10014130 Ga0207709_100141302 241
398 3300025936 Ga0207670_10003260 Ga0207670_100032606 241
399 3300025937 Ga0207669_10043554 Ga0207669_100435543 241
400 3300025938 Ga0207704_10219976 Ga0207704_102199762 241
401 3300025938 Ga0207704_10278258 Ga0207704_102782583 241
402 3300025939 Ga0207665_10073551 Ga0207665_100735512 241
403 3300025940 Ga0207691_10013436 Ga0207691_100134362 241
404 3300025940 Ga0207691_10118786 Ga0207691_101187862 241
405 3300025941 Ga0207711_10003822 Ga0207711_100038226 241
406 3300025942 Ga0207689_10003105 Ga0207689_1000310513 241
407 3300025961 Ga0207712_10003212 Ga0207712_100032128 241
408 3300025961 Ga0207712_10037163 Ga0207712_100371634 241
409 3300025961 Ga0207712_10136360 Ga0207712_101363602 241
410 3300025986 Ga0207658_10008297 Ga0207658_100082976 241
411 3300026023 Ga0207677_10058547 Ga0207677_100585472 241
412 3300026035 Ga0207703_10033193 Ga0207703_100331932 241
413 3300026075 Ga0207708_10032862 Ga0207708_100328624 241
414 3300026078 Ga0207702_10001392 Ga0207702_1000139221 241
415 3300026088 Ga0207641_10003999 Ga0207641_1000399910 241
416 3300026089 Ga0207648_10023478 Ga0207648_100234787 241
417 3300026095 Ga0207676_10001771 Ga0207676_1000177111 241
418 3300026116 Ga0207674_10045014 Ga0207674_100450146 241
419 3300026118 Ga0207675_100009624 Ga0207675_1000096248 241
420 3300026118 Ga0207675_100065976 Ga0207675_1000659764 241
421 3300026121 Ga0207683_10156162 Ga0207683_101561622 241
422 3300026121 Ga0207683_10249688 Ga0207683_102496882 241
423 3300026142 Ga0207698_10329580 Ga0207698_103295802 241
424 3300027312 Ga0209371_1000038 Ga0209371_100003895 241
425 3300027876 Ga0209974_10022065 Ga0209974_100220651 241
426 3300027907 Ga0207428_10368226 Ga0207428_103682262 241
427 3300028379 Ga0268266_10002128 Ga0268266_100021289 241
428 3300028379 Ga0268266_10021170 Ga0268266_100211702 241
429 3300028380 Ga0268265_10003134 Ga0268265_1000313413 241
430 3300028380 Ga0268265_10007277 Ga0268265_100072776 241
431 3300028380 Ga0268265_10071349 Ga0268265_100713493 241
432 3300028381 Ga0268264_10266016 Ga0268264_102660162 241
433 3300028577 Ga0265318_10102895 Ga0265318_101028952 241
434 3300030500 Ga0268256_1000038 Ga0268256_100003895 241
435 3300031242 Ga0265329_10022329 Ga0265329_100223293 241
436 3300031251 Ga0265327_10102697 Ga0265327_101026972 241
437 3300031344 Ga0265316_10059388 Ga0265316_100593883 241
438 3300032004 Ga0307414_10196823 Ga0307414_101968232 241
439 3300034819 Ga0373958_0004705 Ga0373958_0004705_619_1347 241
440 3300037312 Ga0395899_0000108 Ga0395899_0000108_21251_21979 241
441 3300037312 Ga0395899_0011520 Ga0395899_0011520_5908_6636 241
442 3300037418 Ga0395900_0000755 Ga0395900_0000755_17661_18389 241
443 3300037418 Ga0395900_0167389 Ga0395900_0167389_613_1338 241
444 3300037466 Ga0395898_0000018 Ga0395898_0000018_392631_393359 241
445 3300037466 Ga0395898_0000049 Ga0395898_0000049_248372_249100 241
446 3300038443 Ga0395901_0014131 Ga0395901_0014131_4782_5507 241
447 3300038443 Ga0395901_0117270 Ga0395901_0117270_1875_2600 241
448 3300038443 Ga0395901_0149159 Ga0395901_0149159_1691_2419 241
449 3300038443 Ga0395901_0239271 Ga0395901_0239271_501_1229 241
450 3300041411 Ga0439466_0045527 Ga0439466_0045527_30_755 241
451 3300042876 Ga0451577_0117106 Ga0451577_0117106_534_1259 241
452 3300042876 Ga0451577_0665839 Ga0451577_0665839_55_783 241
453 3300044656 Ga0466969_0014958 Ga0466969_0014958_1899_2627 241
454 3300044656 Ga0466969_0015853 Ga0466969_0015853_678_1406 241
455 3300044684 Ga0466966_0019976 Ga0466966_0019976_381_1109 241
456 3300044693 Ga0466961_0000617 Ga0466961_0000617_6431_7159 241
457 3300044693 Ga0466961_0020355 Ga0466961_0020355_2284_3012 241
458 3300044694 Ga0466963_0081589 Ga0466963_0081589_1334_2062 241
459 3300044706 Ga0466964_0051920 Ga0466964_0051920_61_789 241
460 3300044712 Ga0453684_0256310 Ga0453684_0256310_488_1213 241
461 3300044719 Ga0466971_0098234 Ga0466971_0098234_23_751 241
462 3300044842 Ga0466957_0139197 Ga0466957_0139197_258_986 241
463 3300044901 Ga0466960_0080842 Ga0466960_0080842_275_1003 241
464 3300045049 Ga0466959_0000347 Ga0466959_0000347_16365_17093 241
465 3300045049 Ga0466959_0001870 Ga0466959_0001870_3000_3728 241
466 3300045051 Ga0451576_0034629 Ga0451576_0034629_2713_3441 241
467 3300045051 Ga0451576_0572900 Ga0451576_0572900_182_907 241
468 3300045051 Ga0451576_0587255 Ga0451576_0587255_272_1003 241
469 3300045051 Ga0451576_0957821 Ga0451576_0957821_116_841 241
470 3300045836 Ga0466958_0038431 Ga0466958_0038431_502_1230 241
471 3300046492 Ga0495585_0000772 Ga0495585_0000772_9586_10314 241
472 3300046501 Ga0495607_0000298 Ga0495607_0000298_23348_24088 241
473 3300046507 Ga0495606_0008626 Ga0495606_0008626_2850_3578 241
474 3300046512 Ga0495610_0001476 Ga0495610_0001476_5980_6708 241
475 3300046513 Ga0495616_0000036 Ga0495616_0000036_54193_54921 241
476 3300046519 Ga0495632_0074080 Ga0495632_0074080_879_1604 241
477 3300046520 Ga0495637_0001597 Ga0495637_0001597_4273_5001 241
478 3300046522 Ga0495643_0091541 Ga0495643_0091541_121_846 241
479 3300046525 Ga0495663_0000299 Ga0495663_0000299_16126_16851 241
480 3300046525 Ga0495663_0006649 Ga0495663_0006649_1561_2286 241
481 3300046558 Ga0495633_0001297 Ga0495633_0001297_12500_13225 241
482 3300046664 Ga0495659_0000054 Ga0495659_0000054_31727_32452 241
483 3300046691 Ga0495670_0010366 Ga0495670_0010366_1738_2466 241
484 3300046692 Ga0495671_0000314 Ga0495671_0000314_16169_16894 241
485 3300046692 Ga0495671_0001195 Ga0495671_0001195_1989_2714 241
486 3300047318 Ga0495636_0168335 Ga0495636_0168335_211_942 241
487 3300047320 Ga0495672_0028738 Ga0495672_0028738_1790_2515 241
488 3300047323 Ga0495683_0003818 Ga0495683_0003818_1863_2591 241
489 3300047472 Ga0495686_0000295 Ga0495686_0000295_67006_67734 241
490 3300047472 Ga0495686_0059195 Ga0495686_0059195_277_1032 241
491 3300048903 Ga0496100_0003016 Ga0496100_0003016_2686_3414 241
492 3300048904 Ga0496101_0002894 Ga0496101_0002894_911_1639 241
493 3300048905 Ga0496102_0038216 Ga0496102_0038216_2630_3358 241
494 3300048909 Ga0496106_0037602 Ga0496106_0037602_2722_3450 241
495 3300048911 Ga0496108_0198824 Ga0496108_0198824_806_1534 241
496 3300048912 Ga0496109_0020721 Ga0496109_0020721_1215_1943 241
497 3300048912 Ga0496109_0208907 Ga0496109_0208907_410_1135 241
498 3300048913 Ga0496110_0069311 Ga0496110_0069311_1562_2290 241
499 3300048915 Ga0496112_0046686 Ga0496112_0046686_2657_3385 241
500 3300048924 Ga0496121_0000372 Ga0496121_0000372_54114_54842 241
501 3300048924 Ga0496121_0005323 Ga0496121_0005323_13614_14342 241
502 3300048925 Ga0496122_0067755 Ga0496122_0067755_23_751 241
503 3300048926 Ga0496123_0008827 Ga0496123_0008827_566_1294 241
504 3300048926 Ga0496123_0043490 Ga0496123_0043490_348_1076 241
505 3300050507 nmdc:mga05p37_267918_c1 nmdc:mga05p37_267918_c1_1253_1978 241
506 3300050507 nmdc:mga05p37_404326_c1 nmdc:mga05p37_404326_c1_358_1086 241
507 3300050509 nmdc:mga0qj67_11460_c1 nmdc:mga0qj67_11460_c1_3452_4180 241
508 3300050510 nmdc:mga06r32_284767_c1 nmdc:mga06r32_284767_c1_576_1304 241
509 3300050510 nmdc:mga06r32_7200_c1 nmdc:mga06r32_7200_c1_2345_3073 241
510 3300050511 nmdc:mga08y16_152674_c1 nmdc:mga08y16_152674_c1_483_1211 241
511 3300050511 nmdc:mga08y16_37616_c1 nmdc:mga08y16_37616_c1_719_1447 241
512 3300050511 nmdc:mga08y16_620848_c1 nmdc:mga08y16_620848_c1_297_1022 241
513 3300050512 nmdc:mga0n895_135667_c1 nmdc:mga0n895_135667_c1_1541_2269 241
514 3300050512 nmdc:mga0n895_2762_c1 nmdc:mga0n895_2762_c1_10688_11413 241
515 3300050515 nmdc:mga0a205_179577_c1 nmdc:mga0a205_179577_c1_204_929 241
516 3300050515 nmdc:mga0a205_248209_c1 nmdc:mga0a205_248209_c1_810_1535 241
517 3300050515 nmdc:mga0a205_56645_c1 nmdc:mga0a205_56645_c1_2726_3451 241
518 3300061719 Ga0466962_0016392 Ga0466962_0016392_450_1178 241
519 iso_pu_bacteria 2521172590 2521559630 241
520 iso_pu_bacteria 2548876994 2550696103 241
521 iso_pu_bacteria 2884811622 2884816676 241
522 iso_pu_bacteria 2884836552 2884840344 241
523 iso_pu_bacteria 2884852848 2884855600 241
524 iso_pu_bacteria 2896154374 2896157474 241
525 iso_pu_bacteria 2928130867 2928134054 241
526 iso_pu_bacteria 8054357960 8054358215 241
527 3300030735 Ga0316178_1028084 Ga0316178_10280842 242
528 3300030742 Ga0316183_1175186 Ga0316183_11751865 242
529 3300031251 Ga0265327_10001649 Ga0265327_1000164918 242
530 3300049570 Ga0501033_0059786 Ga0501033_0059786_541_1272 242
531 3300049822 Ga0501035_0028900 Ga0501035_0028900_2294_3025 242
532 3300049823 Ga0501044_0000065 Ga0501044_0000065_119470_120201 242
533 3300002738 JGI25154J39366_1001369 JGI25154J39366_10013694 243
534 3300002774 JGI25150J39212_1008972 JGI25150J39212_10089723 243
535 3300005563 Ga0068855_100046672 Ga0068855_1000466726 243
536 3300009036 Ga0105244_10002091 Ga0105244_100020916 243
537 3300021361 Ga0213872_10004418 Ga0213872_100044183 243
538 3300025728 Ga0207655_1011371 Ga0207655_10113712 243
539 3300028794 Ga0307515_10072544 Ga0307515_100725445 243
540 3300039447 Ga0436361_0009597 Ga0436361_0009597_19837_20571 243
541 3300039447 Ga0436361_0809540 Ga0436361_0809540_851_1594 243
542 3300046452 Ga0495617_003902 Ga0495617_003902_2549_3286 243
543 3300046457 Ga0495590_0000003 Ga0495590_0000003_397592_398329 243
544 3300046460 Ga0495638_0000091 Ga0495638_0000091_101779_102516 243
545 3300046460 Ga0495638_0004653 Ga0495638_0004653_2604_3341 243
546 3300046471 Ga0495650_0000097 Ga0495650_0000097_57871_58608 243
547 3300046471 Ga0495650_0001058 Ga0495650_0001058_7014_7751 243
548 3300046475 Ga0495639_0010865 Ga0495639_0010865_1886_2623 243
549 3300046491 Ga0495584_0029967 Ga0495584_0029967_1346_2083 243
550 3300046492 Ga0495585_0008458 Ga0495585_0008458_457_1194 243
551 3300046492 Ga0495585_0174666 Ga0495585_0174666_24_761 243
552 3300046501 Ga0495607_0001875 Ga0495607_0001875_12904_13641 243
553 3300046506 Ga0495583_0000155 Ga0495583_0000155_15056_15793 243
554 3300046506 Ga0495583_0000197 Ga0495583_0000197_57326_58063 243
555 3300046507 Ga0495606_0000371 Ga0495606_0000371_53904_54641 243
556 3300046507 Ga0495606_0000461 Ga0495606_0000461_58891_59628 243
557 3300046507 Ga0495606_0002328 Ga0495606_0002328_53_790 243
558 3300046507 Ga0495606_0018254 Ga0495606_0018254_853_1590 243
559 3300046507 Ga0495606_0253326 Ga0495606_0253326_186_923 243
560 3300046512 Ga0495610_0000003 Ga0495610_0000003_94258_94995 243
561 3300046512 Ga0495610_0004645 Ga0495610_0004645_8562_9299 243
562 3300046512 Ga0495610_0010298 Ga0495610_0010298_2938_3675 243
563 3300046522 Ga0495643_0000179 Ga0495643_0000179_38254_38991 243
564 3300046522 Ga0495643_0000287 Ga0495643_0000287_58153_58890 243
565 3300046522 Ga0495643_0069626 Ga0495643_0069626_144_881 243
566 3300046523 Ga0495644_0002342 Ga0495644_0002342_5651_6388 243
567 3300046523 Ga0495644_0034344 Ga0495644_0034344_1107_1844 243
568 3300046524 Ga0495648_0000058 Ga0495648_0000058_90123_90860 243
569 3300046524 Ga0495648_0012123 Ga0495648_0012123_1166_1903 243
570 3300046524 Ga0495648_0032542 Ga0495648_0032542_2094_2831 243
571 3300046528 Ga0495642_0000223 Ga0495642_0000223_6315_7052 243
572 3300046538 Ga0495609_0080768 Ga0495609_0080768_72_809 243
573 3300046538 Ga0495609_0084539 Ga0495609_0084539_35_772 243
574 3300046542 Ga0495597_0000209 Ga0495597_0000209_37344_38081 243
575 3300046542 Ga0495597_0000242 Ga0495597_0000242_29954_30691 243
576 3300046557 Ga0495622_0000468 Ga0495622_0000468_10320_11057 243
577 3300046558 Ga0495633_0000119 Ga0495633_0000119_69032_69769 243
578 3300046558 Ga0495633_0000249 Ga0495633_0000249_19398_20135 243
579 3300046558 Ga0495633_0002317 Ga0495633_0002317_10036_10773 243
580 3300046558 Ga0495633_0117770 Ga0495633_0117770_53_790 243
581 3300046615 Ga0495656_0052552 Ga0495656_0052552_698_1435 243
582 3300046616 Ga0495668_0000337 Ga0495668_0000337_51955_52692 243
583 3300046648 Ga0495611_0082418 Ga0495611_0082418_370_1107 243
584 3300046660 Ga0495625_0000132 Ga0495625_0000132_43968_44705 243
585 3300046660 Ga0495625_0000139 Ga0495625_0000139_72386_73123 243
586 3300046660 Ga0495625_0002623 Ga0495625_0002623_17894_18631 243
587 3300046660 Ga0495625_0003498 Ga0495625_0003498_14683_15420 243
588 3300046664 Ga0495659_0001118 Ga0495659_0001118_699_1436 243
589 3300046665 Ga0495661_0035739 Ga0495661_0035739_1893_2630 243
590 3300046691 Ga0495670_0062625 Ga0495670_0062625_302_1039 243
591 3300046692 Ga0495671_0000582 Ga0495671_0000582_10565_11302 243
592 3300046692 Ga0495671_0092095 Ga0495671_0092095_327_1064 243
593 3300046810 Ga0495660_0009308 Ga0495660_0009308_3544_4281 243
594 3300047320 Ga0495672_0000263 Ga0495672_0000263_64649_65386 243
595 3300047323 Ga0495683_0003113 Ga0495683_0003113_1622_2359 243
596 3300047443 Ga0495687_000296 Ga0495687_000296_20628_21365 243
597 3300047443 Ga0495687_001591 Ga0495687_001591_4863_5600 243
598 3300047445 Ga0495677_0112482 Ga0495677_0112482_135_872 243
599 3300047446 Ga0495679_031183 Ga0495679_031183_697_1434 243
600 3300047447 Ga0495685_000416 Ga0495685_000416_8321_9058 243
601 3300048917 Ga0496114_0000701 Ga0496114_0000701_17243_17977 243
602 3300048929 Ga0496126_0007665 Ga0496126_0007665_7237_7974 243
603 3300049459 Ga0495678_000283 Ga0495678_000283_47641_48378 243
604 3300049459 Ga0495678_000365 Ga0495678_000365_28519_29256 243
605 3300049459 Ga0495678_041790 Ga0495678_041790_620_1357 243
606 3300049460 Ga0495682_0000188 Ga0495682_0000188_44971_45708 243
607 3300049571 Ga0501034_0000321 Ga0501034_0000321_23618_24352 243
608 3300049679 Ga0501249_003568 Ga0501249_003568_1784_2518 243
609 3300049766 Ga0501269_000017 Ga0501269_000017_49788_50525 243
610 3300053118 Ga0500594_0035457 Ga0500594_0035457_189_926 243
611 3300005339 Ga0070660_100167128 Ga0070660_1001671282 244
612 3300005366 Ga0070659_100289505 Ga0070659_1002895052 244
613 3300005563 Ga0068855_100066169 Ga0068855_1000661694 244
614 3300009174 Ga0105241_10002206 Ga0105241_1000220613 244
615 3300009176 Ga0105242_10012557 Ga0105242_100125574 244
616 3300013307 Ga0157372_10255786 Ga0157372_102557863 244
617 3300025911 Ga0207654_10011436 Ga0207654_100114364 244
618 3300025919 Ga0207657_10007271 Ga0207657_1000727110 244
619 3300025932 Ga0207690_10488643 Ga0207690_104886432 244
620 3300025934 Ga0207686_10006292 Ga0207686_100062925 244
621 3300025949 Ga0207667_10015507 Ga0207667_100155073 244
622 3300037312 Ga0395899_0004137 Ga0395899_0004137_7539_8273 244
623 3300037418 Ga0395900_0013133 Ga0395900_0013133_4033_4767 244
624 3300037418 Ga0395900_0267722 Ga0395900_0267722_399_1133 244
625 3300037466 Ga0395898_0467517 Ga0395898_0467517_121_855 244
626 3300037471 Ga0395905_0119887 Ga0395905_0119887_471_1205 244
627 3300038443 Ga0395901_0106514 Ga0395901_0106514_1446_2180 244
628 3300042005 Ga0439448_0000301 Ga0439448_0000301_792_1526 244
629 3300042008 Ga0439450_007864 Ga0439450_007864_218_952 244
630 3300042012 Ga0439455_0007174 Ga0439455_0007174_1148_1882 244
631 3300044656 Ga0466969_0203000 Ga0466969_0203000_11_745 244
632 3300044683 Ga0466965_0015129 Ga0466965_0015129_1116_1850 244
633 3300044684 Ga0466966_0093765 Ga0466966_0093765_715_1449 244
634 3300044719 Ga0466971_0196298 Ga0466971_0196298_135_869 244
635 3300044842 Ga0466957_0001593 Ga0466957_0001593_9517_10251 244
636 3300045049 Ga0466959_0146293 Ga0466959_0146293_402_1136 244
637 3300046452 Ga0495617_006705 Ga0495617_006705_2678_3412 244
638 3300046455 Ga0495603_0136661 Ga0495603_0136661_583_1317 244
639 3300046473 Ga0495582_0000880 Ga0495582_0000880_1505_2239 244
640 3300046473 Ga0495582_0064202 Ga0495582_0064202_490_1224 244
641 3300046491 Ga0495584_0065432 Ga0495584_0065432_307_1041 244
642 3300046491 Ga0495584_0072788 Ga0495584_0072788_540_1280 244
643 3300046492 Ga0495585_0039317 Ga0495585_0039317_811_1545 244
644 3300046499 Ga0495594_0008636 Ga0495594_0008636_1103_1837 244
645 3300046500 Ga0495596_0001477 Ga0495596_0001477_11193_11927 244
646 3300046501 Ga0495607_0066327 Ga0495607_0066327_1061_1795 244
647 3300046506 Ga0495583_0002755 Ga0495583_0002755_602_1342 244
648 3300046506 Ga0495583_0202825 Ga0495583_0202825_56_790 244
649 3300046513 Ga0495616_0197999 Ga0495616_0197999_120_854 244
650 3300046519 Ga0495632_0001532 Ga0495632_0001532_12762_13496 244
651 3300046523 Ga0495644_0077710 Ga0495644_0077710_491_1225 244
652 3300046528 Ga0495642_0006585 Ga0495642_0006585_1293_2027 244
653 3300046557 Ga0495622_0037101 Ga0495622_0037101_954_1688 244
654 3300046648 Ga0495611_0023655 Ga0495611_0023655_583_1317 244
655 3300046660 Ga0495625_0002129 Ga0495625_0002129_13662_14402 244
656 3300046664 Ga0495659_0068463 Ga0495659_0068463_425_1159 244
657 3300046665 Ga0495661_0027405 Ga0495661_0027405_14_748 244
658 3300046674 Ga0495588_0000110 Ga0495588_0000110_31448_32182 244
659 3300046674 Ga0495588_0026084 Ga0495588_0026084_733_1467 244
660 3300046684 Ga0495669_0000041 Ga0495669_0000041_30234_30968 244
661 3300046689 Ga0495613_0109713 Ga0495613_0109713_797_1531 244
662 3300046691 Ga0495670_0028609 Ga0495670_0028609_1298_2032 244
663 3300046691 Ga0495670_0039030 Ga0495670_0039030_458_1192 244
664 3300047315 Ga0495581_0014620 Ga0495581_0014620_1648_2382 244
665 3300047318 Ga0495636_0071636 Ga0495636_0071636_549_1283 244
666 3300047320 Ga0495672_0016756 Ga0495672_0016756_4080_4814 244
667 3300047323 Ga0495683_0223067 Ga0495683_0223067_52_786 244
668 3300047443 Ga0495687_030413 Ga0495687_030413_1144_1884 244
669 3300047445 Ga0495677_0010069 Ga0495677_0010069_124_864 244
670 3300047447 Ga0495685_039173 Ga0495685_039173_845_1585 244
671 3300047447 Ga0495685_052210 Ga0495685_052210_627_1361 244
672 3300047472 Ga0495686_0001364 Ga0495686_0001364_13636_14376 244
673 3300048091 Ga0495626_0000711 Ga0495626_0000711_9283_10026 244
674 3300048091 Ga0495626_0074916 Ga0495626_0074916_441_1175 244
675 3300048091 Ga0495626_0109991 Ga0495626_0109991_168_911 244
676 3300048905 Ga0496102_0077507 Ga0496102_0077507_594_1328 244
677 3300048909 Ga0496106_0179271 Ga0496106_0179271_815_1549 244
678 3300048916 Ga0496113_0198113 Ga0496113_0198113_351_1085 244
679 3300049822 Ga0501035_0000652 Ga0501035_0000652_33895_34629 244
680 3300049823 Ga0501044_0071447 Ga0501044_0071447_467_1201 244
681 3300061719 Ga0466962_0107047 Ga0466962_0107047_413_1147 244
682 iso_pu_bacteria 2511231003 2511249808 244
683 3300002704 JGI25155J39150_1000301 JGI25155J39150_10003012 245
684 3300002737 JGI25162J39368_1011161 JGI25162J39368_10111612 245
685 3300003323 rootH1_10009899 rootH1_1000989911 245
686 3300005563 Ga0068855_100002195 Ga0068855_1000021959 245
687 3300005563 Ga0068855_100107181 Ga0068855_1001071813 245
688 3300005577 Ga0068857_100582795 Ga0068857_1005827952 245
689 3300005616 Ga0068852_100125934 Ga0068852_1001259342 245
690 3300009093 Ga0105240_10001226 Ga0105240_1000122639 245
691 3300009093 Ga0105240_10078269 Ga0105240_100782695 245
692 3300009551 Ga0105238_10030636 Ga0105238_100306362 245
693 3300025913 Ga0207695_10003589 Ga0207695_1000358910 245
694 3300025924 Ga0207694_10098659 Ga0207694_100986593 245
695 3300025949 Ga0207667_10000120 Ga0207667_1000012098 245
696 3300025949 Ga0207667_10007649 Ga0207667_1000764912 245
697 3300026142 Ga0207698_10095893 Ga0207698_100958933 245
698 3300031665 Ga0316575_10000758 Ga0316575_100007585 245
699 3300046660 Ga0495625_0001396 Ga0495625_0001396_11611_12348 245
700 3300048919 Ga0496116_0064539 Ga0496116_0064539_981_1718 245
701 3300048921 Ga0496118_0151056 Ga0496118_0151056_117_866 245
702 3300048924 Ga0496121_0061327 Ga0496121_0061327_1122_1859 245
703 3300048925 Ga0496122_0000887 Ga0496122_0000887_19680_20417 245
704 3300048926 Ga0496123_0000180 Ga0496123_0000180_19857_20594 245
705 3300048928 Ga0496125_0005042 Ga0496125_0005042_791_1528 245
706 3300048928 Ga0496125_0074638 Ga0496125_0074638_1698_2435 245
707 3300046454 Ga0495592_0202844 Ga0495592_0202844_555_1322 246
708 3300046462 Ga0495651_0018176 Ga0495651_0018176_4165_4932 246
709 3300046516 Ga0495628_0002796 Ga0495628_0002796_802_1569 246
710 3300046529 Ga0495652_0049372 Ga0495652_0049372_2717_3484 246
711 3300046529 Ga0495652_0184547 Ga0495652_0184547_178_945 246
712 3300046543 Ga0495645_0020795 Ga0495645_0020795_865_1632 246
713 3300046679 Ga0495623_0005943 Ga0495623_0005943_3965_4732 246
714 3300046680 Ga0495646_0000446 Ga0495646_0000446_4798_5565 246
715 3300048088 Ga0495602_0227554 Ga0495602_0227554_239_1006 246
716 3300053077 Ga0495601_0123067 Ga0495601_0123067_755_1522 246
717 3300026089 Ga0207648_10134412 Ga0207648_101344123 247
718 3300002737 JGI25162J39368_1000015 JGI25162J39368_1000015260 249
719 3300002771 JGI25163J39215_1001748 JGI25163J39215_10017483 249
720 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001937 249
721 3300003751 Ga0055538_1000001 Ga0055538_100000197 249
722 3300003752 Ga0055539_1000001 Ga0055539_100000197 249
723 3300003756 Ga0055533_1000003 Ga0055533_1000003937 249
724 3300003759 Ga0055525_1000087 Ga0055525_100008748 249
725 3300003841 Ga0055541_1000001 Ga0055541_1000001937 249
726 3300015261 Ga0182006_1004510 Ga0182006_10045108 249
727 3300015265 Ga0182005_1000227 Ga0182005_100022734 249
728 3300025207 Ga0209760_103071 Ga0209760_1030712 249
729 3300025224 Ga0209784_100004 Ga0209784_100004931 249
730 3300025225 Ga0209566_100004 Ga0209566_1000041088 249
731 3300025226 Ga0209674_100006 Ga0209674_1000061088 249
732 3300025230 Ga0209563_100009 Ga0209563_100009931 249
733 3300025231 Ga0207427_103252 Ga0207427_1032521 249
734 3300025233 Ga0209437_100004 Ga0209437_100004931 249
735 3300025253 Ga0209677_100005 Ga0209677_100005931 249
736 3300025261 Ga0209233_1000005 Ga0209233_10000051088 249
737 3300025920 Ga0207649_10114636 Ga0207649_101146362 249
738 3300031507 Ga0307509_10141183 Ga0307509_101411833 249
739 3300035691 Ga0373931_0004051 Ga0373931_0004051_5724_6488 249
740 3300046454 Ga0495592_0013806 Ga0495592_0013806_1320_2096 249
741 3300046463 Ga0495653_0004499 Ga0495653_0004499_1088_1864 249
742 3300046511 Ga0495608_0018979 Ga0495608_0018979_2659_3435 249
743 3300046514 Ga0495618_0011571 Ga0495618_0011571_1660_2436 249
744 3300046516 Ga0495628_0052698 Ga0495628_0052698_1651_2427 249
745 3300046529 Ga0495652_0038065 Ga0495652_0038065_1476_2252 249
746 3300046543 Ga0495645_0009101 Ga0495645_0009101_5512_6288 249
747 3300046678 Ga0495599_0000399 Ga0495599_0000399_16520_17296 249
748 3300046690 Ga0495624_0019179 Ga0495624_0019179_644_1420 249
749 3300046809 Ga0495600_0002038 Ga0495600_0002038_8377_9153 249
750 3300047317 Ga0495604_0002313 Ga0495604_0002313_747_1523 249
751 3300048088 Ga0495602_0040199 Ga0495602_0040199_1498_2274 249
752 3300053077 Ga0495601_0019691 Ga0495601_0019691_1751_2527 249
753 3300053119 Ga0500595_002138 Ga0500595_002138_7102_7878 249
754 3300053154 Ga0500619_010923 Ga0500619_010923_940_1713 249
755 iso_pu_bacteria 2818991436 2819541020 249
756 3300031730 Ga0307516_10003991 Ga0307516_100039915 250
757 3300042115 Ga0450911_008483 Ga0450911_008483_55_846 250
758 3300046507 Ga0495606_0000068 Ga0495606_0000068_171168_171959 250
759 3300046648 Ga0495611_0019241 Ga0495611_0019241_404_1192 250
760 3300001979 JGI24740J21852_10021400 JGI24740J21852_100214003 251
761 3300005289 Ga0065704_10000329 Ga0065704_1000032925 251
762 3300025256 Ga0209759_1019935 Ga0209759_10199352 251
763 3300041410 Ga0439461_0044219 Ga0439461_0044219_151_954 251
764 3300053080 Ga0500635_0000026 Ga0500635_0000026_21736_22491 251
765 iso_pu_bacteria 2738543012 2739246111 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

22

217

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

28

263

0.96

PF08659

KR

KR domain

23

207

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

24

196

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7caw-assembly1.cif.gz_D crystal structure of bacterial reductase 0.9631 12 250
6nrp-assembly1.cif.gz_C putative short-chain dehydrogenase/reductase (sdr) from acinetobacter baumannii 0.9625 12 250
7cax-assembly1.cif.gz_A crystal structure of bacterial reductase 0.9613 12 250
7caw-assembly1.cif.gz_A crystal structure of bacterial reductase 0.9612 12 250
7cax-assembly1.cif.gz_D crystal structure of bacterial reductase 0.9608 12 250
ID Description Score Start End Superfamily
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 11 249 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9389 12 251 3.40.50.720
2c07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9389 10 251 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9377 12 251 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9339 8 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M1YKC1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9412 10 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A0C2DEZ4-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9407 11 251 GO:0016491
AF-A0A496L296-F1-model_v4 deleted 0.9378 12 251
AF-A0A2V7UW99-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9366 11 248 GO:0016491
AF-A0A383B9X5-F1-model_v4 Uncharacterized protein 0.9361 12 130 GO:0016616

Feature Viewer

pLDDT pTM Quality
88.82 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map