F479800
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 436 | 710 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0000068|Ga0495606_0000068_171168_171959 |
| Length | 263 |
| Sequence | MTSTIFCNGAGKERNMNESKNLSVLVTGSSRGIGKAIALRLARDGYDLVLHCRSRRADAEGVAQQISTLGRAVRVLQFDIGDRAASAAALAADVADNGCYYGVVCNAGVAADNAFPAMSGEDWDLVLKTNLDGFYNVLNPLIMPMVQRRKPGRIVTLSSVSGVIGNRGQVNYSAAKAGIIGATKALALELAKRAITVNCVAPGLIDTDMIDGLDPAAREEALKMVPLRRVGQAGEVAGAVSFLIGDDASYITRQVISVNGGMA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 5 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 6 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 7 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 8 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 9 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 10 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 11 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 12 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 13 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 14 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 15 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 16 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 17 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 18 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 19 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 20 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 21 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 22 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 23 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 24 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 25 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 26 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 27 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 28 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 29 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 30 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 31 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 32 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 33 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 34 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 35 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 36 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 37 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 38 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 39 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 40 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 41 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 42 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 43 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 44 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 45 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 46 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 47 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 48 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 49 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 50 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 51 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 52 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 53 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 54 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 55 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 56 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 57 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 58 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 59 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 61 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 62 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 63 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 64 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 65 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 71 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 78 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 79 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 115 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 117 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 118 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 119 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 123 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 124 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 125 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 126 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 127 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 128 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 129 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 175 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 256 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 257 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 258 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 260 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 265 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 266 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 271 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 272 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 282 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 283 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 284 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 285 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 288 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 291 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 292 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 293 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 302 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 305 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 385 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 395 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 414 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 426 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 431 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 434 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 435 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 436 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.81 |
| Metatranscriptomes | 0 |
| Isolates | 7.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 9.67 |
| Nodule | 0.52 |
| Rhizoplane | 2.22 |
| Rhizosphere | 77.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10021400 | 3300001979 | Bacteria | 2242 |
| 2 | JGI25155J39150_1000301 | 3300002704 | Bacteria | 16893 |
| 3 | JGI25156J39149_1000038 | 3300002705 | Bacteria | 108421 |
| 4 | JGI25156J39149_1004474 | 3300002705 | Bacteria | 4255 |
| 5 | JGI25162J39368_1000015 | 3300002737 | Bacteria | 316381 |
| 6 | JGI25162J39368_1011161 | 3300002737 | Bacteria | 1094 |
| 7 | JGI25154J39366_1001243 | 3300002738 | Bacteria | 9588 |
| 8 | JGI25154J39366_1001369 | 3300002738 | Bacteria | 8859 |
| 9 | JGI25157J39369_1000127 | 3300002741 | Bacteria | 65070 |
| 10 | JGI25157J39369_1001386 | 3300002741 | Bacteria | 9364 |
| 11 | JGI25163J39215_1001748 | 3300002771 | Bacteria | 3035 |
| 12 | JGI25150J39212_1000643 | 3300002774 | Bacteria | 13163 |
| 13 | JGI25150J39212_1008972 | 3300002774 | Bacteria | 1928 |
| 14 | JGI25151J46595_10023515 | 3300003187 | Bacteria | 2537 |
| 15 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 16 | JGI25153J46596_10018456 | 3300003215 | Bacteria | 2709 |
| 17 | rootH1_10009899 | 3300003323 | Bacteria | 26612 |
| 18 | rootH1_10012135 | 3300003323 | Bacteria | 10558 |
| 19 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 20 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 21 | Ga0055539_1002307 | 3300003752 | Bacteria | 2990 |
| 22 | Ga0055539_1005513 | 3300003752 | Bacteria | 1642 |
| 23 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 24 | Ga0055533_1001462 | 3300003756 | Bacteria | 6233 |
| 25 | Ga0055525_1000027 | 3300003759 | Bacteria | 340506 |
| 26 | Ga0055525_1000087 | 3300003759 | Bacteria | 149803 |
| 27 | Ga0055527_1000199 | 3300003760 | Bacteria | 39633 |
| 28 | Ga0055527_1000212 | 3300003760 | Bacteria | 37749 |
| 29 | Ga0055535_1000585 | 3300003761 | Bacteria | 30486 |
| 30 | Ga0055535_1000854 | 3300003761 | Bacteria | 21603 |
| 31 | Ga0055535_1001004 | 3300003761 | Bacteria | 18069 |
| 32 | Ga0055542_1000647 | 3300003762 | Bacteria | 28749 |
| 33 | Ga0055542_1000687 | 3300003762 | Bacteria | 26887 |
| 34 | Ga0055542_1000693 | 3300003762 | Bacteria | 26579 |
| 35 | Ga0055529_1000590 | 3300003763 | Bacteria | 28472 |
| 36 | Ga0055529_1001016 | 3300003763 | Bacteria | 13476 |
| 37 | Ga0055526_1000066 | 3300003771 | Bacteria | 101329 |
| 38 | Ga0055524_1017692 | 3300003775 | Bacteria | 2505 |
| 39 | Ga0055531_10021626 | 3300003794 | Bacteria | 2487 |
| 40 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 41 | Ga0058692_1000008 | 3300003856 | Bacteria | 361583 |
| 42 | Ga0065703_1000102 | 3300005272 | Bacteria | 57788 |
| 43 | Ga0065714_10078862 | 3300005288 | Bacteria | 2563 |
| 44 | Ga0065714_10092344 | 3300005288 | Bacteria | 1881 |
| 45 | Ga0065704_10000329 | 3300005289 | Bacteria | 32689 |
| 46 | Ga0065704_10011917 | 3300005289 | Bacteria | 1635 |
| 47 | Ga0065704_10017134 | 3300005289 | Bacteria | 1499 |
| 48 | Ga0065704_10021739 | 3300005289 | Bacteria | 1515 |
| 49 | Ga0070690_100002403 | 3300005330 | Bacteria | 10054 |
| 50 | Ga0070670_100124570 | 3300005331 | Bacteria | 2224 |
| 51 | Ga0070670_100480735 | 3300005331 | Bacteria | 1103 |
| 52 | Ga0068869_100026093 | 3300005334 | Bacteria | 4064 |
| 53 | Ga0070682_100025981 | 3300005337 | Bacteria | 3499 |
| 54 | Ga0070682_100204144 | 3300005337 | Bacteria | 1396 |
| 55 | Ga0070682_100472669 | 3300005337 | Bacteria | 965 |
| 56 | Ga0068868_100015104 | 3300005338 | Bacteria | 5704 |
| 57 | Ga0070660_100096503 | 3300005339 | Bacteria | 2338 |
| 58 | Ga0070660_100167128 | 3300005339 | Bacteria | 1775 |
| 59 | Ga0070689_100000069 | 3300005340 | Bacteria | 61455 |
| 60 | Ga0070687_100003030 | 3300005343 | Bacteria | 6461 |
| 61 | Ga0070661_100003084 | 3300005344 | Bacteria | 11465 |
| 62 | Ga0070692_10008974 | 3300005345 | Bacteria | 4485 |
| 63 | Ga0070669_100000284 | 3300005353 | Bacteria | 39974 |
| 64 | Ga0070669_100001965 | 3300005353 | Bacteria | 14852 |
| 65 | Ga0070669_100105807 | 3300005353 | Bacteria | 2129 |
| 66 | Ga0070669_100113047 | 3300005353 | Bacteria | 2063 |
| 67 | Ga0070669_100614449 | 3300005353 | Bacteria | 912 |
| 68 | Ga0070675_100003503 | 3300005354 | Bacteria | 11907 |
| 69 | Ga0070675_100023546 | 3300005354 | Bacteria | 4925 |
| 70 | Ga0070675_100129920 | 3300005354 | Bacteria | 2146 |
| 71 | Ga0070671_100019760 | 3300005355 | Bacteria | 5487 |
| 72 | Ga0070674_100036098 | 3300005356 | Bacteria | 3316 |
| 73 | Ga0070673_100000741 | 3300005364 | Bacteria | 18095 |
| 74 | Ga0070673_100144447 | 3300005364 | Bacteria | 2010 |
| 75 | Ga0070688_100008091 | 3300005365 | Bacteria | 5695 |
| 76 | Ga0070659_100289505 | 3300005366 | Bacteria | 1364 |
| 77 | Ga0070710_10029220 | 3300005437 | Bacteria | 2956 |
| 78 | Ga0070711_100039163 | 3300005439 | Bacteria | 3191 |
| 79 | Ga0070705_100012699 | 3300005440 | Bacteria | 4290 |
| 80 | Ga0070700_100018379 | 3300005441 | Bacteria | 4018 |
| 81 | Ga0070694_100183238 | 3300005444 | Bacteria | 1550 |
| 82 | Ga0070678_100005340 | 3300005456 | Bacteria | 7414 |
| 83 | Ga0070685_10003995 | 3300005466 | Bacteria | 7452 |
| 84 | Ga0070698_100199509 | 3300005471 | Bacteria | 1937 |
| 85 | Ga0070679_100255993 | 3300005530 | Bacteria | 1706 |
| 86 | Ga0070684_100000781 | 3300005535 | Bacteria | 22094 |
| 87 | Ga0070684_100716953 | 3300005535 | Bacteria | 933 |
| 88 | Ga0070697_100238764 | 3300005536 | Bacteria | 1551 |
| 89 | Ga0068853_100112756 | 3300005539 | Bacteria | 2417 |
| 90 | Ga0070672_100016820 | 3300005543 | Bacteria | 5246 |
| 91 | Ga0070672_100171541 | 3300005543 | Bacteria | 1804 |
| 92 | Ga0070686_100000961 | 3300005544 | Bacteria | 16601 |
| 93 | Ga0070696_100300039 | 3300005546 | Bacteria | 1230 |
| 94 | Ga0070665_100003202 | 3300005548 | Bacteria | 17609 |
| 95 | Ga0070665_100038519 | 3300005548 | Bacteria | 4806 |
| 96 | Ga0070665_100721120 | 3300005548 | Bacteria | 1010 |
| 97 | Ga0068855_100002195 | 3300005563 | Bacteria | 24130 |
| 98 | Ga0068855_100046672 | 3300005563 | Bacteria | 5120 |
| 99 | Ga0068855_100066169 | 3300005563 | Bacteria | 4213 |
| 100 | Ga0068855_100107181 | 3300005563 | Bacteria | 3211 |
| 101 | Ga0068855_100432521 | 3300005563 | Bacteria | 1438 |
| 102 | Ga0070664_100014986 | 3300005564 | Bacteria | 6326 |
| 103 | Ga0068857_100001885 | 3300005577 | Bacteria | 16897 |
| 104 | Ga0068857_100308190 | 3300005577 | Bacteria | 1460 |
| 105 | Ga0068857_100582795 | 3300005577 | Bacteria | 1056 |
| 106 | Ga0068854_100370055 | 3300005578 | Bacteria | 1178 |
| 107 | Ga0068856_100001666 | 3300005614 | Bacteria | 23262 |
| 108 | Ga0068856_100005894 | 3300005614 | Bacteria | 12076 |
| 109 | Ga0068856_100289864 | 3300005614 | Bacteria | 1654 |
| 110 | Ga0070702_100002116 | 3300005615 | Bacteria | 8429 |
| 111 | Ga0068852_100125934 | 3300005616 | Bacteria | 2352 |
| 112 | Ga0068852_100225294 | 3300005616 | Bacteria | 1785 |
| 113 | Ga0068859_100000317 | 3300005617 | Bacteria | 48140 |
| 114 | Ga0068864_100001409 | 3300005618 | Bacteria | 19883 |
| 115 | Ga0068866_10026887 | 3300005718 | Bacteria | 2723 |
| 116 | Ga0068861_100002710 | 3300005719 | Bacteria | 11591 |
| 117 | Ga0068861_100043657 | 3300005719 | Bacteria | 3367 |
| 118 | Ga0068870_10002367 | 3300005840 | Bacteria | 7843 |
| 119 | Ga0068863_100001571 | 3300005841 | Bacteria | 22583 |
| 120 | Ga0068858_100010524 | 3300005842 | Bacteria | 8760 |
| 121 | Ga0068860_100495030 | 3300005843 | Bacteria | 1220 |
| 122 | Ga0068862_100003232 | 3300005844 | Bacteria | 14103 |
| 123 | Ga0068862_100010476 | 3300005844 | Bacteria | 7655 |
| 124 | Ga0068862_100071209 | 3300005844 | Bacteria | 3002 |
| 125 | Ga0075364_10191044 | 3300006051 | Bacteria | 1387 |
| 126 | Ga0070716_100052090 | 3300006173 | Bacteria | 2330 |
| 127 | Ga0070716_100216682 | 3300006173 | Bacteria | 1283 |
| 128 | Ga0097621_100636088 | 3300006237 | Bacteria | 978 |
| 129 | Ga0068871_100053807 | 3300006358 | Bacteria | 3264 |
| 130 | Ga0068871_100057038 | 3300006358 | Bacteria | 3176 |
| 131 | Ga0075428_100019852 | 3300006844 | Bacteria | 7439 |
| 132 | Ga0075428_100026168 | 3300006844 | Bacteria | 6462 |
| 133 | Ga0075430_100027879 | 3300006846 | Bacteria | 4797 |
| 134 | Ga0075431_100034434 | 3300006847 | Bacteria | 5218 |
| 135 | Ga0075431_100142209 | 3300006847 | Bacteria | 2473 |
| 136 | Ga0075433_10082756 | 3300006852 | Bacteria | 2831 |
| 137 | Ga0075433_10097948 | 3300006852 | Bacteria | 2596 |
| 138 | Ga0075433_10169031 | 3300006852 | Bacteria | 1946 |
| 139 | Ga0075433_10228962 | 3300006852 | Bacteria | 1651 |
| 140 | Ga0075434_100010704 | 3300006871 | Bacteria | 8612 |
| 141 | Ga0075434_100148522 | 3300006871 | Bacteria | 2364 |
| 142 | Ga0075429_100257238 | 3300006880 | Bacteria | 1529 |
| 143 | Ga0068865_100234637 | 3300006881 | Bacteria | 1441 |
| 144 | Ga0075436_100086434 | 3300006914 | Bacteria | 2178 |
| 145 | Ga0097620_100000317 | 3300006931 | Bacteria | 48140 |
| 146 | Ga0075435_100323353 | 3300007076 | Bacteria | 1320 |
| 147 | Ga0105251_10019832 | 3300009011 | Bacteria | 3541 |
| 148 | Ga0105244_10002091 | 3300009036 | Bacteria | 15355 |
| 149 | Ga0105244_10010768 | 3300009036 | Bacteria | 5526 |
| 150 | Ga0105244_10012197 | 3300009036 | Bacteria | 5097 |
| 151 | Ga0105244_10201406 | 3300009036 | Bacteria | 938 |
| 152 | Ga0105244_10223513 | 3300009036 | Bacteria | 882 |
| 153 | Ga0105250_10003510 | 3300009092 | Bacteria | 7403 |
| 154 | Ga0105240_10001226 | 3300009093 | Bacteria | 44605 |
| 155 | Ga0105240_10006451 | 3300009093 | Bacteria | 17243 |
| 156 | Ga0105240_10078269 | 3300009093 | Bacteria | 4072 |
| 157 | Ga0105240_10247730 | 3300009093 | Bacteria | 2062 |
| 158 | Ga0111539_10016158 | 3300009094 | Bacteria | 9260 |
| 159 | Ga0111539_10050989 | 3300009094 | Bacteria | 4930 |
| 160 | Ga0111539_11203802 | 3300009094 | Bacteria | 880 |
| 161 | Ga0105245_10243483 | 3300009098 | Bacteria | 1744 |
| 162 | Ga0105245_10383942 | 3300009098 | Bacteria | 1399 |
| 163 | Ga0105247_10024284 | 3300009101 | Bacteria | 3652 |
| 164 | Ga0114129_10002450 | 3300009147 | Bacteria | 25774 |
| 165 | Ga0114129_10141222 | 3300009147 | Bacteria | 3301 |
| 166 | Ga0114129_10152994 | 3300009147 | Bacteria | 3156 |
| 167 | Ga0114129_10223215 | 3300009147 | Bacteria | 2541 |
| 168 | Ga0105243_10000041 | 3300009148 | Bacteria | 159516 |
| 169 | Ga0105243_10129664 | 3300009148 | Bacteria | 2138 |
| 170 | Ga0105241_10002206 | 3300009174 | Bacteria | 14650 |
| 171 | Ga0105241_10134780 | 3300009174 | Bacteria | 2004 |
| 172 | Ga0105242_10012557 | 3300009176 | Bacteria | 6522 |
| 173 | Ga0105248_10004710 | 3300009177 | Bacteria | 15097 |
| 174 | Ga0105238_10025802 | 3300009551 | Bacteria | 5991 |
| 175 | Ga0105238_10030636 | 3300009551 | Bacteria | 5476 |
| 176 | Ga0105238_10071473 | 3300009551 | Bacteria | 3467 |
| 177 | Ga0105238_10626828 | 3300009551 | Bacteria | 1084 |
| 178 | Ga0105249_10004745 | 3300009553 | Bacteria | 11733 |
| 179 | Ga0105249_10057978 | 3300009553 | Bacteria | 3549 |
| 180 | Ga0105249_10234890 | 3300009553 | Bacteria | 1810 |
| 181 | Ga0105239_10079565 | 3300010375 | Bacteria | 3606 |
| 182 | Ga0157373_10397048 | 3300013100 | Bacteria | 988 |
| 183 | Ga0157371_10187003 | 3300013102 | Bacteria | 1482 |
| 184 | Ga0157371_10469304 | 3300013102 | Bacteria | 927 |
| 185 | Ga0157370_10024113 | 3300013104 | Bacteria | 6031 |
| 186 | Ga0157370_10168583 | 3300013104 | Bacteria | 2036 |
| 187 | Ga0157369_10059033 | 3300013105 | Bacteria | 4138 |
| 188 | Ga0163162_10037464 | 3300013306 | Bacteria | 4840 |
| 189 | Ga0157372_10255786 | 3300013307 | Bacteria | 2033 |
| 190 | Ga0157372_10459518 | 3300013307 | Bacteria | 1484 |
| 191 | Ga0157375_10041689 | 3300013308 | Bacteria | 4435 |
| 192 | Ga0163163_10000326 | 3300014325 | Bacteria | 46149 |
| 193 | Ga0157380_10130310 | 3300014326 | Bacteria | 2144 |
| 194 | Ga0157377_10001044 | 3300014745 | Bacteria | 11734 |
| 195 | Ga0157379_10038697 | 3300014968 | Bacteria | 4255 |
| 196 | Ga0157376_10214509 | 3300014969 | Bacteria | 1779 |
| 197 | Ga0157376_10412447 | 3300014969 | Bacteria | 1309 |
| 198 | Ga0182006_1004510 | 3300015261 | Bacteria | 6855 |
| 199 | Ga0182007_10010952 | 3300015262 | Bacteria | 3554 |
| 200 | Ga0182005_1000070 | 3300015265 | Bacteria | 85687 |
| 201 | Ga0182005_1000227 | 3300015265 | Bacteria | 37208 |
| 202 | Ga0213872_10004418 | 3300021361 | Bacteria | 7469 |
| 203 | Ga0209760_103071 | 3300025207 | Bacteria | 1503 |
| 204 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 205 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 206 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 207 | Ga0209674_100086 | 3300025226 | Bacteria | 187776 |
| 208 | Ga0209674_100654 | 3300025226 | Bacteria | 12445 |
| 209 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 210 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 211 | Ga0209672_101479 | 3300025228 | Bacteria | 8284 |
| 212 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 213 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 214 | Ga0207427_103252 | 3300025231 | Bacteria | 3542 |
| 215 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 216 | Ga0209437_101634 | 3300025233 | Bacteria | 5107 |
| 217 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 218 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 219 | Ga0209258_100064 | 3300025242 | Bacteria | 293837 |
| 220 | Ga0207425_1000484 | 3300025245 | Bacteria | 25043 |
| 221 | Ga0209646_1000094 | 3300025246 | Bacteria | 182874 |
| 222 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 223 | Ga0209026_1000074 | 3300025250 | Bacteria | 203820 |
| 224 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 225 | Ga0209677_100097 | 3300025253 | Bacteria | 97418 |
| 226 | Ga0209677_101749 | 3300025253 | Bacteria | 9020 |
| 227 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 228 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 229 | Ga0209148_1000142 | 3300025254 | Bacteria | 163404 |
| 230 | Ga0209148_1002194 | 3300025254 | Bacteria | 7199 |
| 231 | Ga0209759_1000065 | 3300025256 | Bacteria | 187612 |
| 232 | Ga0209759_1003009 | 3300025256 | Bacteria | 6979 |
| 233 | Ga0209759_1003887 | 3300025256 | Bacteria | 5766 |
| 234 | Ga0209759_1019935 | 3300025256 | Bacteria | 1574 |
| 235 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 236 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 237 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 238 | Ga0209455_1007600 | 3300025272 | Bacteria | 3038 |
| 239 | Ga0209676_1005920 | 3300025292 | Bacteria | 6193 |
| 240 | Ga0209025_1002077 | 3300025294 | Bacteria | 22739 |
| 241 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 242 | Ga0209758_1000489 | 3300025297 | Bacteria | 64758 |
| 243 | Ga0209050_1011592 | 3300025298 | Bacteria | 4155 |
| 244 | Ga0209051_1037524 | 3300025303 | Bacteria | 1775 |
| 245 | Ga0209051_1045522 | 3300025303 | Bacteria | 1517 |
| 246 | Ga0207696_1009948 | 3300025711 | Bacteria | 3517 |
| 247 | Ga0207655_1000951 | 3300025728 | Bacteria | 30002 |
| 248 | Ga0207655_1001090 | 3300025728 | Bacteria | 26757 |
| 249 | Ga0207655_1001100 | 3300025728 | Bacteria | 26470 |
| 250 | Ga0207655_1011371 | 3300025728 | Bacteria | 5304 |
| 251 | Ga0207642_10002405 | 3300025899 | Bacteria | 5830 |
| 252 | Ga0207710_10000021 | 3300025900 | Bacteria | 336166 |
| 253 | Ga0207645_10041524 | 3300025907 | Bacteria | 2944 |
| 254 | Ga0207643_10002940 | 3300025908 | Bacteria | 9200 |
| 255 | Ga0207654_10011436 | 3300025911 | Bacteria | 4529 |
| 256 | Ga0207695_10003589 | 3300025913 | Bacteria | 21707 |
| 257 | Ga0207695_10036390 | 3300025913 | Bacteria | 5322 |
| 258 | Ga0207695_10166765 | 3300025913 | Bacteria | 2130 |
| 259 | Ga0207671_10371265 | 3300025914 | Bacteria | 1136 |
| 260 | Ga0207693_10077952 | 3300025915 | Bacteria | 2594 |
| 261 | Ga0207662_10018978 | 3300025918 | Bacteria | 3907 |
| 262 | Ga0207657_10007271 | 3300025919 | Bacteria | 11373 |
| 263 | Ga0207657_10014943 | 3300025919 | Bacteria | 7544 |
| 264 | Ga0207657_10108673 | 3300025919 | Bacteria | 2292 |
| 265 | Ga0207649_10077159 | 3300025920 | Bacteria | 2146 |
| 266 | Ga0207649_10114636 | 3300025920 | Bacteria | 1806 |
| 267 | Ga0207649_10165720 | 3300025920 | Bacteria | 1535 |
| 268 | Ga0207652_10213965 | 3300025921 | Bacteria | 1736 |
| 269 | Ga0207681_10000437 | 3300025923 | Bacteria | 29108 |
| 270 | Ga0207681_10047262 | 3300025923 | Bacteria | 2898 |
| 271 | Ga0207681_10306878 | 3300025923 | Bacteria | 1257 |
| 272 | Ga0207694_10030681 | 3300025924 | Bacteria | 4105 |
| 273 | Ga0207694_10098659 | 3300025924 | Bacteria | 2313 |
| 274 | Ga0207650_10118468 | 3300025925 | Bacteria | 2058 |
| 275 | Ga0207659_10004743 | 3300025926 | Bacteria | 8246 |
| 276 | Ga0207659_10048719 | 3300025926 | Bacteria | 3003 |
| 277 | Ga0207690_10488643 | 3300025932 | Bacteria | 994 |
| 278 | Ga0207706_10007482 | 3300025933 | Bacteria | 10098 |
| 279 | Ga0207706_10015852 | 3300025933 | Bacteria | 6814 |
| 280 | Ga0207686_10006292 | 3300025934 | Bacteria | 6386 |
| 281 | Ga0207709_10000023 | 3300025935 | Bacteria | 369407 |
| 282 | Ga0207709_10014130 | 3300025935 | Bacteria | 4407 |
| 283 | Ga0207670_10003260 | 3300025936 | Bacteria | 8603 |
| 284 | Ga0207669_10043554 | 3300025937 | Bacteria | 2630 |
| 285 | Ga0207704_10219976 | 3300025938 | Bacteria | 1404 |
| 286 | Ga0207704_10278258 | 3300025938 | Bacteria | 1271 |
| 287 | Ga0207665_10073551 | 3300025939 | Bacteria | 2337 |
| 288 | Ga0207691_10013436 | 3300025940 | Bacteria | 7838 |
| 289 | Ga0207691_10118786 | 3300025940 | Bacteria | 2345 |
| 290 | Ga0207711_10003822 | 3300025941 | Bacteria | 12952 |
| 291 | Ga0207689_10003105 | 3300025942 | Bacteria | 15264 |
| 292 | Ga0207667_10000120 | 3300025949 | Bacteria | 123800 |
| 293 | Ga0207667_10007649 | 3300025949 | Bacteria | 12943 |
| 294 | Ga0207667_10015507 | 3300025949 | Bacteria | 8648 |
| 295 | Ga0207667_10149506 | 3300025949 | Bacteria | 2404 |
| 296 | Ga0207712_10003212 | 3300025961 | Bacteria | 10388 |
| 297 | Ga0207712_10037163 | 3300025961 | Bacteria | 3321 |
| 298 | Ga0207712_10136360 | 3300025961 | Bacteria | 1877 |
| 299 | Ga0207640_10030508 | 3300025981 | Bacteria | 3321 |
| 300 | Ga0207658_10008297 | 3300025986 | Bacteria | 7076 |
| 301 | Ga0207677_10058547 | 3300026023 | Bacteria | 2653 |
| 302 | Ga0207703_10033193 | 3300026035 | Bacteria | 4089 |
| 303 | Ga0207639_10055568 | 3300026041 | Bacteria | 3031 |
| 304 | Ga0207708_10032862 | 3300026075 | Bacteria | 3939 |
| 305 | Ga0207702_10000610 | 3300026078 | Bacteria | 39489 |
| 306 | Ga0207702_10001392 | 3300026078 | Bacteria | 24120 |
| 307 | Ga0207702_10068751 | 3300026078 | Bacteria | 3043 |
| 308 | Ga0207641_10003999 | 3300026088 | Bacteria | 12871 |
| 309 | Ga0207648_10023478 | 3300026089 | Bacteria | 5524 |
| 310 | Ga0207648_10134412 | 3300026089 | Bacteria | 2178 |
| 311 | Ga0207676_10001771 | 3300026095 | Bacteria | 15825 |
| 312 | Ga0207674_10045014 | 3300026116 | Bacteria | 4542 |
| 313 | Ga0207675_100009624 | 3300026118 | Bacteria | 9043 |
| 314 | Ga0207675_100065976 | 3300026118 | Bacteria | 3382 |
| 315 | Ga0207683_10156162 | 3300026121 | Bacteria | 2061 |
| 316 | Ga0207683_10249688 | 3300026121 | Bacteria | 1619 |
| 317 | Ga0207698_10095893 | 3300026142 | Bacteria | 2443 |
| 318 | Ga0207698_10169060 | 3300026142 | Bacteria | 1923 |
| 319 | Ga0207698_10329580 | 3300026142 | Bacteria | 1433 |
| 320 | Ga0209371_1000038 | 3300027312 | Bacteria | 361802 |
| 321 | Ga0209974_10022065 | 3300027876 | Bacteria | 2108 |
| 322 | Ga0207428_10368226 | 3300027907 | Bacteria | 1056 |
| 323 | Ga0268266_10002128 | 3300028379 | Bacteria | 21854 |
| 324 | Ga0268266_10021170 | 3300028379 | Bacteria | 5540 |
| 325 | Ga0268265_10003134 | 3300028380 | Bacteria | 12053 |
| 326 | Ga0268265_10007277 | 3300028380 | Bacteria | 7479 |
| 327 | Ga0268265_10071349 | 3300028380 | Bacteria | 2705 |
| 328 | Ga0268264_10266016 | 3300028381 | Bacteria | 1600 |
| 329 | Ga0265334_10000500 | 3300028573 | Bacteria | 20148 |
| 330 | Ga0265318_10102895 | 3300028577 | Bacteria | 1050 |
| 331 | Ga0265336_10000061 | 3300028666 | Bacteria | 102829 |
| 332 | Ga0265336_10035474 | 3300028666 | Bacteria | 1538 |
| 333 | Ga0307515_10072544 | 3300028794 | Bacteria | 4643 |
| 334 | Ga0265324_10001696 | 3300029957 | Bacteria | 12114 |
| 335 | Ga0268256_1000038 | 3300030500 | Bacteria | 361762 |
| 336 | Ga0316178_1028084 | 3300030735 | Bacteria | 1148 |
| 337 | Ga0316183_1175186 | 3300030742 | Bacteria | 4962 |
| 338 | Ga0316181_1163091 | 3300030744 | Bacteria | 1407 |
| 339 | Ga0265329_10022329 | 3300031242 | Bacteria | 2118 |
| 340 | Ga0265327_10001649 | 3300031251 | Bacteria | 26951 |
| 341 | Ga0265327_10102697 | 3300031251 | Bacteria | 1377 |
| 342 | Ga0265316_10059388 | 3300031344 | Bacteria | 2974 |
| 343 | Ga0307513_10058089 | 3300031456 | Bacteria | 4115 |
| 344 | Ga0307509_10141183 | 3300031507 | Bacteria | 2344 |
| 345 | Ga0307508_10078804 | 3300031616 | Bacteria | 2875 |
| 346 | Ga0316575_10000758 | 3300031665 | Bacteria | 9722 |
| 347 | Ga0307516_10003991 | 3300031730 | Bacteria | 18527 |
| 348 | Ga0307413_10088180 | 3300031824 | Bacteria | 2012 |
| 349 | Ga0307412_10000595 | 3300031911 | Bacteria | 21371 |
| 350 | Ga0307409_100710376 | 3300031995 | Bacteria | 1005 |
| 351 | Ga0307416_100883448 | 3300032002 | Bacteria | 993 |
| 352 | Ga0307414_10196823 | 3300032004 | Bacteria | 1636 |
| 353 | Ga0307411_10139350 | 3300032005 | Bacteria | 1786 |
| 354 | Ga0373958_0004705 | 3300034819 | Bacteria | 2033 |
| 355 | Ga0373924_0191022 | 3300035410 | Bacteria | 902 |
| 356 | Ga0373931_0004051 | 3300035691 | Bacteria | 6642 |
| 357 | Ga0373937_0080873 | 3300036401 | Bacteria | 3006 |
| 358 | Ga0373937_0097205 | 3300036401 | Bacteria | 2731 |
| 359 | Ga0395899_0000108 | 3300037312 | Bacteria | 142347 |
| 360 | Ga0395899_0004137 | 3300037312 | Bacteria | 11407 |
| 361 | Ga0395899_0011520 | 3300037312 | Bacteria | 6769 |
| 362 | Ga0395899_0014968 | 3300037312 | Bacteria | 5916 |
| 363 | Ga0395899_0069039 | 3300037312 | Bacteria | 2589 |
| 364 | Ga0395900_0000343 | 3300037418 | Bacteria | 68342 |
| 365 | Ga0395900_0000755 | 3300037418 | Bacteria | 42995 |
| 366 | Ga0395900_0013133 | 3300037418 | Bacteria | 8463 |
| 367 | Ga0395900_0038690 | 3300037418 | Bacteria | 4916 |
| 368 | Ga0395900_0167389 | 3300037418 | Bacteria | 2239 |
| 369 | Ga0395900_0267722 | 3300037418 | Bacteria | 1704 |
| 370 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 371 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 372 | Ga0395898_0140996 | 3300037466 | Bacteria | 2307 |
| 373 | Ga0395898_0467517 | 3300037466 | Bacteria | 1200 |
| 374 | Ga0395905_0119887 | 3300037471 | Bacteria | 2472 |
| 375 | Ga0395901_0000033 | 3300038443 | Bacteria | 232357 |
| 376 | Ga0395901_0010919 | 3300038443 | Bacteria | 9204 |
| 377 | Ga0395901_0014131 | 3300038443 | Bacteria | 8128 |
| 378 | Ga0395901_0106514 | 3300038443 | Bacteria | 2942 |
| 379 | Ga0395901_0117270 | 3300038443 | Bacteria | 2797 |
| 380 | Ga0395901_0149159 | 3300038443 | Bacteria | 2457 |
| 381 | Ga0395901_0239271 | 3300038443 | Bacteria | 1893 |
| 382 | Ga0395901_0343105 | 3300038443 | Bacteria | 1543 |
| 383 | Ga0237816_00313 | 3300039145 | Bacteria | 4149 |
| 384 | Ga0436361_0009597 | 3300039447 | Bacteria | 38752 |
| 385 | Ga0436361_0809540 | 3300039447 | Bacteria | 3675 |
| 386 | Ga0439436_0030789 | 3300041404 | Bacteria | 1559 |
| 387 | Ga0439461_0044219 | 3300041410 | Bacteria | 971 |
| 388 | Ga0439466_0045527 | 3300041411 | Bacteria | 1450 |
| 389 | Ga0439465_0000949 | 3300041413 | Bacteria | 9197 |
| 390 | Ga0451837_0176909 | 3300041494 | Bacteria | 905 |
| 391 | Ga0439448_0000301 | 3300042005 | Bacteria | 10911 |
| 392 | Ga0439449_0000014 | 3300042007 | Bacteria | 50794 |
| 393 | Ga0439449_0037619 | 3300042007 | Bacteria | 1800 |
| 394 | Ga0439449_0058479 | 3300042007 | Bacteria | 1423 |
| 395 | Ga0439450_007864 | 3300042008 | Bacteria | 1969 |
| 396 | Ga0439455_0007174 | 3300042012 | Bacteria | 2348 |
| 397 | Ga0450911_008483 | 3300042115 | Bacteria | 1461 |
| 398 | Ga0450911_018912 | 3300042115 | Bacteria | 904 |
| 399 | Ga0439458_0152058 | 3300042157 | Bacteria | 620 |
| 400 | Ga0451577_0117106 | 3300042876 | Bacteria | 2386 |
| 401 | Ga0451577_0232380 | 3300042876 | Bacteria | 1668 |
| 402 | Ga0451577_0665839 | 3300042876 | Bacteria | 944 |
| 403 | Ga0466969_0014958 | 3300044656 | Bacteria | 4070 |
| 404 | Ga0466969_0015853 | 3300044656 | Bacteria | 3949 |
| 405 | Ga0466969_0203000 | 3300044656 | Bacteria | 904 |
| 406 | Ga0466965_0015129 | 3300044683 | Bacteria | 3662 |
| 407 | Ga0466966_0019976 | 3300044684 | Bacteria | 4406 |
| 408 | Ga0466966_0093765 | 3300044684 | Bacteria | 1861 |
| 409 | Ga0466961_0000617 | 3300044693 | Bacteria | 22343 |
| 410 | Ga0466961_0020355 | 3300044693 | Bacteria | 4267 |
| 411 | Ga0466963_0081589 | 3300044694 | Bacteria | 2191 |
| 412 | Ga0466964_0000727 | 3300044706 | Bacteria | 10691 |
| 413 | Ga0466964_0051920 | 3300044706 | Bacteria | 1684 |
| 414 | Ga0453684_0006727 | 3300044712 | Bacteria | 21662 |
| 415 | Ga0453684_0256310 | 3300044712 | Bacteria | 2006 |
| 416 | Ga0453684_0452472 | 3300044712 | Bacteria | 1429 |
| 417 | Ga0466971_0098234 | 3300044719 | Bacteria | 1344 |
| 418 | Ga0466971_0196298 | 3300044719 | Bacteria | 952 |
| 419 | Ga0466957_0001593 | 3300044842 | Bacteria | 11926 |
| 420 | Ga0466957_0029147 | 3300044842 | Bacteria | 3290 |
| 421 | Ga0466957_0139197 | 3300044842 | Bacteria | 1562 |
| 422 | Ga0466960_0080842 | 3300044901 | Bacteria | 1637 |
| 423 | Ga0466959_0000347 | 3300045049 | Bacteria | 27371 |
| 424 | Ga0466959_0001870 | 3300045049 | Bacteria | 13231 |
| 425 | Ga0466959_0146293 | 3300045049 | Bacteria | 1667 |
| 426 | Ga0451576_0034629 | 3300045051 | Bacteria | 5362 |
| 427 | Ga0451576_0572900 | 3300045051 | Bacteria | 1186 |
| 428 | Ga0451576_0587255 | 3300045051 | Bacteria | 1171 |
| 429 | Ga0451576_0957821 | 3300045051 | Bacteria | 897 |
| 430 | Ga0466958_0026361 | 3300045836 | Bacteria | 3434 |
| 431 | Ga0466958_0038431 | 3300045836 | Bacteria | 2872 |
| 432 | Ga0466967_0010517 | 3300045976 | Bacteria | 6948 |
| 433 | Ga0495617_003902 | 3300046452 | Bacteria | 5494 |
| 434 | Ga0495617_006705 | 3300046452 | Bacteria | 4026 |
| 435 | Ga0495592_0013806 | 3300046454 | Bacteria | 6141 |
| 436 | Ga0495592_0141801 | 3300046454 | Bacteria | 1671 |
| 437 | Ga0495592_0202844 | 3300046454 | Bacteria | 1337 |
| 438 | Ga0495592_0451578 | 3300046454 | Bacteria | 805 |
| 439 | Ga0495603_0136661 | 3300046455 | Bacteria | 1426 |
| 440 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 441 | Ga0495590_0044275 | 3300046457 | Bacteria | 1552 |
| 442 | Ga0495638_0000091 | 3300046460 | Bacteria | 146548 |
| 443 | Ga0495638_0004653 | 3300046460 | Bacteria | 10379 |
| 444 | Ga0495651_0018176 | 3300046462 | Bacteria | 5442 |
| 445 | Ga0495653_0004499 | 3300046463 | Bacteria | 11259 |
| 446 | Ga0495650_0000097 | 3300046471 | Bacteria | 216051 |
| 447 | Ga0495650_0001058 | 3300046471 | Bacteria | 30529 |
| 448 | Ga0495582_0000880 | 3300046473 | Bacteria | 16656 |
| 449 | Ga0495582_0064202 | 3300046473 | Bacteria | 2027 |
| 450 | Ga0495605_0000251 | 3300046474 | Bacteria | 63553 |
| 451 | Ga0495605_0008057 | 3300046474 | Bacteria | 5965 |
| 452 | Ga0495639_0010865 | 3300046475 | Bacteria | 3921 |
| 453 | Ga0495639_0075418 | 3300046475 | Bacteria | 1563 |
| 454 | Ga0495584_0000021 | 3300046491 | Bacteria | 130377 |
| 455 | Ga0495584_0019130 | 3300046491 | Bacteria | 3478 |
| 456 | Ga0495584_0029967 | 3300046491 | Bacteria | 2757 |
| 457 | Ga0495584_0065432 | 3300046491 | Bacteria | 1828 |
| 458 | Ga0495584_0072788 | 3300046491 | Bacteria | 1727 |
| 459 | Ga0495585_0000772 | 3300046492 | Bacteria | 28287 |
| 460 | Ga0495585_0008458 | 3300046492 | Bacteria | 6237 |
| 461 | Ga0495585_0024974 | 3300046492 | Bacteria | 3424 |
| 462 | Ga0495585_0027981 | 3300046492 | Bacteria | 3217 |
| 463 | Ga0495585_0039317 | 3300046492 | Bacteria | 2659 |
| 464 | Ga0495585_0174666 | 3300046492 | Bacteria | 1107 |
| 465 | Ga0495594_0008636 | 3300046499 | Bacteria | 5248 |
| 466 | Ga0495594_0044138 | 3300046499 | Bacteria | 2445 |
| 467 | Ga0495596_0001477 | 3300046500 | Bacteria | 13428 |
| 468 | Ga0495607_0000298 | 3300046501 | Bacteria | 51955 |
| 469 | Ga0495607_0001875 | 3300046501 | Bacteria | 17831 |
| 470 | Ga0495607_0006297 | 3300046501 | Bacteria | 8368 |
| 471 | Ga0495607_0007143 | 3300046501 | Bacteria | 7761 |
| 472 | Ga0495607_0031071 | 3300046501 | Bacteria | 3272 |
| 473 | Ga0495607_0066327 | 3300046501 | Bacteria | 2031 |
| 474 | Ga0495583_0000060 | 3300046506 | Bacteria | 199091 |
| 475 | Ga0495583_0000155 | 3300046506 | Bacteria | 114870 |
| 476 | Ga0495583_0000197 | 3300046506 | Bacteria | 101236 |
| 477 | Ga0495583_0002755 | 3300046506 | Bacteria | 14519 |
| 478 | Ga0495583_0202825 | 3300046506 | Bacteria | 805 |
| 479 | Ga0495606_0000068 | 3300046507 | Bacteria | 179653 |
| 480 | Ga0495606_0000141 | 3300046507 | Bacteria | 123586 |
| 481 | Ga0495606_0000371 | 3300046507 | Bacteria | 76806 |
| 482 | Ga0495606_0000461 | 3300046507 | Bacteria | 66807 |
| 483 | Ga0495606_0001419 | 3300046507 | Bacteria | 32193 |
| 484 | Ga0495606_0002328 | 3300046507 | Bacteria | 22395 |
| 485 | Ga0495606_0008626 | 3300046507 | Bacteria | 8810 |
| 486 | Ga0495606_0018254 | 3300046507 | Bacteria | 5268 |
| 487 | Ga0495606_0253326 | 3300046507 | Bacteria | 975 |
| 488 | Ga0495608_0018979 | 3300046511 | Bacteria | 4738 |
| 489 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 490 | Ga0495610_0001476 | 3300046512 | Bacteria | 20720 |
| 491 | Ga0495610_0004645 | 3300046512 | Bacteria | 10042 |
| 492 | Ga0495610_0010298 | 3300046512 | Bacteria | 5821 |
| 493 | Ga0495616_0000036 | 3300046513 | Bacteria | 128264 |
| 494 | Ga0495616_0005947 | 3300046513 | Bacteria | 7441 |
| 495 | Ga0495616_0041033 | 3300046513 | Bacteria | 2362 |
| 496 | Ga0495616_0197999 | 3300046513 | Bacteria | 884 |
| 497 | Ga0495618_0011571 | 3300046514 | Bacteria | 5354 |
| 498 | Ga0495628_0002796 | 3300046516 | Bacteria | 15660 |
| 499 | Ga0495628_0052698 | 3300046516 | Bacteria | 3213 |
| 500 | Ga0495631_0004837 | 3300046518 | Bacteria | 7100 |
| 501 | Ga0495632_0001532 | 3300046519 | Bacteria | 19084 |
| 502 | Ga0495632_0004109 | 3300046519 | Bacteria | 10026 |
| 503 | Ga0495632_0074080 | 3300046519 | Bacteria | 1631 |
| 504 | Ga0495637_0001597 | 3300046520 | Bacteria | 13157 |
| 505 | Ga0495643_0000179 | 3300046522 | Bacteria | 100406 |
| 506 | Ga0495643_0000287 | 3300046522 | Bacteria | 72080 |
| 507 | Ga0495643_0011258 | 3300046522 | Bacteria | 5460 |
| 508 | Ga0495643_0069626 | 3300046522 | Bacteria | 1849 |
| 509 | Ga0495643_0091541 | 3300046522 | Bacteria | 1568 |
| 510 | Ga0495644_0002342 | 3300046523 | Bacteria | 7553 |
| 511 | Ga0495644_0003908 | 3300046523 | Bacteria | 5868 |
| 512 | Ga0495644_0034344 | 3300046523 | Bacteria | 1914 |
| 513 | Ga0495644_0077710 | 3300046523 | Bacteria | 1250 |
| 514 | Ga0495648_0000058 | 3300046524 | Bacteria | 156717 |
| 515 | Ga0495648_0012123 | 3300046524 | Bacteria | 6453 |
| 516 | Ga0495648_0032542 | 3300046524 | Bacteria | 3419 |
| 517 | Ga0495663_0000299 | 3300046525 | Bacteria | 18832 |
| 518 | Ga0495663_0006649 | 3300046525 | Bacteria | 3190 |
| 519 | Ga0495666_0040246 | 3300046526 | Bacteria | 2267 |
| 520 | Ga0495642_0000223 | 3300046528 | Bacteria | 32585 |
| 521 | Ga0495642_0006585 | 3300046528 | Bacteria | 4457 |
| 522 | Ga0495642_0195445 | 3300046528 | Bacteria | 881 |
| 523 | Ga0495652_0038065 | 3300046529 | Bacteria | 4169 |
| 524 | Ga0495652_0049372 | 3300046529 | Bacteria | 3602 |
| 525 | Ga0495652_0184547 | 3300046529 | Bacteria | 1597 |
| 526 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 527 | Ga0495609_0016132 | 3300046538 | Bacteria | 3485 |
| 528 | Ga0495609_0080768 | 3300046538 | Bacteria | 1421 |
| 529 | Ga0495609_0084539 | 3300046538 | Bacteria | 1384 |
| 530 | Ga0495597_0000209 | 3300046542 | Bacteria | 53295 |
| 531 | Ga0495597_0000242 | 3300046542 | Bacteria | 49561 |
| 532 | Ga0495645_0009101 | 3300046543 | Bacteria | 6939 |
| 533 | Ga0495645_0020795 | 3300046543 | Bacteria | 4741 |
| 534 | Ga0495622_0000468 | 3300046557 | Bacteria | 25821 |
| 535 | Ga0495622_0037101 | 3300046557 | Bacteria | 2270 |
| 536 | Ga0495633_0000119 | 3300046558 | Bacteria | 106455 |
| 537 | Ga0495633_0000249 | 3300046558 | Bacteria | 64232 |
| 538 | Ga0495633_0001297 | 3300046558 | Bacteria | 19748 |
| 539 | Ga0495633_0002317 | 3300046558 | Bacteria | 13558 |
| 540 | Ga0495633_0009262 | 3300046558 | Bacteria | 5455 |
| 541 | Ga0495633_0034772 | 3300046558 | Bacteria | 2422 |
| 542 | Ga0495633_0117770 | 3300046558 | Bacteria | 1230 |
| 543 | Ga0495656_0052552 | 3300046615 | Bacteria | 1747 |
| 544 | Ga0495668_0000337 | 3300046616 | Bacteria | 63494 |
| 545 | Ga0495611_0004289 | 3300046648 | Bacteria | 6194 |
| 546 | Ga0495611_0019241 | 3300046648 | Bacteria | 2933 |
| 547 | Ga0495611_0023655 | 3300046648 | Bacteria | 2667 |
| 548 | Ga0495611_0082418 | 3300046648 | Bacteria | 1480 |
| 549 | Ga0495625_0000132 | 3300046660 | Bacteria | 115728 |
| 550 | Ga0495625_0000139 | 3300046660 | Bacteria | 112271 |
| 551 | Ga0495625_0001396 | 3300046660 | Bacteria | 29588 |
| 552 | Ga0495625_0002129 | 3300046660 | Bacteria | 22079 |
| 553 | Ga0495625_0002623 | 3300046660 | Bacteria | 19215 |
| 554 | Ga0495625_0003498 | 3300046660 | Bacteria | 15570 |
| 555 | Ga0495659_0000054 | 3300046664 | Bacteria | 51199 |
| 556 | Ga0495659_0001118 | 3300046664 | Bacteria | 9335 |
| 557 | Ga0495659_0068463 | 3300046664 | Bacteria | 1326 |
| 558 | Ga0495661_0000094 | 3300046665 | Bacteria | 109394 |
| 559 | Ga0495661_0027405 | 3300046665 | Bacteria | 3658 |
| 560 | Ga0495661_0035739 | 3300046665 | Bacteria | 3115 |
| 561 | Ga0495661_0036819 | 3300046665 | Bacteria | 3059 |
| 562 | Ga0495588_0000110 | 3300046674 | Bacteria | 142825 |
| 563 | Ga0495588_0026084 | 3300046674 | Bacteria | 2915 |
| 564 | Ga0495599_0000399 | 3300046678 | Bacteria | 24819 |
| 565 | Ga0495623_0005943 | 3300046679 | Bacteria | 7955 |
| 566 | Ga0495646_0000446 | 3300046680 | Bacteria | 21847 |
| 567 | Ga0495669_0000041 | 3300046684 | Bacteria | 88966 |
| 568 | Ga0495613_0109713 | 3300046689 | Bacteria | 1989 |
| 569 | Ga0495624_0019179 | 3300046690 | Bacteria | 4569 |
| 570 | Ga0495670_0010366 | 3300046691 | Bacteria | 4579 |
| 571 | Ga0495670_0028609 | 3300046691 | Bacteria | 2762 |
| 572 | Ga0495670_0039030 | 3300046691 | Bacteria | 2368 |
| 573 | Ga0495670_0062625 | 3300046691 | Bacteria | 1872 |
| 574 | Ga0495671_0000314 | 3300046692 | Bacteria | 41125 |
| 575 | Ga0495671_0000582 | 3300046692 | Bacteria | 27065 |
| 576 | Ga0495671_0001195 | 3300046692 | Bacteria | 17789 |
| 577 | Ga0495671_0092095 | 3300046692 | Bacteria | 1483 |
| 578 | Ga0495649_0140133 | 3300046694 | Bacteria | 1273 |
| 579 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 580 | Ga0495589_0002079 | 3300046794 | Bacteria | 11326 |
| 581 | Ga0495600_0002038 | 3300046809 | Bacteria | 11377 |
| 582 | Ga0495660_0004026 | 3300046810 | Bacteria | 8972 |
| 583 | Ga0495660_0009308 | 3300046810 | Bacteria | 5728 |
| 584 | Ga0495581_0014620 | 3300047315 | Bacteria | 4550 |
| 585 | Ga0495581_0319056 | 3300047315 | Bacteria | 908 |
| 586 | Ga0495604_0002313 | 3300047317 | Bacteria | 15272 |
| 587 | Ga0495636_0071636 | 3300047318 | Bacteria | 1480 |
| 588 | Ga0495636_0168335 | 3300047318 | Bacteria | 990 |
| 589 | Ga0495672_0000263 | 3300047320 | Bacteria | 72879 |
| 590 | Ga0495672_0016756 | 3300047320 | Bacteria | 4921 |
| 591 | Ga0495672_0028738 | 3300047320 | Bacteria | 3512 |
| 592 | Ga0495683_0003113 | 3300047323 | Bacteria | 9722 |
| 593 | Ga0495683_0003818 | 3300047323 | Bacteria | 8693 |
| 594 | Ga0495683_0017927 | 3300047323 | Bacteria | 3665 |
| 595 | Ga0495683_0028091 | 3300047323 | Bacteria | 2876 |
| 596 | Ga0495683_0223067 | 3300047323 | Bacteria | 839 |
| 597 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 598 | Ga0495687_000296 | 3300047443 | Bacteria | 65626 |
| 599 | Ga0495687_001591 | 3300047443 | Bacteria | 20510 |
| 600 | Ga0495687_030413 | 3300047443 | Bacteria | 2486 |
| 601 | Ga0495675_0097764 | 3300047444 | Bacteria | 1839 |
| 602 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 603 | Ga0495677_0000590 | 3300047445 | Bacteria | 14890 |
| 604 | Ga0495677_0010069 | 3300047445 | Bacteria | 3478 |
| 605 | Ga0495677_0112482 | 3300047445 | Bacteria | 1035 |
| 606 | Ga0495679_031183 | 3300047446 | Bacteria | 1722 |
| 607 | Ga0495685_000416 | 3300047447 | Bacteria | 13459 |
| 608 | Ga0495685_039173 | 3300047447 | Bacteria | 1622 |
| 609 | Ga0495685_052210 | 3300047447 | Bacteria | 1385 |
| 610 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 611 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 612 | Ga0495681_0007045 | 3300047470 | Bacteria | 7258 |
| 613 | Ga0495686_0000295 | 3300047472 | Bacteria | 86824 |
| 614 | Ga0495686_0001364 | 3300047472 | Bacteria | 27253 |
| 615 | Ga0495686_0059195 | 3300047472 | Bacteria | 2385 |
| 616 | Ga0495602_0040199 | 3300048088 | Bacteria | 4293 |
| 617 | Ga0495602_0227554 | 3300048088 | Bacteria | 1403 |
| 618 | Ga0495614_0199754 | 3300048089 | Bacteria | 904 |
| 619 | Ga0495626_0000494 | 3300048091 | Bacteria | 39727 |
| 620 | Ga0495626_0000711 | 3300048091 | Bacteria | 31405 |
| 621 | Ga0495626_0008460 | 3300048091 | Bacteria | 5639 |
| 622 | Ga0495626_0039518 | 3300048091 | Bacteria | 2232 |
| 623 | Ga0495626_0074916 | 3300048091 | Bacteria | 1513 |
| 624 | Ga0495626_0109991 | 3300048091 | Bacteria | 1194 |
| 625 | Ga0496100_0003016 | 3300048903 | Bacteria | 8684 |
| 626 | Ga0496101_0002894 | 3300048904 | Bacteria | 10563 |
| 627 | Ga0496102_0038216 | 3300048905 | Bacteria | 4331 |
| 628 | Ga0496102_0077507 | 3300048905 | Bacteria | 3059 |
| 629 | Ga0496104_0681864 | 3300048907 | Bacteria | 936 |
| 630 | Ga0496106_0037602 | 3300048909 | Bacteria | 3622 |
| 631 | Ga0496106_0179271 | 3300048909 | Bacteria | 1681 |
| 632 | Ga0496108_0198824 | 3300048911 | Bacteria | 1739 |
| 633 | Ga0496109_0020721 | 3300048912 | Bacteria | 5807 |
| 634 | Ga0496109_0208907 | 3300048912 | Bacteria | 1836 |
| 635 | Ga0496110_0069311 | 3300048913 | Bacteria | 3123 |
| 636 | Ga0496111_0305982 | 3300048914 | Bacteria | 1178 |
| 637 | Ga0496112_0046686 | 3300048915 | Bacteria | 4249 |
| 638 | Ga0496113_0198113 | 3300048916 | Bacteria | 1596 |
| 639 | Ga0496114_0000701 | 3300048917 | Bacteria | 24988 |
| 640 | Ga0496114_0018872 | 3300048917 | Bacteria | 5584 |
| 641 | Ga0496116_0003933 | 3300048919 | Bacteria | 14459 |
| 642 | Ga0496116_0064539 | 3300048919 | Bacteria | 2353 |
| 643 | Ga0496118_0151056 | 3300048921 | Bacteria | 1454 |
| 644 | Ga0496121_0000372 | 3300048924 | Bacteria | 92348 |
| 645 | Ga0496121_0005323 | 3300048924 | Bacteria | 16544 |
| 646 | Ga0496121_0016968 | 3300048924 | Bacteria | 7479 |
| 647 | Ga0496121_0061327 | 3300048924 | Bacteria | 3087 |
| 648 | Ga0496121_0279831 | 3300048924 | Bacteria | 1142 |
| 649 | Ga0496122_0000165 | 3300048925 | Bacteria | 157612 |
| 650 | Ga0496122_0000887 | 3300048925 | Bacteria | 55765 |
| 651 | Ga0496122_0067755 | 3300048925 | Bacteria | 2568 |
| 652 | Ga0496123_0000180 | 3300048926 | Bacteria | 127726 |
| 653 | Ga0496123_0000471 | 3300048926 | Bacteria | 70580 |
| 654 | Ga0496123_0008827 | 3300048926 | Bacteria | 9186 |
| 655 | Ga0496123_0043490 | 3300048926 | Bacteria | 3084 |
| 656 | Ga0496124_0041418 | 3300048927 | Bacteria | 3974 |
| 657 | Ga0496125_0005042 | 3300048928 | Bacteria | 14901 |
| 658 | Ga0496125_0074638 | 3300048928 | Bacteria | 2628 |
| 659 | Ga0496125_0143265 | 3300048928 | Bacteria | 1657 |
| 660 | Ga0496126_0007665 | 3300048929 | Bacteria | 11782 |
| 661 | Ga0496126_0170497 | 3300048929 | Bacteria | 1854 |
| 662 | Ga0495678_000283 | 3300049459 | Bacteria | 55712 |
| 663 | Ga0495678_000365 | 3300049459 | Bacteria | 46300 |
| 664 | Ga0495678_003240 | 3300049459 | Bacteria | 10196 |
| 665 | Ga0495678_041790 | 3300049459 | Bacteria | 1831 |
| 666 | Ga0495682_0000188 | 3300049460 | Bacteria | 50664 |
| 667 | Ga0501033_0059786 | 3300049570 | Bacteria | 2814 |
| 668 | Ga0501034_0000321 | 3300049571 | Bacteria | 84273 |
| 669 | Ga0501034_0128376 | 3300049571 | Bacteria | 2520 |
| 670 | Ga0501039_0544289 | 3300049575 | Bacteria | 911 |
| 671 | Ga0501068_0361300 | 3300049584 | Bacteria | 934 |
| 672 | Ga0501077_0151048 | 3300049593 | Bacteria | 1474 |
| 673 | Ga0501249_003568 | 3300049679 | Bacteria | 3128 |
| 674 | Ga0501225_0037693 | 3300049705 | Bacteria | 1332 |
| 675 | Ga0501080_0167775 | 3300049742 | Bacteria | 2025 |
| 676 | Ga0501083_0041654 | 3300049744 | Bacteria | 3114 |
| 677 | Ga0501263_007207 | 3300049760 | Bacteria | 1304 |
| 678 | Ga0501269_000017 | 3300049766 | Bacteria | 57974 |
| 679 | Ga0501035_0000652 | 3300049822 | Bacteria | 38210 |
| 680 | Ga0501035_0028900 | 3300049822 | Bacteria | 5059 |
| 681 | Ga0501044_0000065 | 3300049823 | Bacteria | 130072 |
| 682 | Ga0501044_0071447 | 3300049823 | Bacteria | 3529 |
| 683 | nmdc:mga05p37_267918_c1 | 3300050507 | Bacteria | 2042 |
| 684 | nmdc:mga05p37_404326_c1 | 3300050507 | Bacteria | 1593 |
| 685 | nmdc:mga0qj67_11460_c1 | 3300050509 | Bacteria | 6643 |
| 686 | nmdc:mga06r32_284767_c1 | 3300050510 | Bacteria | 1639 |
| 687 | nmdc:mga06r32_7200_c1 | 3300050510 | Bacteria | 10027 |
| 688 | nmdc:mga08y16_152674_c1 | 3300050511 | Bacteria | 2400 |
| 689 | nmdc:mga08y16_37616_c1 | 3300050511 | Bacteria | 5081 |
| 690 | nmdc:mga08y16_620848_c1 | 3300050511 | Bacteria | 1088 |
| 691 | nmdc:mga0n895_135667_c1 | 3300050512 | Bacteria | 2487 |
| 692 | nmdc:mga0n895_2762_c1 | 3300050512 | Bacteria | 13867 |
| 693 | nmdc:mga0rr50_476448_c1 | 3300050513 | Bacteria | 1060 |
| 694 | nmdc:mga0a205_179577_c1 | 3300050515 | Bacteria | 2011 |
| 695 | nmdc:mga0a205_248209_c1 | 3300050515 | Bacteria | 1660 |
| 696 | nmdc:mga0a205_52399_c1 | 3300050515 | Bacteria | 3938 |
| 697 | nmdc:mga0a205_56645_c1 | 3300050515 | Bacteria | 3784 |
| 698 | Ga0495601_0011605 | 3300053077 | Bacteria | 5278 |
| 699 | Ga0495601_0019691 | 3300053077 | Bacteria | 4118 |
| 700 | Ga0495601_0123067 | 3300053077 | Bacteria | 1686 |
| 701 | Ga0500635_0000026 | 3300053080 | Bacteria | 104983 |
| 702 | Ga0500660_170555 | 3300053100 | Unclassified | 806 |
| 703 | Ga0500594_0035457 | 3300053118 | Bacteria | 1338 |
| 704 | Ga0500595_002138 | 3300053119 | Bacteria | 10061 |
| 705 | Ga0500564_081302 | 3300053138 | Bacteria | 1452 |
| 706 | Ga0500619_010923 | 3300053154 | Bacteria | 2317 |
| 707 | Ga0500636_0060106 | 3300053177 | Bacteria | 2219 |
| 708 | Ga0501082_0042873 | 3300060353 | Bacteria | 3900 |
| 709 | Ga0466962_0016392 | 3300061719 | Bacteria | 3574 |
| 710 | Ga0466962_0107047 | 3300061719 | Bacteria | 1345 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042157 | Ga0439458_0152058 | Ga0439458_0152058_11_610 | 199 |
| 2 | 3300046492 | Ga0495585_0027981 | Ga0495585_0027981_1160_1906 | 207 |
| 3 | 3300039145 | Ga0237816_00313 | Ga0237816_00313_1215_1949 | 210 |
| 4 | 3300053100 | Ga0500660_170555 | Ga0500660_170555_149_787 | 211 |
| 5 | 3300047323 | Ga0495683_0028091 | Ga0495683_0028091_2153_2794 | 213 |
| 6 | 3300048924 | Ga0496121_0016968 | Ga0496121_0016968_2277_3008 | 213 |
| 7 | 3300048925 | Ga0496122_0000165 | Ga0496122_0000165_91220_91951 | 213 |
| 8 | 3300048926 | Ga0496123_0000471 | Ga0496123_0000471_18413_19144 | 213 |
| 9 | 3300048927 | Ga0496124_0041418 | Ga0496124_0041418_50_781 | 213 |
| 10 | 3300048928 | Ga0496125_0143265 | Ga0496125_0143265_155_886 | 213 |
| 11 | 3300048929 | Ga0496126_0170497 | Ga0496126_0170497_970_1701 | 213 |
| 12 | 3300025292 | Ga0209676_1005920 | Ga0209676_10059208 | 214 |
| 13 | 3300025298 | Ga0209050_1011592 | Ga0209050_10115922 | 214 |
| 14 | 3300025303 | Ga0209051_1037524 | Ga0209051_10375243 | 214 |
| 15 | 3300041404 | Ga0439436_0030789 | Ga0439436_0030789_815_1549 | 215 |
| 16 | 3300048919 | Ga0496116_0003933 | Ga0496116_0003933_1504_2235 | 215 |
| 17 | 3300041413 | Ga0439465_0000949 | Ga0439465_0000949_833_1567 | 217 |
| 18 | 3300042007 | Ga0439449_0000014 | Ga0439449_0000014_43334_44068 | 217 |
| 19 | 3300048924 | Ga0496121_0279831 | Ga0496121_0279831_72_803 | 217 |
| 20 | 3300031911 | Ga0307412_10000595 | Ga0307412_1000059518 | 218 |
| 21 | 3300002774 | JGI25150J39212_1000643 | JGI25150J39212_10006432 | 220 |
| 22 | 3300003187 | JGI25151J46595_10023515 | JGI25151J46595_100235153 | 220 |
| 23 | 3300003215 | JGI25153J46596_10018456 | JGI25153J46596_100184561 | 220 |
| 24 | 3300025245 | Ga0207425_1000484 | Ga0207425_10004847 | 220 |
| 25 | 3300025294 | Ga0209025_1002077 | Ga0209025_100207720 | 220 |
| 26 | 3300025297 | Ga0209758_1000489 | Ga0209758_100048940 | 220 |
| 27 | 3300049584 | Ga0501068_0361300 | Ga0501068_0361300_164_889 | 220 |
| 28 | 3300053138 | Ga0500564_081302 | Ga0500564_081302_490_1242 | 221 |
| 29 | 3300053177 | Ga0500636_0060106 | Ga0500636_0060106_1026_1778 | 221 |
| 30 | 3300038443 | Ga0395901_0343105 | Ga0395901_0343105_18_689 | 222 |
| 31 | 3300042007 | Ga0439449_0037619 | Ga0439449_0037619_678_1412 | 222 |
| 32 | 3300042115 | Ga0450911_018912 | Ga0450911_018912_144_878 | 222 |
| 33 | 3300046454 | Ga0495592_0451578 | Ga0495592_0451578_126_794 | 222 |
| 34 | 3300002705 | JGI25156J39149_1000038 | JGI25156J39149_1000038116 | 223 |
| 35 | 3300002738 | JGI25154J39366_1001243 | JGI25154J39366_10012436 | 223 |
| 36 | 3300002741 | JGI25157J39369_1000127 | JGI25157J39369_100012717 | 223 |
| 37 | 3300003752 | Ga0055539_1002307 | Ga0055539_10023072 | 223 |
| 38 | 3300005339 | Ga0070660_100096503 | Ga0070660_1000965032 | 223 |
| 39 | 3300005539 | Ga0068853_100112756 | Ga0068853_1001127562 | 223 |
| 40 | 3300005563 | Ga0068855_100432521 | Ga0068855_1004325212 | 223 |
| 41 | 3300005577 | Ga0068857_100001885 | Ga0068857_10000188513 | 223 |
| 42 | 3300005614 | Ga0068856_100005894 | Ga0068856_1000058949 | 223 |
| 43 | 3300009093 | Ga0105240_10247730 | Ga0105240_102477302 | 223 |
| 44 | 3300009174 | Ga0105241_10134780 | Ga0105241_101347802 | 223 |
| 45 | 3300009551 | Ga0105238_10071473 | Ga0105238_100714734 | 223 |
| 46 | 3300013105 | Ga0157369_10059033 | Ga0157369_100590336 | 223 |
| 47 | 3300013307 | Ga0157372_10459518 | Ga0157372_104595182 | 223 |
| 48 | 3300025246 | Ga0209646_1000094 | Ga0209646_100009454 | 223 |
| 49 | 3300025250 | Ga0209026_1000009 | Ga0209026_1000009147 | 223 |
| 50 | 3300025253 | Ga0209677_100097 | Ga0209677_10009788 | 223 |
| 51 | 3300025256 | Ga0209759_1000065 | Ga0209759_1000065147 | 223 |
| 52 | 3300025913 | Ga0207695_10166765 | Ga0207695_101667652 | 223 |
| 53 | 3300025914 | Ga0207671_10371265 | Ga0207671_103712652 | 223 |
| 54 | 3300025919 | Ga0207657_10108673 | Ga0207657_101086732 | 223 |
| 55 | 3300025924 | Ga0207694_10030681 | Ga0207694_100306812 | 223 |
| 56 | 3300025949 | Ga0207667_10149506 | Ga0207667_101495062 | 223 |
| 57 | 3300025981 | Ga0207640_10030508 | Ga0207640_100305084 | 223 |
| 58 | 3300026041 | Ga0207639_10055568 | Ga0207639_100555682 | 223 |
| 59 | 3300026078 | Ga0207702_10000610 | Ga0207702_1000061033 | 223 |
| 60 | 3300028666 | Ga0265336_10035474 | Ga0265336_100354742 | 223 |
| 61 | 3300025256 | Ga0209759_1003887 | Ga0209759_10038872 | 224 |
| 62 | 3300046501 | Ga0495607_0006297 | Ga0495607_0006297_1387_2124 | 224 |
| 63 | 3300046507 | Ga0495606_0000141 | Ga0495606_0000141_83343_84080 | 224 |
| 64 | 3300046558 | Ga0495633_0009262 | Ga0495633_0009262_1581_2318 | 224 |
| 65 | 3300047444 | Ga0495675_0097764 | Ga0495675_0097764_227_961 | 224 |
| 66 | 3300048089 | Ga0495614_0199754 | Ga0495614_0199754_88_822 | 224 |
| 67 | 3300046526 | Ga0495666_0040246 | Ga0495666_0040246_1197_1931 | 225 |
| 68 | 3300003771 | Ga0055526_1000066 | Ga0055526_100006639 | 226 |
| 69 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009603 | 226 |
| 70 | 3300046491 | Ga0495584_0000021 | Ga0495584_0000021_120132_120866 | 227 |
| 71 | 3300046507 | Ga0495606_0001419 | Ga0495606_0001419_26161_26895 | 227 |
| 72 | 3300014969 | Ga0157376_10412447 | Ga0157376_104124472 | 228 |
| 73 | 3300032002 | Ga0307416_100883448 | Ga0307416_1008834482 | 228 |
| 74 | 3300046457 | Ga0495590_0044275 | Ga0495590_0044275_409_1143 | 228 |
| 75 | 3300046492 | Ga0495585_0024974 | Ga0495585_0024974_1906_2640 | 228 |
| 76 | 3300046501 | Ga0495607_0031071 | Ga0495607_0031071_239_973 | 228 |
| 77 | 3300046506 | Ga0495583_0000060 | Ga0495583_0000060_166364_167098 | 228 |
| 78 | 3300046513 | Ga0495616_0041033 | Ga0495616_0041033_1309_2043 | 228 |
| 79 | 3300046518 | Ga0495631_0004837 | Ga0495631_0004837_1957_2691 | 228 |
| 80 | 3300046519 | Ga0495632_0004109 | Ga0495632_0004109_1039_1773 | 228 |
| 81 | 3300046523 | Ga0495644_0003908 | Ga0495644_0003908_3093_3827 | 228 |
| 82 | 3300046538 | Ga0495609_0016132 | Ga0495609_0016132_388_1122 | 228 |
| 83 | 3300046648 | Ga0495611_0004289 | Ga0495611_0004289_2313_3047 | 228 |
| 84 | 3300046665 | Ga0495661_0036819 | Ga0495661_0036819_369_1103 | 228 |
| 85 | 3300046694 | Ga0495649_0140133 | Ga0495649_0140133_10_744 | 228 |
| 86 | 3300046794 | Ga0495589_0002079 | Ga0495589_0002079_6102_6836 | 228 |
| 87 | 3300046810 | Ga0495660_0004026 | Ga0495660_0004026_466_1200 | 228 |
| 88 | 3300047323 | Ga0495683_0017927 | Ga0495683_0017927_2491_3225 | 228 |
| 89 | 3300047470 | Ga0495681_0007045 | Ga0495681_0007045_980_1714 | 228 |
| 90 | 3300049459 | Ga0495678_003240 | Ga0495678_003240_5501_6235 | 228 |
| 91 | 3300028573 | Ga0265334_10000500 | Ga0265334_1000050019 | 229 |
| 92 | 3300044842 | Ga0466957_0029147 | Ga0466957_0029147_1319_2041 | 230 |
| 93 | 3300046474 | Ga0495605_0000251 | Ga0495605_0000251_42058_42795 | 230 |
| 94 | 3300046474 | Ga0495605_0008057 | Ga0495605_0008057_3929_4663 | 230 |
| 95 | 3300046491 | Ga0495584_0019130 | Ga0495584_0019130_466_1200 | 230 |
| 96 | 3300046501 | Ga0495607_0007143 | Ga0495607_0007143_3759_4493 | 230 |
| 97 | 3300046513 | Ga0495616_0005947 | Ga0495616_0005947_6082_6816 | 230 |
| 98 | 3300046528 | Ga0495642_0195445 | Ga0495642_0195445_42_776 | 230 |
| 99 | 3300046538 | Ga0495609_0000039 | Ga0495609_0000039_101070_101804 | 230 |
| 100 | 3300046665 | Ga0495661_0000094 | Ga0495661_0000094_5765_6499 | 230 |
| 101 | 3300046794 | Ga0495589_0000019 | Ga0495589_0000019_102841_103575 | 230 |
| 102 | 3300047443 | Ga0495687_000059 | Ga0495687_000059_101070_101804 | 230 |
| 103 | 3300047445 | Ga0495677_0000006 | Ga0495677_0000006_97427_98161 | 230 |
| 104 | 3300047445 | Ga0495677_0000590 | Ga0495677_0000590_8868_9602 | 230 |
| 105 | 3300048091 | Ga0495626_0000494 | Ga0495626_0000494_22129_22863 | 230 |
| 106 | 3300037418 | Ga0395900_0000343 | Ga0395900_0000343_45451_46185 | 231 |
| 107 | 3300038443 | Ga0395901_0000033 | Ga0395901_0000033_18734_19468 | 231 |
| 108 | 3300048091 | Ga0495626_0008460 | Ga0495626_0008460_424_1158 | 231 |
| 109 | 3300049760 | Ga0501263_007207 | Ga0501263_007207_451_1179 | 231 |
| 110 | 3300028666 | Ga0265336_10000061 | Ga0265336_1000006143 | 232 |
| 111 | 3300029957 | Ga0265324_10001696 | Ga0265324_100016969 | 232 |
| 112 | 3300049705 | Ga0501225_0037693 | Ga0501225_0037693_427_1161 | 232 |
| 113 | 3300030744 | Ga0316181_1163091 | Ga0316181_11630912 | 233 |
| 114 | 3300044706 | Ga0466964_0000727 | Ga0466964_0000727_9869_10603 | 233 |
| 115 | 3300044712 | Ga0453684_0452472 | Ga0453684_0452472_335_1069 | 233 |
| 116 | 3300045976 | Ga0466967_0010517 | Ga0466967_0010517_596_1330 | 233 |
| 117 | 3300046522 | Ga0495643_0011258 | Ga0495643_0011258_759_1493 | 233 |
| 118 | 3300048091 | Ga0495626_0039518 | Ga0495626_0039518_84_818 | 233 |
| 119 | 3300009036 | Ga0105244_10010768 | Ga0105244_100107684 | 235 |
| 120 | 3300009092 | Ga0105250_10003510 | Ga0105250_100035105 | 235 |
| 121 | 3300009553 | Ga0105249_10004745 | Ga0105249_100047456 | 235 |
| 122 | 3300013102 | Ga0157371_10187003 | Ga0157371_101870032 | 235 |
| 123 | 3300035410 | Ga0373924_0191022 | Ga0373924_0191022_156_884 | 235 |
| 124 | 3300036401 | Ga0373937_0080873 | Ga0373937_0080873_312_1040 | 235 |
| 125 | 3300042007 | Ga0439449_0058479 | Ga0439449_0058479_694_1404 | 236 |
| 126 | 3300048907 | Ga0496104_0681864 | Ga0496104_0681864_16_726 | 236 |
| 127 | 3300050513 | nmdc:mga0rr50_476448_c1 | nmdc:mga0rr50_476448_c1_61_771 | 236 |
| 128 | iso_pu_bacteria | 2597490356 | 2599105455 | 236 |
| 129 | iso_pu_bacteria | 2648501241 | 2649122548 | 236 |
| 130 | iso_pu_bacteria | 2651869818 | 2652976069 | 236 |
| 131 | iso_pu_bacteria | 2846952575 | 2846954861 | 236 |
| 132 | iso_pu_bacteria | 2848858292 | 2848860465 | 236 |
| 133 | iso_pu_bacteria | 2883354860 | 2883357790 | 236 |
| 134 | iso_pu_bacteria | 2919493220 | 2919493772 | 236 |
| 135 | iso_pu_bacteria | 2919497567 | 2919500914 | 236 |
| 136 | iso_pu_bacteria | 2919543075 | 2919545656 | 236 |
| 137 | 3300005564 | Ga0070664_100014986 | Ga0070664_1000149862 | 237 |
| 138 | 3300005578 | Ga0068854_100370055 | Ga0068854_1003700552 | 237 |
| 139 | 3300005614 | Ga0068856_100289864 | Ga0068856_1002898643 | 237 |
| 140 | 3300005616 | Ga0068852_100225294 | Ga0068852_1002252943 | 237 |
| 141 | 3300009551 | Ga0105238_10025802 | Ga0105238_100258024 | 237 |
| 142 | 3300009551 | Ga0105238_10626828 | Ga0105238_106268282 | 237 |
| 143 | 3300013100 | Ga0157373_10397048 | Ga0157373_103970482 | 237 |
| 144 | 3300013102 | Ga0157371_10469304 | Ga0157371_104693042 | 237 |
| 145 | 3300025303 | Ga0209051_1045522 | Ga0209051_10455222 | 237 |
| 146 | 3300025920 | Ga0207649_10077159 | Ga0207649_100771593 | 237 |
| 147 | 3300026078 | Ga0207702_10068751 | Ga0207702_100687513 | 237 |
| 148 | 3300026142 | Ga0207698_10169060 | Ga0207698_101690602 | 237 |
| 149 | 3300037312 | Ga0395899_0014968 | Ga0395899_0014968_4422_5135 | 237 |
| 150 | 3300037312 | Ga0395899_0069039 | Ga0395899_0069039_1347_2063 | 237 |
| 151 | 3300037418 | Ga0395900_0038690 | Ga0395900_0038690_93_809 | 237 |
| 152 | 3300037466 | Ga0395898_0140996 | Ga0395898_0140996_332_1045 | 237 |
| 153 | 3300038443 | Ga0395901_0010919 | Ga0395901_0010919_1442_2158 | 237 |
| 154 | iso_pu_bacteria | 2511231010 | 2511288796 | 237 |
| 155 | iso_pu_bacteria | 2593339238 | 2595446876 | 237 |
| 156 | iso_pu_bacteria | 2639762793 | 2640736784 | 237 |
| 157 | iso_pu_bacteria | 2643221621 | 2644123872 | 237 |
| 158 | iso_pu_bacteria | 2643221665 | 2644364163 | 237 |
| 159 | iso_pu_bacteria | 2675903507 | 2678230175 | 237 |
| 160 | iso_pu_bacteria | 2744054655 | 2745159466 | 237 |
| 161 | iso_pu_bacteria | 2773857761 | 2774390699 | 237 |
| 162 | iso_pu_bacteria | 2773857770 | 2774438268 | 237 |
| 163 | iso_pu_bacteria | 2811994881 | 2812370169 | 237 |
| 164 | iso_pu_bacteria | 2842914999 | 2842917581 | 237 |
| 165 | iso_pu_bacteria | 2916699645 | 2916700014 | 237 |
| 166 | iso_pu_bacteria | 2919063839 | 2919066162 | 237 |
| 167 | iso_pu_bacteria | 2919085039 | 2919088251 | 237 |
| 168 | iso_pu_bacteria | 2919182534 | 2919184900 | 237 |
| 169 | iso_pu_bacteria | 2919404418 | 2919406162 | 237 |
| 170 | iso_pu_bacteria | 2923519811 | 2923524260 | 237 |
| 171 | iso_pu_bacteria | 2941471342 | 2941472999 | 237 |
| 172 | iso_pu_bacteria | 2984568884 | 2984570869 | 237 |
| 173 | iso_pu_bacteria | 2990196909 | 2990199589 | 237 |
| 174 | iso_pu_bacteria | 3007718800 | 3007721213 | 237 |
| 175 | 3300046475 | Ga0495639_0075418 | Ga0495639_0075418_793_1509 | 238 |
| 176 | 3300046558 | Ga0495633_0034772 | Ga0495633_0034772_1229_1948 | 238 |
| 177 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_613793_614512 | 238 |
| 178 | 3300047469 | Ga0495673_0000024 | Ga0495673_0000024_252596_253315 | 238 |
| 179 | 3300048914 | Ga0496111_0305982 | Ga0496111_0305982_211_930 | 238 |
| 180 | iso_pu_bacteria | 2599185292 | 2599906823 | 238 |
| 181 | iso_pu_bacteria | 2891633521 | 2891634702 | 238 |
| 182 | iso_pu_bacteria | 2989392574 | 2989393238 | 238 |
| 183 | iso_pu_bacteria | 8001522603 | 8001522611 | 238 |
| 184 | 3300006852 | Ga0075433_10082756 | Ga0075433_100827563 | 239 |
| 185 | 3300048917 | Ga0496114_0018872 | Ga0496114_0018872_3445_4167 | 239 |
| 186 | 3300050515 | nmdc:mga0a205_52399_c1 | nmdc:mga0a205_52399_c1_365_1087 | 239 |
| 187 | iso_pu_bacteria | 2816332141 | 2816517960 | 239 |
| 188 | iso_pu_bacteria | 2842391507 | 2842394079 | 239 |
| 189 | iso_pu_bacteria | 2842711865 | 2842714484 | 239 |
| 190 | iso_pu_bacteria | 2857564685 | 2857565153 | 239 |
| 191 | iso_pu_bacteria | 2961064222 | 2961064387 | 239 |
| 192 | iso_pu_bacteria | 8057160832 | 8057163249 | 239 |
| 193 | 3300003323 | rootH1_10012135 | rootH1_1001213511 | 240 |
| 194 | 3300003775 | Ga0055524_1017692 | Ga0055524_10176922 | 240 |
| 195 | 3300003794 | Ga0055531_10021626 | Ga0055531_100216262 | 240 |
| 196 | 3300005288 | Ga0065714_10078862 | Ga0065714_100788622 | 240 |
| 197 | 3300005354 | Ga0070675_100129920 | Ga0070675_1001299203 | 240 |
| 198 | 3300006358 | Ga0068871_100053807 | Ga0068871_1000538072 | 240 |
| 199 | 3300009098 | Ga0105245_10383942 | Ga0105245_103839421 | 240 |
| 200 | 3300031456 | Ga0307513_10058089 | Ga0307513_100580893 | 240 |
| 201 | 3300031616 | Ga0307508_10078804 | Ga0307508_100788043 | 240 |
| 202 | 3300031824 | Ga0307413_10088180 | Ga0307413_100881802 | 240 |
| 203 | 3300031995 | Ga0307409_100710376 | Ga0307409_1007103761 | 240 |
| 204 | 3300032005 | Ga0307411_10139350 | Ga0307411_101393502 | 240 |
| 205 | 3300036401 | Ga0373937_0097205 | Ga0373937_0097205_1251_1976 | 240 |
| 206 | 3300041494 | Ga0451837_0176909 | Ga0451837_0176909_51_791 | 240 |
| 207 | 3300042876 | Ga0451577_0232380 | Ga0451577_0232380_933_1658 | 240 |
| 208 | 3300044712 | Ga0453684_0006727 | Ga0453684_0006727_20512_21237 | 240 |
| 209 | 3300045836 | Ga0466958_0026361 | Ga0466958_0026361_808_1533 | 240 |
| 210 | 3300046454 | Ga0495592_0141801 | Ga0495592_0141801_289_1014 | 240 |
| 211 | 3300046499 | Ga0495594_0044138 | Ga0495594_0044138_1469_2194 | 240 |
| 212 | 3300047315 | Ga0495581_0319056 | Ga0495581_0319056_16_741 | 240 |
| 213 | 3300049571 | Ga0501034_0128376 | Ga0501034_0128376_1674_2399 | 240 |
| 214 | 3300049575 | Ga0501039_0544289 | Ga0501039_0544289_78_806 | 240 |
| 215 | 3300049593 | Ga0501077_0151048 | Ga0501077_0151048_532_1260 | 240 |
| 216 | 3300049742 | Ga0501080_0167775 | Ga0501080_0167775_827_1552 | 240 |
| 217 | 3300049744 | Ga0501083_0041654 | Ga0501083_0041654_1373_2098 | 240 |
| 218 | 3300053077 | Ga0495601_0011605 | Ga0495601_0011605_4169_4894 | 240 |
| 219 | 3300060353 | Ga0501082_0042873 | Ga0501082_0042873_1249_1974 | 240 |
| 220 | iso_pu_bacteria | 2643221581 | 2643916617 | 240 |
| 221 | iso_pu_bacteria | 2738541276 | 2738714087 | 240 |
| 222 | iso_pu_bacteria | 2917832318 | 2917836389 | 240 |
| 223 | iso_pu_bacteria | 2923516293 | 2923518393 | 240 |
| 224 | 3300002705 | JGI25156J39149_1004474 | JGI25156J39149_10044743 | 241 |
| 225 | 3300002741 | JGI25157J39369_1001386 | JGI25157J39369_10013863 | 241 |
| 226 | 3300003752 | Ga0055539_1005513 | Ga0055539_10055132 | 241 |
| 227 | 3300003756 | Ga0055533_1001462 | Ga0055533_10014622 | 241 |
| 228 | 3300003759 | Ga0055525_1000027 | Ga0055525_1000027232 | 241 |
| 229 | 3300003760 | Ga0055527_1000199 | Ga0055527_100019914 | 241 |
| 230 | 3300003760 | Ga0055527_1000212 | Ga0055527_100021214 | 241 |
| 231 | 3300003761 | Ga0055535_1000585 | Ga0055535_100058517 | 241 |
| 232 | 3300003761 | Ga0055535_1000854 | Ga0055535_100085418 | 241 |
| 233 | 3300003761 | Ga0055535_1001004 | Ga0055535_100100420 | 241 |
| 234 | 3300003762 | Ga0055542_1000647 | Ga0055542_100064722 | 241 |
| 235 | 3300003762 | Ga0055542_1000687 | Ga0055542_10006875 | 241 |
| 236 | 3300003762 | Ga0055542_1000693 | Ga0055542_10006936 | 241 |
| 237 | 3300003763 | Ga0055529_1000590 | Ga0055529_100059023 | 241 |
| 238 | 3300003763 | Ga0055529_1001016 | Ga0055529_10010163 | 241 |
| 239 | 3300003856 | Ga0058692_1000008 | Ga0058692_100000898 | 241 |
| 240 | 3300005272 | Ga0065703_1000102 | Ga0065703_100010234 | 241 |
| 241 | 3300005288 | Ga0065714_10092344 | Ga0065714_100923443 | 241 |
| 242 | 3300005289 | Ga0065704_10011917 | Ga0065704_100119172 | 241 |
| 243 | 3300005289 | Ga0065704_10017134 | Ga0065704_100171342 | 241 |
| 244 | 3300005289 | Ga0065704_10021739 | Ga0065704_100217392 | 241 |
| 245 | 3300005330 | Ga0070690_100002403 | Ga0070690_1000024037 | 241 |
| 246 | 3300005331 | Ga0070670_100124570 | Ga0070670_1001245702 | 241 |
| 247 | 3300005331 | Ga0070670_100480735 | Ga0070670_1004807351 | 241 |
| 248 | 3300005334 | Ga0068869_100026093 | Ga0068869_1000260936 | 241 |
| 249 | 3300005337 | Ga0070682_100025981 | Ga0070682_1000259815 | 241 |
| 250 | 3300005337 | Ga0070682_100204144 | Ga0070682_1002041442 | 241 |
| 251 | 3300005337 | Ga0070682_100472669 | Ga0070682_1004726692 | 241 |
| 252 | 3300005338 | Ga0068868_100015104 | Ga0068868_1000151045 | 241 |
| 253 | 3300005340 | Ga0070689_100000069 | Ga0070689_10000006932 | 241 |
| 254 | 3300005343 | Ga0070687_100003030 | Ga0070687_1000030307 | 241 |
| 255 | 3300005344 | Ga0070661_100003084 | Ga0070661_1000030848 | 241 |
| 256 | 3300005345 | Ga0070692_10008974 | Ga0070692_100089742 | 241 |
| 257 | 3300005353 | Ga0070669_100000284 | Ga0070669_10000028417 | 241 |
| 258 | 3300005353 | Ga0070669_100001965 | Ga0070669_1000019653 | 241 |
| 259 | 3300005353 | Ga0070669_100105807 | Ga0070669_1001058072 | 241 |
| 260 | 3300005353 | Ga0070669_100113047 | Ga0070669_1001130472 | 241 |
| 261 | 3300005353 | Ga0070669_100614449 | Ga0070669_1006144492 | 241 |
| 262 | 3300005354 | Ga0070675_100003503 | Ga0070675_1000035038 | 241 |
| 263 | 3300005354 | Ga0070675_100023546 | Ga0070675_1000235466 | 241 |
| 264 | 3300005355 | Ga0070671_100019760 | Ga0070671_1000197602 | 241 |
| 265 | 3300005356 | Ga0070674_100036098 | Ga0070674_1000360983 | 241 |
| 266 | 3300005364 | Ga0070673_100000741 | Ga0070673_1000007412 | 241 |
| 267 | 3300005364 | Ga0070673_100144447 | Ga0070673_1001444472 | 241 |
| 268 | 3300005365 | Ga0070688_100008091 | Ga0070688_1000080916 | 241 |
| 269 | 3300005437 | Ga0070710_10029220 | Ga0070710_100292203 | 241 |
| 270 | 3300005439 | Ga0070711_100039163 | Ga0070711_1000391633 | 241 |
| 271 | 3300005440 | Ga0070705_100012699 | Ga0070705_1000126995 | 241 |
| 272 | 3300005441 | Ga0070700_100018379 | Ga0070700_1000183795 | 241 |
| 273 | 3300005444 | Ga0070694_100183238 | Ga0070694_1001832382 | 241 |
| 274 | 3300005456 | Ga0070678_100005340 | Ga0070678_1000053402 | 241 |
| 275 | 3300005466 | Ga0070685_10003995 | Ga0070685_100039956 | 241 |
| 276 | 3300005471 | Ga0070698_100199509 | Ga0070698_1001995091 | 241 |
| 277 | 3300005530 | Ga0070679_100255993 | Ga0070679_1002559932 | 241 |
| 278 | 3300005535 | Ga0070684_100000781 | Ga0070684_10000078114 | 241 |
| 279 | 3300005535 | Ga0070684_100716953 | Ga0070684_1007169532 | 241 |
| 280 | 3300005536 | Ga0070697_100238764 | Ga0070697_1002387642 | 241 |
| 281 | 3300005543 | Ga0070672_100016820 | Ga0070672_1000168206 | 241 |
| 282 | 3300005543 | Ga0070672_100171541 | Ga0070672_1001715412 | 241 |
| 283 | 3300005544 | Ga0070686_100000961 | Ga0070686_1000009618 | 241 |
| 284 | 3300005546 | Ga0070696_100300039 | Ga0070696_1003000392 | 241 |
| 285 | 3300005548 | Ga0070665_100003202 | Ga0070665_1000032022 | 241 |
| 286 | 3300005548 | Ga0070665_100038519 | Ga0070665_1000385196 | 241 |
| 287 | 3300005548 | Ga0070665_100721120 | Ga0070665_1007211202 | 241 |
| 288 | 3300005577 | Ga0068857_100308190 | Ga0068857_1003081902 | 241 |
| 289 | 3300005614 | Ga0068856_100001666 | Ga0068856_1000016668 | 241 |
| 290 | 3300005615 | Ga0070702_100002116 | Ga0070702_1000021164 | 241 |
| 291 | 3300005617 | Ga0068859_100000317 | Ga0068859_10000031736 | 241 |
| 292 | 3300005618 | Ga0068864_100001409 | Ga0068864_1000014096 | 241 |
| 293 | 3300005718 | Ga0068866_10026887 | Ga0068866_100268872 | 241 |
| 294 | 3300005719 | Ga0068861_100002710 | Ga0068861_10000271011 | 241 |
| 295 | 3300005719 | Ga0068861_100043657 | Ga0068861_1000436574 | 241 |
| 296 | 3300005840 | Ga0068870_10002367 | Ga0068870_100023676 | 241 |
| 297 | 3300005841 | Ga0068863_100001571 | Ga0068863_1000015716 | 241 |
| 298 | 3300005842 | Ga0068858_100010524 | Ga0068858_1000105248 | 241 |
| 299 | 3300005843 | Ga0068860_100495030 | Ga0068860_1004950302 | 241 |
| 300 | 3300005844 | Ga0068862_100003232 | Ga0068862_1000032326 | 241 |
| 301 | 3300005844 | Ga0068862_100010476 | Ga0068862_1000104762 | 241 |
| 302 | 3300005844 | Ga0068862_100071209 | Ga0068862_1000712093 | 241 |
| 303 | 3300006051 | Ga0075364_10191044 | Ga0075364_101910442 | 241 |
| 304 | 3300006173 | Ga0070716_100052090 | Ga0070716_1000520903 | 241 |
| 305 | 3300006173 | Ga0070716_100216682 | Ga0070716_1002166822 | 241 |
| 306 | 3300006237 | Ga0097621_100636088 | Ga0097621_1006360882 | 241 |
| 307 | 3300006358 | Ga0068871_100057038 | Ga0068871_1000570384 | 241 |
| 308 | 3300006844 | Ga0075428_100019852 | Ga0075428_1000198522 | 241 |
| 309 | 3300006844 | Ga0075428_100026168 | Ga0075428_1000261684 | 241 |
| 310 | 3300006846 | Ga0075430_100027879 | Ga0075430_1000278796 | 241 |
| 311 | 3300006847 | Ga0075431_100034434 | Ga0075431_1000344341 | 241 |
| 312 | 3300006847 | Ga0075431_100142209 | Ga0075431_1001422092 | 241 |
| 313 | 3300006852 | Ga0075433_10097948 | Ga0075433_100979483 | 241 |
| 314 | 3300006852 | Ga0075433_10169031 | Ga0075433_101690312 | 241 |
| 315 | 3300006852 | Ga0075433_10228962 | Ga0075433_102289622 | 241 |
| 316 | 3300006871 | Ga0075434_100010704 | Ga0075434_1000107042 | 241 |
| 317 | 3300006871 | Ga0075434_100148522 | Ga0075434_1001485222 | 241 |
| 318 | 3300006880 | Ga0075429_100257238 | Ga0075429_1002572382 | 241 |
| 319 | 3300006881 | Ga0068865_100234637 | Ga0068865_1002346371 | 241 |
| 320 | 3300006914 | Ga0075436_100086434 | Ga0075436_1000864342 | 241 |
| 321 | 3300006931 | Ga0097620_100000317 | Ga0097620_10000031736 | 241 |
| 322 | 3300007076 | Ga0075435_100323353 | Ga0075435_1003233531 | 241 |
| 323 | 3300009011 | Ga0105251_10019832 | Ga0105251_100198323 | 241 |
| 324 | 3300009036 | Ga0105244_10012197 | Ga0105244_100121975 | 241 |
| 325 | 3300009036 | Ga0105244_10201406 | Ga0105244_102014062 | 241 |
| 326 | 3300009036 | Ga0105244_10223513 | Ga0105244_102235132 | 241 |
| 327 | 3300009093 | Ga0105240_10006451 | Ga0105240_1000645118 | 241 |
| 328 | 3300009094 | Ga0111539_10016158 | Ga0111539_100161586 | 241 |
| 329 | 3300009094 | Ga0111539_10050989 | Ga0111539_100509894 | 241 |
| 330 | 3300009094 | Ga0111539_11203802 | Ga0111539_112038021 | 241 |
| 331 | 3300009098 | Ga0105245_10243483 | Ga0105245_102434833 | 241 |
| 332 | 3300009101 | Ga0105247_10024284 | Ga0105247_100242843 | 241 |
| 333 | 3300009147 | Ga0114129_10002450 | Ga0114129_100024504 | 241 |
| 334 | 3300009147 | Ga0114129_10141222 | Ga0114129_101412225 | 241 |
| 335 | 3300009147 | Ga0114129_10152994 | Ga0114129_101529944 | 241 |
| 336 | 3300009147 | Ga0114129_10223215 | Ga0114129_102232152 | 241 |
| 337 | 3300009148 | Ga0105243_10000041 | Ga0105243_1000004152 | 241 |
| 338 | 3300009148 | Ga0105243_10129664 | Ga0105243_101296642 | 241 |
| 339 | 3300009177 | Ga0105248_10004710 | Ga0105248_1000471013 | 241 |
| 340 | 3300009553 | Ga0105249_10057978 | Ga0105249_100579784 | 241 |
| 341 | 3300009553 | Ga0105249_10234890 | Ga0105249_102348902 | 241 |
| 342 | 3300010375 | Ga0105239_10079565 | Ga0105239_100795654 | 241 |
| 343 | 3300013104 | Ga0157370_10024113 | Ga0157370_100241133 | 241 |
| 344 | 3300013104 | Ga0157370_10168583 | Ga0157370_101685831 | 241 |
| 345 | 3300013306 | Ga0163162_10037464 | Ga0163162_100374645 | 241 |
| 346 | 3300013308 | Ga0157375_10041689 | Ga0157375_100416892 | 241 |
| 347 | 3300014325 | Ga0163163_10000326 | Ga0163163_100003265 | 241 |
| 348 | 3300014326 | Ga0157380_10130310 | Ga0157380_101303102 | 241 |
| 349 | 3300014745 | Ga0157377_10001044 | Ga0157377_100010445 | 241 |
| 350 | 3300014968 | Ga0157379_10038697 | Ga0157379_100386973 | 241 |
| 351 | 3300014969 | Ga0157376_10214509 | Ga0157376_102145092 | 241 |
| 352 | 3300015262 | Ga0182007_10010952 | Ga0182007_100109522 | 241 |
| 353 | 3300015265 | Ga0182005_1000070 | Ga0182005_100007050 | 241 |
| 354 | 3300025226 | Ga0209674_100086 | Ga0209674_100086124 | 241 |
| 355 | 3300025226 | Ga0209674_100654 | Ga0209674_10065412 | 241 |
| 356 | 3300025228 | Ga0209672_100005 | Ga0209672_100005733 | 241 |
| 357 | 3300025228 | Ga0209672_100029 | Ga0209672_100029237 | 241 |
| 358 | 3300025228 | Ga0209672_101479 | Ga0209672_1014792 | 241 |
| 359 | 3300025230 | Ga0209563_100023 | Ga0209563_100023392 | 241 |
| 360 | 3300025233 | Ga0209437_101634 | Ga0209437_1016344 | 241 |
| 361 | 3300025242 | Ga0209258_100006 | Ga0209258_100006733 | 241 |
| 362 | 3300025242 | Ga0209258_100053 | Ga0209258_10005393 | 241 |
| 363 | 3300025242 | Ga0209258_100064 | Ga0209258_100064263 | 241 |
| 364 | 3300025250 | Ga0209026_1000074 | Ga0209026_1000074189 | 241 |
| 365 | 3300025253 | Ga0209677_101749 | Ga0209677_1017493 | 241 |
| 366 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009237 | 241 |
| 367 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012733 | 241 |
| 368 | 3300025254 | Ga0209148_1000142 | Ga0209148_100014224 | 241 |
| 369 | 3300025254 | Ga0209148_1002194 | Ga0209148_10021947 | 241 |
| 370 | 3300025256 | Ga0209759_1003009 | Ga0209759_10030093 | 241 |
| 371 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008733 | 241 |
| 372 | 3300025272 | Ga0209455_1000060 | Ga0209455_1000060237 | 241 |
| 373 | 3300025272 | Ga0209455_1007600 | Ga0209455_10076002 | 241 |
| 374 | 3300025711 | Ga0207696_1009948 | Ga0207696_10099482 | 241 |
| 375 | 3300025728 | Ga0207655_1000951 | Ga0207655_100095112 | 241 |
| 376 | 3300025728 | Ga0207655_1001090 | Ga0207655_100109022 | 241 |
| 377 | 3300025728 | Ga0207655_1001100 | Ga0207655_100110022 | 241 |
| 378 | 3300025899 | Ga0207642_10002405 | Ga0207642_100024054 | 241 |
| 379 | 3300025900 | Ga0207710_10000021 | Ga0207710_1000002173 | 241 |
| 380 | 3300025907 | Ga0207645_10041524 | Ga0207645_100415242 | 241 |
| 381 | 3300025908 | Ga0207643_10002940 | Ga0207643_100029407 | 241 |
| 382 | 3300025913 | Ga0207695_10036390 | Ga0207695_100363905 | 241 |
| 383 | 3300025915 | Ga0207693_10077952 | Ga0207693_100779522 | 241 |
| 384 | 3300025918 | Ga0207662_10018978 | Ga0207662_100189783 | 241 |
| 385 | 3300025919 | Ga0207657_10014943 | Ga0207657_100149439 | 241 |
| 386 | 3300025920 | Ga0207649_10165720 | Ga0207649_101657202 | 241 |
| 387 | 3300025921 | Ga0207652_10213965 | Ga0207652_102139652 | 241 |
| 388 | 3300025923 | Ga0207681_10000437 | Ga0207681_100004375 | 241 |
| 389 | 3300025923 | Ga0207681_10047262 | Ga0207681_100472623 | 241 |
| 390 | 3300025923 | Ga0207681_10306878 | Ga0207681_103068782 | 241 |
| 391 | 3300025925 | Ga0207650_10118468 | Ga0207650_101184682 | 241 |
| 392 | 3300025926 | Ga0207659_10004743 | Ga0207659_100047436 | 241 |
| 393 | 3300025926 | Ga0207659_10048719 | Ga0207659_100487192 | 241 |
| 394 | 3300025933 | Ga0207706_10007482 | Ga0207706_1000748211 | 241 |
| 395 | 3300025933 | Ga0207706_10015852 | Ga0207706_100158524 | 241 |
| 396 | 3300025935 | Ga0207709_10000023 | Ga0207709_10000023254 | 241 |
| 397 | 3300025935 | Ga0207709_10014130 | Ga0207709_100141302 | 241 |
| 398 | 3300025936 | Ga0207670_10003260 | Ga0207670_100032606 | 241 |
| 399 | 3300025937 | Ga0207669_10043554 | Ga0207669_100435543 | 241 |
| 400 | 3300025938 | Ga0207704_10219976 | Ga0207704_102199762 | 241 |
| 401 | 3300025938 | Ga0207704_10278258 | Ga0207704_102782583 | 241 |
| 402 | 3300025939 | Ga0207665_10073551 | Ga0207665_100735512 | 241 |
| 403 | 3300025940 | Ga0207691_10013436 | Ga0207691_100134362 | 241 |
| 404 | 3300025940 | Ga0207691_10118786 | Ga0207691_101187862 | 241 |
| 405 | 3300025941 | Ga0207711_10003822 | Ga0207711_100038226 | 241 |
| 406 | 3300025942 | Ga0207689_10003105 | Ga0207689_1000310513 | 241 |
| 407 | 3300025961 | Ga0207712_10003212 | Ga0207712_100032128 | 241 |
| 408 | 3300025961 | Ga0207712_10037163 | Ga0207712_100371634 | 241 |
| 409 | 3300025961 | Ga0207712_10136360 | Ga0207712_101363602 | 241 |
| 410 | 3300025986 | Ga0207658_10008297 | Ga0207658_100082976 | 241 |
| 411 | 3300026023 | Ga0207677_10058547 | Ga0207677_100585472 | 241 |
| 412 | 3300026035 | Ga0207703_10033193 | Ga0207703_100331932 | 241 |
| 413 | 3300026075 | Ga0207708_10032862 | Ga0207708_100328624 | 241 |
| 414 | 3300026078 | Ga0207702_10001392 | Ga0207702_1000139221 | 241 |
| 415 | 3300026088 | Ga0207641_10003999 | Ga0207641_1000399910 | 241 |
| 416 | 3300026089 | Ga0207648_10023478 | Ga0207648_100234787 | 241 |
| 417 | 3300026095 | Ga0207676_10001771 | Ga0207676_1000177111 | 241 |
| 418 | 3300026116 | Ga0207674_10045014 | Ga0207674_100450146 | 241 |
| 419 | 3300026118 | Ga0207675_100009624 | Ga0207675_1000096248 | 241 |
| 420 | 3300026118 | Ga0207675_100065976 | Ga0207675_1000659764 | 241 |
| 421 | 3300026121 | Ga0207683_10156162 | Ga0207683_101561622 | 241 |
| 422 | 3300026121 | Ga0207683_10249688 | Ga0207683_102496882 | 241 |
| 423 | 3300026142 | Ga0207698_10329580 | Ga0207698_103295802 | 241 |
| 424 | 3300027312 | Ga0209371_1000038 | Ga0209371_100003895 | 241 |
| 425 | 3300027876 | Ga0209974_10022065 | Ga0209974_100220651 | 241 |
| 426 | 3300027907 | Ga0207428_10368226 | Ga0207428_103682262 | 241 |
| 427 | 3300028379 | Ga0268266_10002128 | Ga0268266_100021289 | 241 |
| 428 | 3300028379 | Ga0268266_10021170 | Ga0268266_100211702 | 241 |
| 429 | 3300028380 | Ga0268265_10003134 | Ga0268265_1000313413 | 241 |
| 430 | 3300028380 | Ga0268265_10007277 | Ga0268265_100072776 | 241 |
| 431 | 3300028380 | Ga0268265_10071349 | Ga0268265_100713493 | 241 |
| 432 | 3300028381 | Ga0268264_10266016 | Ga0268264_102660162 | 241 |
| 433 | 3300028577 | Ga0265318_10102895 | Ga0265318_101028952 | 241 |
| 434 | 3300030500 | Ga0268256_1000038 | Ga0268256_100003895 | 241 |
| 435 | 3300031242 | Ga0265329_10022329 | Ga0265329_100223293 | 241 |
| 436 | 3300031251 | Ga0265327_10102697 | Ga0265327_101026972 | 241 |
| 437 | 3300031344 | Ga0265316_10059388 | Ga0265316_100593883 | 241 |
| 438 | 3300032004 | Ga0307414_10196823 | Ga0307414_101968232 | 241 |
| 439 | 3300034819 | Ga0373958_0004705 | Ga0373958_0004705_619_1347 | 241 |
| 440 | 3300037312 | Ga0395899_0000108 | Ga0395899_0000108_21251_21979 | 241 |
| 441 | 3300037312 | Ga0395899_0011520 | Ga0395899_0011520_5908_6636 | 241 |
| 442 | 3300037418 | Ga0395900_0000755 | Ga0395900_0000755_17661_18389 | 241 |
| 443 | 3300037418 | Ga0395900_0167389 | Ga0395900_0167389_613_1338 | 241 |
| 444 | 3300037466 | Ga0395898_0000018 | Ga0395898_0000018_392631_393359 | 241 |
| 445 | 3300037466 | Ga0395898_0000049 | Ga0395898_0000049_248372_249100 | 241 |
| 446 | 3300038443 | Ga0395901_0014131 | Ga0395901_0014131_4782_5507 | 241 |
| 447 | 3300038443 | Ga0395901_0117270 | Ga0395901_0117270_1875_2600 | 241 |
| 448 | 3300038443 | Ga0395901_0149159 | Ga0395901_0149159_1691_2419 | 241 |
| 449 | 3300038443 | Ga0395901_0239271 | Ga0395901_0239271_501_1229 | 241 |
| 450 | 3300041411 | Ga0439466_0045527 | Ga0439466_0045527_30_755 | 241 |
| 451 | 3300042876 | Ga0451577_0117106 | Ga0451577_0117106_534_1259 | 241 |
| 452 | 3300042876 | Ga0451577_0665839 | Ga0451577_0665839_55_783 | 241 |
| 453 | 3300044656 | Ga0466969_0014958 | Ga0466969_0014958_1899_2627 | 241 |
| 454 | 3300044656 | Ga0466969_0015853 | Ga0466969_0015853_678_1406 | 241 |
| 455 | 3300044684 | Ga0466966_0019976 | Ga0466966_0019976_381_1109 | 241 |
| 456 | 3300044693 | Ga0466961_0000617 | Ga0466961_0000617_6431_7159 | 241 |
| 457 | 3300044693 | Ga0466961_0020355 | Ga0466961_0020355_2284_3012 | 241 |
| 458 | 3300044694 | Ga0466963_0081589 | Ga0466963_0081589_1334_2062 | 241 |
| 459 | 3300044706 | Ga0466964_0051920 | Ga0466964_0051920_61_789 | 241 |
| 460 | 3300044712 | Ga0453684_0256310 | Ga0453684_0256310_488_1213 | 241 |
| 461 | 3300044719 | Ga0466971_0098234 | Ga0466971_0098234_23_751 | 241 |
| 462 | 3300044842 | Ga0466957_0139197 | Ga0466957_0139197_258_986 | 241 |
| 463 | 3300044901 | Ga0466960_0080842 | Ga0466960_0080842_275_1003 | 241 |
| 464 | 3300045049 | Ga0466959_0000347 | Ga0466959_0000347_16365_17093 | 241 |
| 465 | 3300045049 | Ga0466959_0001870 | Ga0466959_0001870_3000_3728 | 241 |
| 466 | 3300045051 | Ga0451576_0034629 | Ga0451576_0034629_2713_3441 | 241 |
| 467 | 3300045051 | Ga0451576_0572900 | Ga0451576_0572900_182_907 | 241 |
| 468 | 3300045051 | Ga0451576_0587255 | Ga0451576_0587255_272_1003 | 241 |
| 469 | 3300045051 | Ga0451576_0957821 | Ga0451576_0957821_116_841 | 241 |
| 470 | 3300045836 | Ga0466958_0038431 | Ga0466958_0038431_502_1230 | 241 |
| 471 | 3300046492 | Ga0495585_0000772 | Ga0495585_0000772_9586_10314 | 241 |
| 472 | 3300046501 | Ga0495607_0000298 | Ga0495607_0000298_23348_24088 | 241 |
| 473 | 3300046507 | Ga0495606_0008626 | Ga0495606_0008626_2850_3578 | 241 |
| 474 | 3300046512 | Ga0495610_0001476 | Ga0495610_0001476_5980_6708 | 241 |
| 475 | 3300046513 | Ga0495616_0000036 | Ga0495616_0000036_54193_54921 | 241 |
| 476 | 3300046519 | Ga0495632_0074080 | Ga0495632_0074080_879_1604 | 241 |
| 477 | 3300046520 | Ga0495637_0001597 | Ga0495637_0001597_4273_5001 | 241 |
| 478 | 3300046522 | Ga0495643_0091541 | Ga0495643_0091541_121_846 | 241 |
| 479 | 3300046525 | Ga0495663_0000299 | Ga0495663_0000299_16126_16851 | 241 |
| 480 | 3300046525 | Ga0495663_0006649 | Ga0495663_0006649_1561_2286 | 241 |
| 481 | 3300046558 | Ga0495633_0001297 | Ga0495633_0001297_12500_13225 | 241 |
| 482 | 3300046664 | Ga0495659_0000054 | Ga0495659_0000054_31727_32452 | 241 |
| 483 | 3300046691 | Ga0495670_0010366 | Ga0495670_0010366_1738_2466 | 241 |
| 484 | 3300046692 | Ga0495671_0000314 | Ga0495671_0000314_16169_16894 | 241 |
| 485 | 3300046692 | Ga0495671_0001195 | Ga0495671_0001195_1989_2714 | 241 |
| 486 | 3300047318 | Ga0495636_0168335 | Ga0495636_0168335_211_942 | 241 |
| 487 | 3300047320 | Ga0495672_0028738 | Ga0495672_0028738_1790_2515 | 241 |
| 488 | 3300047323 | Ga0495683_0003818 | Ga0495683_0003818_1863_2591 | 241 |
| 489 | 3300047472 | Ga0495686_0000295 | Ga0495686_0000295_67006_67734 | 241 |
| 490 | 3300047472 | Ga0495686_0059195 | Ga0495686_0059195_277_1032 | 241 |
| 491 | 3300048903 | Ga0496100_0003016 | Ga0496100_0003016_2686_3414 | 241 |
| 492 | 3300048904 | Ga0496101_0002894 | Ga0496101_0002894_911_1639 | 241 |
| 493 | 3300048905 | Ga0496102_0038216 | Ga0496102_0038216_2630_3358 | 241 |
| 494 | 3300048909 | Ga0496106_0037602 | Ga0496106_0037602_2722_3450 | 241 |
| 495 | 3300048911 | Ga0496108_0198824 | Ga0496108_0198824_806_1534 | 241 |
| 496 | 3300048912 | Ga0496109_0020721 | Ga0496109_0020721_1215_1943 | 241 |
| 497 | 3300048912 | Ga0496109_0208907 | Ga0496109_0208907_410_1135 | 241 |
| 498 | 3300048913 | Ga0496110_0069311 | Ga0496110_0069311_1562_2290 | 241 |
| 499 | 3300048915 | Ga0496112_0046686 | Ga0496112_0046686_2657_3385 | 241 |
| 500 | 3300048924 | Ga0496121_0000372 | Ga0496121_0000372_54114_54842 | 241 |
| 501 | 3300048924 | Ga0496121_0005323 | Ga0496121_0005323_13614_14342 | 241 |
| 502 | 3300048925 | Ga0496122_0067755 | Ga0496122_0067755_23_751 | 241 |
| 503 | 3300048926 | Ga0496123_0008827 | Ga0496123_0008827_566_1294 | 241 |
| 504 | 3300048926 | Ga0496123_0043490 | Ga0496123_0043490_348_1076 | 241 |
| 505 | 3300050507 | nmdc:mga05p37_267918_c1 | nmdc:mga05p37_267918_c1_1253_1978 | 241 |
| 506 | 3300050507 | nmdc:mga05p37_404326_c1 | nmdc:mga05p37_404326_c1_358_1086 | 241 |
| 507 | 3300050509 | nmdc:mga0qj67_11460_c1 | nmdc:mga0qj67_11460_c1_3452_4180 | 241 |
| 508 | 3300050510 | nmdc:mga06r32_284767_c1 | nmdc:mga06r32_284767_c1_576_1304 | 241 |
| 509 | 3300050510 | nmdc:mga06r32_7200_c1 | nmdc:mga06r32_7200_c1_2345_3073 | 241 |
| 510 | 3300050511 | nmdc:mga08y16_152674_c1 | nmdc:mga08y16_152674_c1_483_1211 | 241 |
| 511 | 3300050511 | nmdc:mga08y16_37616_c1 | nmdc:mga08y16_37616_c1_719_1447 | 241 |
| 512 | 3300050511 | nmdc:mga08y16_620848_c1 | nmdc:mga08y16_620848_c1_297_1022 | 241 |
| 513 | 3300050512 | nmdc:mga0n895_135667_c1 | nmdc:mga0n895_135667_c1_1541_2269 | 241 |
| 514 | 3300050512 | nmdc:mga0n895_2762_c1 | nmdc:mga0n895_2762_c1_10688_11413 | 241 |
| 515 | 3300050515 | nmdc:mga0a205_179577_c1 | nmdc:mga0a205_179577_c1_204_929 | 241 |
| 516 | 3300050515 | nmdc:mga0a205_248209_c1 | nmdc:mga0a205_248209_c1_810_1535 | 241 |
| 517 | 3300050515 | nmdc:mga0a205_56645_c1 | nmdc:mga0a205_56645_c1_2726_3451 | 241 |
| 518 | 3300061719 | Ga0466962_0016392 | Ga0466962_0016392_450_1178 | 241 |
| 519 | iso_pu_bacteria | 2521172590 | 2521559630 | 241 |
| 520 | iso_pu_bacteria | 2548876994 | 2550696103 | 241 |
| 521 | iso_pu_bacteria | 2884811622 | 2884816676 | 241 |
| 522 | iso_pu_bacteria | 2884836552 | 2884840344 | 241 |
| 523 | iso_pu_bacteria | 2884852848 | 2884855600 | 241 |
| 524 | iso_pu_bacteria | 2896154374 | 2896157474 | 241 |
| 525 | iso_pu_bacteria | 2928130867 | 2928134054 | 241 |
| 526 | iso_pu_bacteria | 8054357960 | 8054358215 | 241 |
| 527 | 3300030735 | Ga0316178_1028084 | Ga0316178_10280842 | 242 |
| 528 | 3300030742 | Ga0316183_1175186 | Ga0316183_11751865 | 242 |
| 529 | 3300031251 | Ga0265327_10001649 | Ga0265327_1000164918 | 242 |
| 530 | 3300049570 | Ga0501033_0059786 | Ga0501033_0059786_541_1272 | 242 |
| 531 | 3300049822 | Ga0501035_0028900 | Ga0501035_0028900_2294_3025 | 242 |
| 532 | 3300049823 | Ga0501044_0000065 | Ga0501044_0000065_119470_120201 | 242 |
| 533 | 3300002738 | JGI25154J39366_1001369 | JGI25154J39366_10013694 | 243 |
| 534 | 3300002774 | JGI25150J39212_1008972 | JGI25150J39212_10089723 | 243 |
| 535 | 3300005563 | Ga0068855_100046672 | Ga0068855_1000466726 | 243 |
| 536 | 3300009036 | Ga0105244_10002091 | Ga0105244_100020916 | 243 |
| 537 | 3300021361 | Ga0213872_10004418 | Ga0213872_100044183 | 243 |
| 538 | 3300025728 | Ga0207655_1011371 | Ga0207655_10113712 | 243 |
| 539 | 3300028794 | Ga0307515_10072544 | Ga0307515_100725445 | 243 |
| 540 | 3300039447 | Ga0436361_0009597 | Ga0436361_0009597_19837_20571 | 243 |
| 541 | 3300039447 | Ga0436361_0809540 | Ga0436361_0809540_851_1594 | 243 |
| 542 | 3300046452 | Ga0495617_003902 | Ga0495617_003902_2549_3286 | 243 |
| 543 | 3300046457 | Ga0495590_0000003 | Ga0495590_0000003_397592_398329 | 243 |
| 544 | 3300046460 | Ga0495638_0000091 | Ga0495638_0000091_101779_102516 | 243 |
| 545 | 3300046460 | Ga0495638_0004653 | Ga0495638_0004653_2604_3341 | 243 |
| 546 | 3300046471 | Ga0495650_0000097 | Ga0495650_0000097_57871_58608 | 243 |
| 547 | 3300046471 | Ga0495650_0001058 | Ga0495650_0001058_7014_7751 | 243 |
| 548 | 3300046475 | Ga0495639_0010865 | Ga0495639_0010865_1886_2623 | 243 |
| 549 | 3300046491 | Ga0495584_0029967 | Ga0495584_0029967_1346_2083 | 243 |
| 550 | 3300046492 | Ga0495585_0008458 | Ga0495585_0008458_457_1194 | 243 |
| 551 | 3300046492 | Ga0495585_0174666 | Ga0495585_0174666_24_761 | 243 |
| 552 | 3300046501 | Ga0495607_0001875 | Ga0495607_0001875_12904_13641 | 243 |
| 553 | 3300046506 | Ga0495583_0000155 | Ga0495583_0000155_15056_15793 | 243 |
| 554 | 3300046506 | Ga0495583_0000197 | Ga0495583_0000197_57326_58063 | 243 |
| 555 | 3300046507 | Ga0495606_0000371 | Ga0495606_0000371_53904_54641 | 243 |
| 556 | 3300046507 | Ga0495606_0000461 | Ga0495606_0000461_58891_59628 | 243 |
| 557 | 3300046507 | Ga0495606_0002328 | Ga0495606_0002328_53_790 | 243 |
| 558 | 3300046507 | Ga0495606_0018254 | Ga0495606_0018254_853_1590 | 243 |
| 559 | 3300046507 | Ga0495606_0253326 | Ga0495606_0253326_186_923 | 243 |
| 560 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_94258_94995 | 243 |
| 561 | 3300046512 | Ga0495610_0004645 | Ga0495610_0004645_8562_9299 | 243 |
| 562 | 3300046512 | Ga0495610_0010298 | Ga0495610_0010298_2938_3675 | 243 |
| 563 | 3300046522 | Ga0495643_0000179 | Ga0495643_0000179_38254_38991 | 243 |
| 564 | 3300046522 | Ga0495643_0000287 | Ga0495643_0000287_58153_58890 | 243 |
| 565 | 3300046522 | Ga0495643_0069626 | Ga0495643_0069626_144_881 | 243 |
| 566 | 3300046523 | Ga0495644_0002342 | Ga0495644_0002342_5651_6388 | 243 |
| 567 | 3300046523 | Ga0495644_0034344 | Ga0495644_0034344_1107_1844 | 243 |
| 568 | 3300046524 | Ga0495648_0000058 | Ga0495648_0000058_90123_90860 | 243 |
| 569 | 3300046524 | Ga0495648_0012123 | Ga0495648_0012123_1166_1903 | 243 |
| 570 | 3300046524 | Ga0495648_0032542 | Ga0495648_0032542_2094_2831 | 243 |
| 571 | 3300046528 | Ga0495642_0000223 | Ga0495642_0000223_6315_7052 | 243 |
| 572 | 3300046538 | Ga0495609_0080768 | Ga0495609_0080768_72_809 | 243 |
| 573 | 3300046538 | Ga0495609_0084539 | Ga0495609_0084539_35_772 | 243 |
| 574 | 3300046542 | Ga0495597_0000209 | Ga0495597_0000209_37344_38081 | 243 |
| 575 | 3300046542 | Ga0495597_0000242 | Ga0495597_0000242_29954_30691 | 243 |
| 576 | 3300046557 | Ga0495622_0000468 | Ga0495622_0000468_10320_11057 | 243 |
| 577 | 3300046558 | Ga0495633_0000119 | Ga0495633_0000119_69032_69769 | 243 |
| 578 | 3300046558 | Ga0495633_0000249 | Ga0495633_0000249_19398_20135 | 243 |
| 579 | 3300046558 | Ga0495633_0002317 | Ga0495633_0002317_10036_10773 | 243 |
| 580 | 3300046558 | Ga0495633_0117770 | Ga0495633_0117770_53_790 | 243 |
| 581 | 3300046615 | Ga0495656_0052552 | Ga0495656_0052552_698_1435 | 243 |
| 582 | 3300046616 | Ga0495668_0000337 | Ga0495668_0000337_51955_52692 | 243 |
| 583 | 3300046648 | Ga0495611_0082418 | Ga0495611_0082418_370_1107 | 243 |
| 584 | 3300046660 | Ga0495625_0000132 | Ga0495625_0000132_43968_44705 | 243 |
| 585 | 3300046660 | Ga0495625_0000139 | Ga0495625_0000139_72386_73123 | 243 |
| 586 | 3300046660 | Ga0495625_0002623 | Ga0495625_0002623_17894_18631 | 243 |
| 587 | 3300046660 | Ga0495625_0003498 | Ga0495625_0003498_14683_15420 | 243 |
| 588 | 3300046664 | Ga0495659_0001118 | Ga0495659_0001118_699_1436 | 243 |
| 589 | 3300046665 | Ga0495661_0035739 | Ga0495661_0035739_1893_2630 | 243 |
| 590 | 3300046691 | Ga0495670_0062625 | Ga0495670_0062625_302_1039 | 243 |
| 591 | 3300046692 | Ga0495671_0000582 | Ga0495671_0000582_10565_11302 | 243 |
| 592 | 3300046692 | Ga0495671_0092095 | Ga0495671_0092095_327_1064 | 243 |
| 593 | 3300046810 | Ga0495660_0009308 | Ga0495660_0009308_3544_4281 | 243 |
| 594 | 3300047320 | Ga0495672_0000263 | Ga0495672_0000263_64649_65386 | 243 |
| 595 | 3300047323 | Ga0495683_0003113 | Ga0495683_0003113_1622_2359 | 243 |
| 596 | 3300047443 | Ga0495687_000296 | Ga0495687_000296_20628_21365 | 243 |
| 597 | 3300047443 | Ga0495687_001591 | Ga0495687_001591_4863_5600 | 243 |
| 598 | 3300047445 | Ga0495677_0112482 | Ga0495677_0112482_135_872 | 243 |
| 599 | 3300047446 | Ga0495679_031183 | Ga0495679_031183_697_1434 | 243 |
| 600 | 3300047447 | Ga0495685_000416 | Ga0495685_000416_8321_9058 | 243 |
| 601 | 3300048917 | Ga0496114_0000701 | Ga0496114_0000701_17243_17977 | 243 |
| 602 | 3300048929 | Ga0496126_0007665 | Ga0496126_0007665_7237_7974 | 243 |
| 603 | 3300049459 | Ga0495678_000283 | Ga0495678_000283_47641_48378 | 243 |
| 604 | 3300049459 | Ga0495678_000365 | Ga0495678_000365_28519_29256 | 243 |
| 605 | 3300049459 | Ga0495678_041790 | Ga0495678_041790_620_1357 | 243 |
| 606 | 3300049460 | Ga0495682_0000188 | Ga0495682_0000188_44971_45708 | 243 |
| 607 | 3300049571 | Ga0501034_0000321 | Ga0501034_0000321_23618_24352 | 243 |
| 608 | 3300049679 | Ga0501249_003568 | Ga0501249_003568_1784_2518 | 243 |
| 609 | 3300049766 | Ga0501269_000017 | Ga0501269_000017_49788_50525 | 243 |
| 610 | 3300053118 | Ga0500594_0035457 | Ga0500594_0035457_189_926 | 243 |
| 611 | 3300005339 | Ga0070660_100167128 | Ga0070660_1001671282 | 244 |
| 612 | 3300005366 | Ga0070659_100289505 | Ga0070659_1002895052 | 244 |
| 613 | 3300005563 | Ga0068855_100066169 | Ga0068855_1000661694 | 244 |
| 614 | 3300009174 | Ga0105241_10002206 | Ga0105241_1000220613 | 244 |
| 615 | 3300009176 | Ga0105242_10012557 | Ga0105242_100125574 | 244 |
| 616 | 3300013307 | Ga0157372_10255786 | Ga0157372_102557863 | 244 |
| 617 | 3300025911 | Ga0207654_10011436 | Ga0207654_100114364 | 244 |
| 618 | 3300025919 | Ga0207657_10007271 | Ga0207657_1000727110 | 244 |
| 619 | 3300025932 | Ga0207690_10488643 | Ga0207690_104886432 | 244 |
| 620 | 3300025934 | Ga0207686_10006292 | Ga0207686_100062925 | 244 |
| 621 | 3300025949 | Ga0207667_10015507 | Ga0207667_100155073 | 244 |
| 622 | 3300037312 | Ga0395899_0004137 | Ga0395899_0004137_7539_8273 | 244 |
| 623 | 3300037418 | Ga0395900_0013133 | Ga0395900_0013133_4033_4767 | 244 |
| 624 | 3300037418 | Ga0395900_0267722 | Ga0395900_0267722_399_1133 | 244 |
| 625 | 3300037466 | Ga0395898_0467517 | Ga0395898_0467517_121_855 | 244 |
| 626 | 3300037471 | Ga0395905_0119887 | Ga0395905_0119887_471_1205 | 244 |
| 627 | 3300038443 | Ga0395901_0106514 | Ga0395901_0106514_1446_2180 | 244 |
| 628 | 3300042005 | Ga0439448_0000301 | Ga0439448_0000301_792_1526 | 244 |
| 629 | 3300042008 | Ga0439450_007864 | Ga0439450_007864_218_952 | 244 |
| 630 | 3300042012 | Ga0439455_0007174 | Ga0439455_0007174_1148_1882 | 244 |
| 631 | 3300044656 | Ga0466969_0203000 | Ga0466969_0203000_11_745 | 244 |
| 632 | 3300044683 | Ga0466965_0015129 | Ga0466965_0015129_1116_1850 | 244 |
| 633 | 3300044684 | Ga0466966_0093765 | Ga0466966_0093765_715_1449 | 244 |
| 634 | 3300044719 | Ga0466971_0196298 | Ga0466971_0196298_135_869 | 244 |
| 635 | 3300044842 | Ga0466957_0001593 | Ga0466957_0001593_9517_10251 | 244 |
| 636 | 3300045049 | Ga0466959_0146293 | Ga0466959_0146293_402_1136 | 244 |
| 637 | 3300046452 | Ga0495617_006705 | Ga0495617_006705_2678_3412 | 244 |
| 638 | 3300046455 | Ga0495603_0136661 | Ga0495603_0136661_583_1317 | 244 |
| 639 | 3300046473 | Ga0495582_0000880 | Ga0495582_0000880_1505_2239 | 244 |
| 640 | 3300046473 | Ga0495582_0064202 | Ga0495582_0064202_490_1224 | 244 |
| 641 | 3300046491 | Ga0495584_0065432 | Ga0495584_0065432_307_1041 | 244 |
| 642 | 3300046491 | Ga0495584_0072788 | Ga0495584_0072788_540_1280 | 244 |
| 643 | 3300046492 | Ga0495585_0039317 | Ga0495585_0039317_811_1545 | 244 |
| 644 | 3300046499 | Ga0495594_0008636 | Ga0495594_0008636_1103_1837 | 244 |
| 645 | 3300046500 | Ga0495596_0001477 | Ga0495596_0001477_11193_11927 | 244 |
| 646 | 3300046501 | Ga0495607_0066327 | Ga0495607_0066327_1061_1795 | 244 |
| 647 | 3300046506 | Ga0495583_0002755 | Ga0495583_0002755_602_1342 | 244 |
| 648 | 3300046506 | Ga0495583_0202825 | Ga0495583_0202825_56_790 | 244 |
| 649 | 3300046513 | Ga0495616_0197999 | Ga0495616_0197999_120_854 | 244 |
| 650 | 3300046519 | Ga0495632_0001532 | Ga0495632_0001532_12762_13496 | 244 |
| 651 | 3300046523 | Ga0495644_0077710 | Ga0495644_0077710_491_1225 | 244 |
| 652 | 3300046528 | Ga0495642_0006585 | Ga0495642_0006585_1293_2027 | 244 |
| 653 | 3300046557 | Ga0495622_0037101 | Ga0495622_0037101_954_1688 | 244 |
| 654 | 3300046648 | Ga0495611_0023655 | Ga0495611_0023655_583_1317 | 244 |
| 655 | 3300046660 | Ga0495625_0002129 | Ga0495625_0002129_13662_14402 | 244 |
| 656 | 3300046664 | Ga0495659_0068463 | Ga0495659_0068463_425_1159 | 244 |
| 657 | 3300046665 | Ga0495661_0027405 | Ga0495661_0027405_14_748 | 244 |
| 658 | 3300046674 | Ga0495588_0000110 | Ga0495588_0000110_31448_32182 | 244 |
| 659 | 3300046674 | Ga0495588_0026084 | Ga0495588_0026084_733_1467 | 244 |
| 660 | 3300046684 | Ga0495669_0000041 | Ga0495669_0000041_30234_30968 | 244 |
| 661 | 3300046689 | Ga0495613_0109713 | Ga0495613_0109713_797_1531 | 244 |
| 662 | 3300046691 | Ga0495670_0028609 | Ga0495670_0028609_1298_2032 | 244 |
| 663 | 3300046691 | Ga0495670_0039030 | Ga0495670_0039030_458_1192 | 244 |
| 664 | 3300047315 | Ga0495581_0014620 | Ga0495581_0014620_1648_2382 | 244 |
| 665 | 3300047318 | Ga0495636_0071636 | Ga0495636_0071636_549_1283 | 244 |
| 666 | 3300047320 | Ga0495672_0016756 | Ga0495672_0016756_4080_4814 | 244 |
| 667 | 3300047323 | Ga0495683_0223067 | Ga0495683_0223067_52_786 | 244 |
| 668 | 3300047443 | Ga0495687_030413 | Ga0495687_030413_1144_1884 | 244 |
| 669 | 3300047445 | Ga0495677_0010069 | Ga0495677_0010069_124_864 | 244 |
| 670 | 3300047447 | Ga0495685_039173 | Ga0495685_039173_845_1585 | 244 |
| 671 | 3300047447 | Ga0495685_052210 | Ga0495685_052210_627_1361 | 244 |
| 672 | 3300047472 | Ga0495686_0001364 | Ga0495686_0001364_13636_14376 | 244 |
| 673 | 3300048091 | Ga0495626_0000711 | Ga0495626_0000711_9283_10026 | 244 |
| 674 | 3300048091 | Ga0495626_0074916 | Ga0495626_0074916_441_1175 | 244 |
| 675 | 3300048091 | Ga0495626_0109991 | Ga0495626_0109991_168_911 | 244 |
| 676 | 3300048905 | Ga0496102_0077507 | Ga0496102_0077507_594_1328 | 244 |
| 677 | 3300048909 | Ga0496106_0179271 | Ga0496106_0179271_815_1549 | 244 |
| 678 | 3300048916 | Ga0496113_0198113 | Ga0496113_0198113_351_1085 | 244 |
| 679 | 3300049822 | Ga0501035_0000652 | Ga0501035_0000652_33895_34629 | 244 |
| 680 | 3300049823 | Ga0501044_0071447 | Ga0501044_0071447_467_1201 | 244 |
| 681 | 3300061719 | Ga0466962_0107047 | Ga0466962_0107047_413_1147 | 244 |
| 682 | iso_pu_bacteria | 2511231003 | 2511249808 | 244 |
| 683 | 3300002704 | JGI25155J39150_1000301 | JGI25155J39150_10003012 | 245 |
| 684 | 3300002737 | JGI25162J39368_1011161 | JGI25162J39368_10111612 | 245 |
| 685 | 3300003323 | rootH1_10009899 | rootH1_1000989911 | 245 |
| 686 | 3300005563 | Ga0068855_100002195 | Ga0068855_1000021959 | 245 |
| 687 | 3300005563 | Ga0068855_100107181 | Ga0068855_1001071813 | 245 |
| 688 | 3300005577 | Ga0068857_100582795 | Ga0068857_1005827952 | 245 |
| 689 | 3300005616 | Ga0068852_100125934 | Ga0068852_1001259342 | 245 |
| 690 | 3300009093 | Ga0105240_10001226 | Ga0105240_1000122639 | 245 |
| 691 | 3300009093 | Ga0105240_10078269 | Ga0105240_100782695 | 245 |
| 692 | 3300009551 | Ga0105238_10030636 | Ga0105238_100306362 | 245 |
| 693 | 3300025913 | Ga0207695_10003589 | Ga0207695_1000358910 | 245 |
| 694 | 3300025924 | Ga0207694_10098659 | Ga0207694_100986593 | 245 |
| 695 | 3300025949 | Ga0207667_10000120 | Ga0207667_1000012098 | 245 |
| 696 | 3300025949 | Ga0207667_10007649 | Ga0207667_1000764912 | 245 |
| 697 | 3300026142 | Ga0207698_10095893 | Ga0207698_100958933 | 245 |
| 698 | 3300031665 | Ga0316575_10000758 | Ga0316575_100007585 | 245 |
| 699 | 3300046660 | Ga0495625_0001396 | Ga0495625_0001396_11611_12348 | 245 |
| 700 | 3300048919 | Ga0496116_0064539 | Ga0496116_0064539_981_1718 | 245 |
| 701 | 3300048921 | Ga0496118_0151056 | Ga0496118_0151056_117_866 | 245 |
| 702 | 3300048924 | Ga0496121_0061327 | Ga0496121_0061327_1122_1859 | 245 |
| 703 | 3300048925 | Ga0496122_0000887 | Ga0496122_0000887_19680_20417 | 245 |
| 704 | 3300048926 | Ga0496123_0000180 | Ga0496123_0000180_19857_20594 | 245 |
| 705 | 3300048928 | Ga0496125_0005042 | Ga0496125_0005042_791_1528 | 245 |
| 706 | 3300048928 | Ga0496125_0074638 | Ga0496125_0074638_1698_2435 | 245 |
| 707 | 3300046454 | Ga0495592_0202844 | Ga0495592_0202844_555_1322 | 246 |
| 708 | 3300046462 | Ga0495651_0018176 | Ga0495651_0018176_4165_4932 | 246 |
| 709 | 3300046516 | Ga0495628_0002796 | Ga0495628_0002796_802_1569 | 246 |
| 710 | 3300046529 | Ga0495652_0049372 | Ga0495652_0049372_2717_3484 | 246 |
| 711 | 3300046529 | Ga0495652_0184547 | Ga0495652_0184547_178_945 | 246 |
| 712 | 3300046543 | Ga0495645_0020795 | Ga0495645_0020795_865_1632 | 246 |
| 713 | 3300046679 | Ga0495623_0005943 | Ga0495623_0005943_3965_4732 | 246 |
| 714 | 3300046680 | Ga0495646_0000446 | Ga0495646_0000446_4798_5565 | 246 |
| 715 | 3300048088 | Ga0495602_0227554 | Ga0495602_0227554_239_1006 | 246 |
| 716 | 3300053077 | Ga0495601_0123067 | Ga0495601_0123067_755_1522 | 246 |
| 717 | 3300026089 | Ga0207648_10134412 | Ga0207648_101344123 | 247 |
| 718 | 3300002737 | JGI25162J39368_1000015 | JGI25162J39368_1000015260 | 249 |
| 719 | 3300002771 | JGI25163J39215_1001748 | JGI25163J39215_10017483 | 249 |
| 720 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001937 | 249 |
| 721 | 3300003751 | Ga0055538_1000001 | Ga0055538_100000197 | 249 |
| 722 | 3300003752 | Ga0055539_1000001 | Ga0055539_100000197 | 249 |
| 723 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003937 | 249 |
| 724 | 3300003759 | Ga0055525_1000087 | Ga0055525_100008748 | 249 |
| 725 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001937 | 249 |
| 726 | 3300015261 | Ga0182006_1004510 | Ga0182006_10045108 | 249 |
| 727 | 3300015265 | Ga0182005_1000227 | Ga0182005_100022734 | 249 |
| 728 | 3300025207 | Ga0209760_103071 | Ga0209760_1030712 | 249 |
| 729 | 3300025224 | Ga0209784_100004 | Ga0209784_100004931 | 249 |
| 730 | 3300025225 | Ga0209566_100004 | Ga0209566_1000041088 | 249 |
| 731 | 3300025226 | Ga0209674_100006 | Ga0209674_1000061088 | 249 |
| 732 | 3300025230 | Ga0209563_100009 | Ga0209563_100009931 | 249 |
| 733 | 3300025231 | Ga0207427_103252 | Ga0207427_1032521 | 249 |
| 734 | 3300025233 | Ga0209437_100004 | Ga0209437_100004931 | 249 |
| 735 | 3300025253 | Ga0209677_100005 | Ga0209677_100005931 | 249 |
| 736 | 3300025261 | Ga0209233_1000005 | Ga0209233_10000051088 | 249 |
| 737 | 3300025920 | Ga0207649_10114636 | Ga0207649_101146362 | 249 |
| 738 | 3300031507 | Ga0307509_10141183 | Ga0307509_101411833 | 249 |
| 739 | 3300035691 | Ga0373931_0004051 | Ga0373931_0004051_5724_6488 | 249 |
| 740 | 3300046454 | Ga0495592_0013806 | Ga0495592_0013806_1320_2096 | 249 |
| 741 | 3300046463 | Ga0495653_0004499 | Ga0495653_0004499_1088_1864 | 249 |
| 742 | 3300046511 | Ga0495608_0018979 | Ga0495608_0018979_2659_3435 | 249 |
| 743 | 3300046514 | Ga0495618_0011571 | Ga0495618_0011571_1660_2436 | 249 |
| 744 | 3300046516 | Ga0495628_0052698 | Ga0495628_0052698_1651_2427 | 249 |
| 745 | 3300046529 | Ga0495652_0038065 | Ga0495652_0038065_1476_2252 | 249 |
| 746 | 3300046543 | Ga0495645_0009101 | Ga0495645_0009101_5512_6288 | 249 |
| 747 | 3300046678 | Ga0495599_0000399 | Ga0495599_0000399_16520_17296 | 249 |
| 748 | 3300046690 | Ga0495624_0019179 | Ga0495624_0019179_644_1420 | 249 |
| 749 | 3300046809 | Ga0495600_0002038 | Ga0495600_0002038_8377_9153 | 249 |
| 750 | 3300047317 | Ga0495604_0002313 | Ga0495604_0002313_747_1523 | 249 |
| 751 | 3300048088 | Ga0495602_0040199 | Ga0495602_0040199_1498_2274 | 249 |
| 752 | 3300053077 | Ga0495601_0019691 | Ga0495601_0019691_1751_2527 | 249 |
| 753 | 3300053119 | Ga0500595_002138 | Ga0500595_002138_7102_7878 | 249 |
| 754 | 3300053154 | Ga0500619_010923 | Ga0500619_010923_940_1713 | 249 |
| 755 | iso_pu_bacteria | 2818991436 | 2819541020 | 249 |
| 756 | 3300031730 | Ga0307516_10003991 | Ga0307516_100039915 | 250 |
| 757 | 3300042115 | Ga0450911_008483 | Ga0450911_008483_55_846 | 250 |
| 758 | 3300046507 | Ga0495606_0000068 | Ga0495606_0000068_171168_171959 | 250 |
| 759 | 3300046648 | Ga0495611_0019241 | Ga0495611_0019241_404_1192 | 250 |
| 760 | 3300001979 | JGI24740J21852_10021400 | JGI24740J21852_100214003 | 251 |
| 761 | 3300005289 | Ga0065704_10000329 | Ga0065704_1000032925 | 251 |
| 762 | 3300025256 | Ga0209759_1019935 | Ga0209759_10199352 | 251 |
| 763 | 3300041410 | Ga0439461_0044219 | Ga0439461_0044219_151_954 | 251 |
| 764 | 3300053080 | Ga0500635_0000026 | Ga0500635_0000026_21736_22491 | 251 |
| 765 | iso_pu_bacteria | 2738543012 | 2739246111 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7caw-assembly1.cif.gz_D | crystal structure of bacterial reductase | 0.9631 | 12 | 250 |
| 6nrp-assembly1.cif.gz_C | putative short-chain dehydrogenase/reductase (sdr) from acinetobacter baumannii | 0.9625 | 12 | 250 |
| 7cax-assembly1.cif.gz_A | crystal structure of bacterial reductase | 0.9613 | 12 | 250 |
| 7caw-assembly1.cif.gz_A | crystal structure of bacterial reductase | 0.9612 | 12 | 250 |
| 7cax-assembly1.cif.gz_D | crystal structure of bacterial reductase | 0.9608 | 12 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ntnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9396 | 11 | 249 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9389 | 12 | 251 | 3.40.50.720 |
| 2c07A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9389 | 10 | 251 | 3.40.50.720 |
| 4iinB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9377 | 12 | 251 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9339 | 8 | 249 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1YKC1-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9412 | 10 | 251 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A0C2DEZ4-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.9407 | 11 | 251 |
GO:0016491
|
| AF-A0A496L296-F1-model_v4 | deleted | 0.9378 | 12 | 251 |
|
| AF-A0A2V7UW99-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9366 | 11 | 248 |
GO:0016491
|
| AF-A0A383B9X5-F1-model_v4 | Uncharacterized protein | 0.9361 | 12 | 130 |
GO:0016616
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar