F479682

General Info

Members Datasets Scaffolds Average Seq Length
763 406 1526 321

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10011385|Ga0157369_100113852
Length 374
Sequence MNLAVDHRGVDLVSVVLELEGSLRTESISIQSFFTQNAYQSLDSGKPDQSLVLRKMTNYNHWFIRARLKTRQLLLLVALAEEGNIHRAAQVLNMTQPAASKLLKDLEDVLEVPLFDRLPRGMRPTWYGETMIRHARVALASLNQAHDELTALKAGRFGQVSVGAITAPGLTLLPPAVAMVKREQPDLRVSLEIETSPVLIERLEQGKLDILVARLFAEHDKAQLRYEALSEEPVCALVRPGHPLLGVSGLTLRDVVSAGWIVPPAGSVLRHRFELMFQEEGLAPPTNTIESPALLFITRMLQQSDMVAVLATDVARYYASHGIVSLLPLNMPCHMDAFGIITRTDRLLSPAARVMMKALKTASLSVYGRKFEID

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
85 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
156 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
157 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
158 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
159 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
193 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
194 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
200 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
206 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
207 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
208 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
280 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
281 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
282 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
291 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
299 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
300 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
303 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
306 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
311 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
312 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
315 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
319 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
322 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
323 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
324 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
325 2547132374 Acidovorax radicis N35 Isolate Unclassified
326 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
327 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
328 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
329 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
330 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
331 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
332 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
333 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
334 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
335 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
336 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
337 2643221570 Acidovorax sp. Root568 Isolate Unclassified
338 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
339 2643221596 Acidovorax sp. Root70 Isolate Unclassified
340 2643221609 Acidovorax sp. Root217 Isolate Unclassified
341 2643221611 Acidovorax sp. Root219 Isolate Unclassified
342 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
343 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
344 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
345 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
346 2643221652 Acidovorax sp. Root402 Isolate Unclassified
347 2643221658 Variovorax sp. Root411 Isolate Unclassified
348 2643221672 Variovorax sp. Root434 Isolate Unclassified
349 2643221683 Variovorax sp. Root473 Isolate Unclassified
350 2643221717 Acidovorax sp. Root267 Isolate Unclassified
351 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
352 2738541277 Variovorax sp. GV051 Isolate Unclassified
353 2738541307 Variovorax sp. GV008 Isolate Unclassified
354 2738543012 Acidovorax sp. CF301 Isolate Unclassified
355 2738543013 Variovorax sp. BT01 Isolate Unclassified
356 2738543019 Variovorax sp. GV040 Isolate Unclassified
357 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
358 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
359 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
360 2816332133 Acidovorax radicis 2721A Isolate Unclassified
361 2818991446 Variovorax sp. 1180 Isolate Unclassified
362 2818991452 Burkholderia cepacia 561 Isolate Unclassified
363 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
364 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
365 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
366 2842677519 Variovorax sp. R-72495 Isolate Unclassified
367 2842747753 Variovorax sp. R-72060 Isolate Unclassified
368 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
369 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
370 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
371 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
372 2885198086 Variovorax sp. 679 Isolate Unclassified
373 2885211737 Variovorax sp. 553 Isolate Unclassified
374 2899924645 Variovorax sp. 369 Isolate Unclassified
375 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
376 2904456579 Variovorax sp. 2002 Isolate Unclassified
377 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
378 2904564687 Burkholderia sp. 571 Isolate Unclassified
379 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
380 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
381 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
382 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
383 2928037797 Variovorax sp. 1126 Isolate Unclassified
384 2928044640 Variovorax sp. 1128 Isolate Unclassified
385 2928051484 Variovorax sp. 1133 Isolate Unclassified
386 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
387 2928070936 Variovorax gossypii 1167 Isolate Unclassified
388 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
389 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
390 2928170801 Burkholderia sp. 572 Isolate Unclassified
391 2928536128 Burkholderia sola 565 Isolate Unclassified
392 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
393 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
394 2929520902 Variovorax beijingensis 502 Isolate Unclassified
395 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
396 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
397 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
398 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
399 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
400 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
401 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
402 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
403 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
404 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
405 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
406 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.6
Metatranscriptomes 0.13
Isolates 11.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.84
Nodule 1.05
Rhizoplane 4.59
Rhizosphere 37.61
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10011385 3300013105 Bacteria 10101
2 JGI24739J22299_10007043 3300001989 Bacteria 4231
3 JGI25156J39149_1000053 3300002705 Bacteria 88796
4 JGI25156J39149_1000229 3300002705 Bacteria 38688
5 JGI25154J39366_1000082 3300002738 Bacteria 88767
6 JGI25154J39366_1002197 3300002738 Bacteria 5407
7 JGI25158J39367_1002974 3300002739 Bacteria 2668
8 JGI25157J39369_1000072 3300002741 Bacteria 88796
9 JGI25157J39369_1000235 3300002741 Bacteria 42844
10 JGI25152J39213_1000942 3300002773 Bacteria 14276
11 JGI25152J39213_1005726 3300002773 Bacteria 3550
12 JGI25152J39213_1006030 3300002773 Bacteria 3391
13 JGI25150J39212_1002720 3300002774 Bacteria 4305
14 JGI25150J39212_1009423 3300002774 Bacteria 1860
15 JGI25159J45721_1006013 3300002987 Bacteria 3707
16 JGI25151J46595_10001345 3300003187 Bacteria 17082
17 JGI25151J46595_10002163 3300003187 Bacteria 12182
18 JGI25151J46595_10010819 3300003187 Bacteria 4222
19 JGI25151J46595_10014236 3300003187 Bacteria 3550
20 JGI25153J46596_10006053 3300003215 Bacteria 6214
21 JGI25153J46596_10012953 3300003215 Bacteria 3559
22 JGI25153J46596_10018814 3300003215 Bacteria 2667
23 rootH1_10121641 3300003316 Bacteria 2068
24 rootH1_10056142 3300003323 Bacteria 4544
25 rootH1_10081981 3300003323 Bacteria 2678
26 JGI25160J50197_1000188 3300003354 Bacteria 52036
27 JGI25160J50197_1000227 3300003354 Bacteria 44493
28 JGI25160J50197_1008812 3300003354 Bacteria 3805
29 JGI25160J50197_1009683 3300003354 Bacteria 3550
30 JGI25161J50226_1000007 3300003374 Bacteria 256181
31 JGI25161J50226_1002786 3300003374 Bacteria 4301
32 JGI25161J50226_1004513 3300003374 Bacteria 2902
33 Ga0006562J51391_1162216 3300003578 Bacteria 2930
34 Ga0055539_1001626 3300003752 Bacteria 4028
35 Ga0055539_1001703 3300003752 Bacteria 3881
36 Ga0055533_1000221 3300003756 Bacteria 40020
37 Ga0055532_1000429 3300003758 Bacteria 20037
38 Ga0055532_1000506 3300003758 Bacteria 17054
39 Ga0055532_1000674 3300003758 Bacteria 12913
40 Ga0055527_1000357 3300003760 Bacteria 21933
41 Ga0055535_1000069 3300003761 Bacteria 115207
42 Ga0055535_1000650 3300003761 Bacteria 27681
43 Ga0055535_1000815 3300003761 Bacteria 22469
44 Ga0055535_1010024 3300003761 Bacteria 1586
45 Ga0055542_1000084 3300003762 Bacteria 125518
46 Ga0055542_1000658 3300003762 Bacteria 28380
47 Ga0055542_1012327 3300003762 Bacteria 1481
48 Ga0055529_1000595 3300003763 Bacteria 28380
49 Ga0055529_1000813 3300003763 Bacteria 18807
50 Ga0055529_1003903 3300003763 Bacteria 2358
51 Ga0055526_1000475 3300003771 Bacteria 31936
52 Ga0055526_1008074 3300003771 Bacteria 5311
53 Ga0055526_1012676 3300003771 Bacteria 3648
54 Ga0055526_1013066 3300003771 Bacteria 3550
55 Ga0055537_1000096 3300003773 Bacteria 65970
56 Ga0055537_1000243 3300003773 Bacteria 39987
57 Ga0055537_1001145 3300003773 Bacteria 11365
58 Ga0055537_1002064 3300003773 Bacteria 7071
59 Ga0055537_1011235 3300003773 Bacteria 1832
60 Ga0055524_1000098 3300003775 Bacteria 108095
61 Ga0055524_1000158 3300003775 Bacteria 78973
62 Ga0055524_1001068 3300003775 Bacteria 16849
63 Ga0055524_1010661 3300003775 Bacteria 3644
64 Ga0055524_1011064 3300003775 Bacteria 3550
65 Ga0055536_1003691 3300003781 Bacteria 8129
66 Ga0055536_1005357 3300003781 Bacteria 6293
67 Ga0055534_1000212 3300003784 Bacteria 42993
68 Ga0055534_1000623 3300003784 Bacteria 18191
69 Ga0055534_1005205 3300003784 Bacteria 3550
70 Ga0055534_1007585 3300003784 Bacteria 2565
71 Ga0055528_1000104 3300003790 Bacteria 67913
72 Ga0055528_1000316 3300003790 Bacteria 40688
73 Ga0055528_1000751 3300003790 Bacteria 22613
74 Ga0055528_1006384 3300003790 Bacteria 5351
75 Ga0055528_1011332 3300003790 Bacteria 3550
76 Ga0055530_10000377 3300003791 Bacteria 40435
77 Ga0055530_10003146 3300003791 Bacteria 9724
78 Ga0055530_10005360 3300003791 Bacteria 6131
79 Ga0055530_10008089 3300003791 Bacteria 4281
80 Ga0055530_10031189 3300003791 Bacteria 1402
81 Ga0055540_1000004 3300003792 Bacteria 395545
82 Ga0055540_1000035 3300003792 Bacteria 166843
83 Ga0055540_1000176 3300003792 Bacteria 63046
84 Ga0055540_1000683 3300003792 Bacteria 23509
85 Ga0055540_1004901 3300003792 Bacteria 5843
86 Ga0055540_1007960 3300003792 Bacteria 3894
87 Ga0055540_1011214 3300003792 Bacteria 2910
88 Ga0055540_1029351 3300003792 Bacteria 1288
89 Ga0055531_10001036 3300003794 Bacteria 22011
90 Ga0055531_10007671 3300003794 Bacteria 5835
91 Ga0055531_10014003 3300003794 Bacteria 3649
92 Ga0055531_10019093 3300003794 Bacteria 2794
93 Ga0058692_1000017 3300003856 Bacteria 274459
94 Ga0058692_1000886 3300003856 Bacteria 11791
95 Ga0055543_1000386 3300004625 Bacteria 28622
96 Ga0055543_1007001 3300004625 Bacteria 2657
97 Ga0055543_1008331 3300004625 Bacteria 2302
98 Ga0065165_1000863 3300005262 Bacteria 39623
99 Ga0065165_1003346 3300005262 Bacteria 11403
100 Ga0065165_1004243 3300005262 Bacteria 9096
101 Ga0065165_1006536 3300005262 Bacteria 6078
102 Ga0065165_1007941 3300005262 Bacteria 5085
103 Ga0065165_1026045 3300005262 Bacteria 1931
104 Ga0070670_100157592 3300005331 Bacteria 1967
105 Ga0068869_100244453 3300005334 Bacteria 1431
106 Ga0070669_100053430 3300005353 Bacteria 2957
107 Ga0070673_100022588 3300005364 Bacteria 4582
108 Ga0070667_100008936 3300005367 Bacteria 8294
109 Ga0070678_100017199 3300005456 Bacteria 4649
110 Ga0070662_100008045 3300005457 Bacteria 6861
111 Ga0070662_100202341 3300005457 Bacteria 1576
112 Ga0070706_100026507 3300005467 Bacteria 5332
113 Ga0068853_100039865 3300005539 Bacteria 4007
114 Ga0068853_100166406 3300005539 Bacteria 1993
115 Ga0070665_100014912 3300005548 Bacteria 7802
116 Ga0070665_100322192 3300005548 Bacteria 1550
117 Ga0068855_100000557 3300005563 Bacteria 45786
118 Ga0068855_100045112 3300005563 Bacteria 5214
119 Ga0068855_100108953 3300005563 Bacteria 3181
120 Ga0070664_100083374 3300005564 Bacteria 2758
121 Ga0068857_100046048 3300005577 Bacteria 3870
122 Ga0068857_100066282 3300005577 Bacteria 3212
123 Ga0068854_100000701 3300005578 Bacteria 19827
124 Ga0068854_100003386 3300005578 Bacteria 9937
125 Ga0068854_100178852 3300005578 Bacteria 1656
126 Ga0068854_100203776 3300005578 Bacteria 1557
127 Ga0068856_100008119 3300005614 Bacteria 10244
128 Ga0068852_100046268 3300005616 Bacteria 3707
129 Ga0068851_10030818 3300005834 Bacteria 2662
130 Ga0068860_100243312 3300005843 Bacteria 1750
131 Ga0075365_10000840 3300006038 Bacteria 12730
132 Ga0075365_10026102 3300006038 Bacteria 3705
133 Ga0075368_10011743 3300006042 Bacteria 3192
134 Ga0075363_100001052 3300006048 Bacteria 9951
135 Ga0075364_10006825 3300006051 Bacteria 6736
136 Ga0075432_10003816 3300006058 Bacteria 5136
137 Ga0075362_10004613 3300006177 Bacteria 4965
138 Ga0075362_10011353 3300006177 Bacteria 3508
139 Ga0075362_10021799 3300006177 Bacteria 2694
140 Ga0075362_10025396 3300006177 Bacteria 2522
141 Ga0075362_10035368 3300006177 Bacteria 2180
142 Ga0075362_10077856 3300006177 Bacteria 1524
143 Ga0075367_10006409 3300006178 Bacteria 5943
144 Ga0075367_10010533 3300006178 Bacteria 4859
145 Ga0075367_10055628 3300006178 Bacteria 2349
146 Ga0075366_10001909 3300006195 Bacteria 10537
147 Ga0075366_10007941 3300006195 Bacteria 5872
148 Ga0075366_10022746 3300006195 Bacteria 3649
149 Ga0075366_10034275 3300006195 Bacteria 2989
150 Ga0075366_10048578 3300006195 Bacteria 2517
151 Ga0075366_10158584 3300006195 Bacteria 1371
152 Ga0075370_10002040 3300006353 Bacteria 9168
153 Ga0075370_10034927 3300006353 Bacteria 2820
154 Ga0075370_10077992 3300006353 Bacteria 1901
155 Ga0079104_1000024 3300006946 Bacteria 219543
156 Ga0099826_10000647 3300006948 Bacteria 17955
157 Ga0105244_10020876 3300009036 Bacteria 3630
158 Ga0105240_10007013 3300009093 Bacteria 16445
159 Ga0105240_10008933 3300009093 Bacteria 14247
160 Ga0105240_10010014 3300009093 Bacteria 13353
161 Ga0105245_10047398 3300009098 Bacteria 3842
162 Ga0105243_10012171 3300009148 Bacteria 6504
163 Ga0105243_10031763 3300009148 Bacteria 4073
164 Ga0105243_10131677 3300009148 Bacteria 2122
165 Ga0105241_10049033 3300009174 Bacteria 3215
166 Ga0105241_10358239 3300009174 Bacteria 1269
167 Ga0105242_10007052 3300009176 Bacteria 8680
168 Ga0105237_10001461 3300009545 Bacteria 31169
169 Ga0105237_10041702 3300009545 Bacteria 4628
170 Ga0105238_10008447 3300009551 Bacteria 10311
171 Ga0105239_10000798 3300010375 Bacteria 44685
172 Ga0105239_10121403 3300010375 Bacteria 2902
173 Ga0105239_10165000 3300010375 Bacteria 2476
174 Ga0105246_10153632 3300011119 Bacteria 1745
175 Ga0157347_1002903 3300012502 Bacteria 1502
176 Ga0157370_10123663 3300013104 Bacteria 2415
177 Ga0157369_10086457 3300013105 Bacteria 3349
178 Ga0157372_10286845 3300013307 Bacteria 1914
179 Ga0157375_10482525 3300013308 Bacteria 1404
180 Ga0182008_10010814 3300014497 Bacteria 4873
181 Ga0182008_10016325 3300014497 Bacteria 3859
182 Ga0182008_10035378 3300014497 Bacteria 2502
183 Ga0182008_10114428 3300014497 Bacteria 1338
184 Ga0157377_10000162 3300014745 Bacteria 40218
185 Ga0157376_10284962 3300014969 Bacteria 1557
186 Ga0182007_10002182 3300015262 Bacteria 9930
187 Ga0182007_10018964 3300015262 Bacteria 2482
188 Ga0182007_10076378 3300015262 Bacteria 1098
189 Ga0182005_1009900 3300015265 Bacteria 2756
190 Ga0183362_10003 3300015683 Bacteria 977584
191 Ga0183361_10007 3300016635 Bacteria 339575
192 Ga0163161_10000072 3300017792 Bacteria 102352
193 Ga0213872_10000204 3300021361 Bacteria 52638
194 Ga0213872_10037667 3300021361 Bacteria 2208
195 Ga0209435_100019 3300025206 Bacteria 260989
196 Ga0209436_101993 3300025208 Bacteria 6493
197 Ga0209436_105375 3300025208 Bacteria 2959
198 Ga0209566_100929 3300025225 Bacteria 13474
199 Ga0209674_100270 3300025226 Bacteria 39854
200 Ga0209674_101471 3300025226 Bacteria 6154
201 Ga0209672_100012 3300025228 Bacteria 795742
202 Ga0209672_100063 3300025228 Bacteria 204903
203 Ga0209672_101126 3300025228 Bacteria 11150
204 Ga0209147_100007 3300025229 Bacteria 795684
205 Ga0209147_100077 3300025229 Bacteria 205964
206 Ga0209147_100116 3300025229 Bacteria 143881
207 Ga0209147_101467 3300025229 Bacteria 8459
208 Ga0209563_100178 3300025230 Bacteria 41597
209 Ga0207427_100650 3300025231 Bacteria 16837
210 Ga0209258_100014 3300025242 Bacteria 720132
211 Ga0209258_100093 3300025242 Bacteria 223559
212 Ga0209258_100105 3300025242 Bacteria 207862
213 Ga0209258_100370 3300025242 Bacteria 59033
214 Ga0209258_100714 3300025242 Bacteria 22241
215 Ga0207425_1000904 3300025245 Bacteria 14295
216 Ga0207425_1003217 3300025245 Bacteria 5336
217 Ga0207425_1004431 3300025245 Bacteria 4214
218 Ga0209646_1000038 3300025246 Bacteria 353982
219 Ga0209646_1000157 3300025246 Bacteria 94054
220 Ga0209026_1000048 3300025250 Bacteria 257264
221 Ga0209026_1000328 3300025250 Bacteria 47719
222 Ga0209677_101668 3300025253 Bacteria 9325
223 Ga0209677_101743 3300025253 Bacteria 9049
224 Ga0209677_101779 3300025253 Bacteria 8903
225 Ga0209148_1000007 3300025254 Bacteria 1592273
226 Ga0209148_1000107 3300025254 Bacteria 207862
227 Ga0209148_1000277 3300025254 Bacteria 79813
228 Ga0209148_1006066 3300025254 Bacteria 2665
229 Ga0209759_1000038 3300025256 Bacteria 257264
230 Ga0209759_1000448 3300025256 Bacteria 47719
231 Ga0209759_1004057 3300025256 Bacteria 5604
232 Ga0209759_1005894 3300025256 Bacteria 4192
233 Ga0209759_1012386 3300025256 Bacteria 2366
234 Ga0209759_1012670 3300025256 Bacteria 2323
235 Ga0209129_1000038 3300025258 Bacteria 322778
236 Ga0209129_1000147 3300025258 Bacteria 115120
237 Ga0209129_1001795 3300025258 Bacteria 11407
238 Ga0209129_1002493 3300025258 Bacteria 8978
239 Ga0209129_1003595 3300025258 Bacteria 6632
240 Ga0209233_1002309 3300025261 Bacteria 7113
241 Ga0209565_1000021 3300025263 Bacteria 406281
242 Ga0209565_1000026 3300025263 Bacteria 365910
243 Ga0209565_1000117 3300025263 Bacteria 113536
244 Ga0209565_1000482 3300025263 Bacteria 29305
245 Ga0209565_1000534 3300025263 Bacteria 26749
246 Ga0209565_1002047 3300025263 Bacteria 7746
247 Ga0209565_1002308 3300025263 Bacteria 6987
248 Ga0209455_1000100 3300025272 Bacteria 207862
249 Ga0209455_1000590 3300025272 Bacteria 23490
250 Ga0209455_1000594 3300025272 Bacteria 23265
251 Ga0209673_1000009 3300025273 Bacteria 620735
252 Ga0209673_1000137 3300025273 Bacteria 158691
253 Ga0209673_1000218 3300025273 Bacteria 113542
254 Ga0209673_1000415 3300025273 Bacteria 74762
255 Ga0209673_1001234 3300025273 Bacteria 26811
256 Ga0209673_1004918 3300025273 Bacteria 6955
257 Ga0209673_1007869 3300025273 Bacteria 4824
258 Ga0209673_1013506 3300025273 Bacteria 3216
259 Ga0209130_1000289 3300025284 Bacteria 61485
260 Ga0209130_1000477 3300025284 Bacteria 41244
261 Ga0209130_1000916 3300025284 Bacteria 23720
262 Ga0209130_1001348 3300025284 Bacteria 16621
263 Ga0209130_1002132 3300025284 Bacteria 10500
264 Ga0209675_1000113 3300025291 Bacteria 113542
265 Ga0209675_1000379 3300025291 Bacteria 36995
266 Ga0209675_1000540 3300025291 Bacteria 27687
267 Ga0209675_1000559 3300025291 Bacteria 26945
268 Ga0209675_1001092 3300025291 Bacteria 16691
269 Ga0209675_1002524 3300025291 Bacteria 9333
270 Ga0209675_1013669 3300025291 Bacteria 2521
271 Ga0209676_1000013 3300025292 Bacteria 816080
272 Ga0209676_1000028 3300025292 Bacteria 559745
273 Ga0209676_1000216 3300025292 Bacteria 125759
274 Ga0209676_1002084 3300025292 Bacteria 15495
275 Ga0209676_1002944 3300025292 Bacteria 11117
276 Ga0209676_1004555 3300025292 Bacteria 7671
277 Ga0209676_1015854 3300025292 Bacteria 2752
278 Ga0209025_1000194 3300025294 Bacteria 148593
279 Ga0209025_1000375 3300025294 Bacteria 93043
280 Ga0209025_1000503 3300025294 Bacteria 75048
281 Ga0209025_1000728 3300025294 Bacteria 55852
282 Ga0209025_1000890 3300025294 Bacteria 46568
283 Ga0209025_1002918 3300025294 Bacteria 17042
284 Ga0209025_1003283 3300025294 Bacteria 15570
285 Ga0209025_1010170 3300025294 Bacteria 6418
286 Ga0209025_1044232 3300025294 Bacteria 1864
287 Ga0209564_1000129 3300025295 Bacteria 195163
288 Ga0209564_1000220 3300025295 Bacteria 129579
289 Ga0209564_1000327 3300025295 Bacteria 92740
290 Ga0209564_1000452 3300025295 Bacteria 69505
291 Ga0209564_1000579 3300025295 Bacteria 58010
292 Ga0209564_1000620 3300025295 Bacteria 54301
293 Ga0209564_1003725 3300025295 Bacteria 9987
294 Ga0209564_1015900 3300025295 Bacteria 3035
295 Ga0209758_1000177 3300025297 Bacteria 142824
296 Ga0209758_1000199 3300025297 Bacteria 133164
297 Ga0209758_1000600 3300025297 Bacteria 55923
298 Ga0209758_1010313 3300025297 Bacteria 5612
299 Ga0209758_1017476 3300025297 Bacteria 3569
300 Ga0209758_1024055 3300025297 Bacteria 2727
301 Ga0209758_1028680 3300025297 Bacteria 2347
302 Ga0209050_1000008 3300025298 Bacteria 1144179
303 Ga0209050_1000072 3300025298 Bacteria 293619
304 Ga0209050_1000133 3300025298 Bacteria 184688
305 Ga0209050_1001320 3300025298 Bacteria 27764
306 Ga0209050_1001869 3300025298 Bacteria 20247
307 Ga0209050_1005260 3300025298 Bacteria 8243
308 Ga0209050_1006508 3300025298 Bacteria 6887
309 Ga0209050_1017137 3300025298 Bacteria 2911
310 Ga0209050_1018842 3300025298 Bacteria 2657
311 Ga0209256_1000003 3300025299 Bacteria 1661127
312 Ga0209256_1000011 3300025299 Bacteria 865309
313 Ga0209256_1000117 3300025299 Bacteria 169435
314 Ga0209256_1000151 3300025299 Bacteria 145299
315 Ga0209256_1003336 3300025299 Bacteria 11391
316 Ga0209256_1015232 3300025299 Bacteria 2704
317 Ga0207426_1000049 3300025302 Bacteria 401954
318 Ga0207426_1000091 3300025302 Bacteria 280561
319 Ga0207426_1000166 3300025302 Bacteria 169435
320 Ga0207426_1007743 3300025302 Bacteria 4454
321 Ga0209051_1000005 3300025303 Bacteria 1142353
322 Ga0209051_1000015 3300025303 Bacteria 546798
323 Ga0209051_1000016 3300025303 Bacteria 541891
324 Ga0209051_1000056 3300025303 Bacteria 271616
325 Ga0209051_1000255 3300025303 Bacteria 89418
326 Ga0209051_1000370 3300025303 Bacteria 64642
327 Ga0209051_1001607 3300025303 Bacteria 18438
328 Ga0209051_1002201 3300025303 Bacteria 14399
329 Ga0209051_1002454 3300025303 Bacteria 13276
330 Ga0209051_1015174 3300025303 Bacteria 3556
331 Ga0209051_1019974 3300025303 Bacteria 2906
332 Ga0209257_1000037 3300025304 Bacteria 612915
333 Ga0209257_1000048 3300025304 Bacteria 455536
334 Ga0209257_1000095 3300025304 Bacteria 259437
335 Ga0209257_1000102 3300025304 Bacteria 251074
336 Ga0209257_1004198 3300025304 Bacteria 11424
337 Ga0209257_1006583 3300025304 Bacteria 7408
338 Ga0209257_1016654 3300025304 Bacteria 2957
339 Ga0207656_10019756 3300025321 Bacteria 2668
340 Ga0207655_1004027 3300025728 Bacteria 10604
341 Ga0207705_10053393 3300025909 Bacteria 2911
342 Ga0207654_10044386 3300025911 Bacteria 2524
343 Ga0207654_10199045 3300025911 Bacteria 1318
344 Ga0207695_10000527 3300025913 Bacteria 80644
345 Ga0207695_10007898 3300025913 Bacteria 13428
346 Ga0207695_10024312 3300025913 Bacteria 6819
347 Ga0207695_10029912 3300025913 Bacteria 6008
348 Ga0207695_10096745 3300025913 Bacteria 2954
349 Ga0207671_10001730 3300025914 Bacteria 24566
350 Ga0207657_10035279 3300025919 Bacteria 4486
351 Ga0207657_10369786 3300025919 Bacteria 1130
352 Ga0207646_10135490 3300025922 Bacteria 2217
353 Ga0207681_10013022 3300025923 Bacteria 5142
354 Ga0207681_10251338 3300025923 Bacteria 1380
355 Ga0207694_10050113 3300025924 Bacteria 3232
356 Ga0207687_10041458 3300025927 Bacteria 3161
357 Ga0207690_10015128 3300025932 Bacteria 4671
358 Ga0207706_10010455 3300025933 Bacteria 8478
359 Ga0207706_10045858 3300025933 Bacteria 3871
360 Ga0207709_10000208 3300025935 Bacteria 76530
361 Ga0207709_10000320 3300025935 Bacteria 52414
362 Ga0207709_10004923 3300025935 Bacteria 7644
363 Ga0207709_10023154 3300025935 Bacteria 3532
364 Ga0207667_10000062 3300025949 Bacteria 190422
365 Ga0207667_10030142 3300025949 Bacteria 5870
366 Ga0207667_10072465 3300025949 Bacteria 3581
367 Ga0207651_10008063 3300025960 Bacteria 5654
368 Ga0207640_10000022 3300025981 Bacteria 167526
369 Ga0207640_10001829 3300025981 Bacteria 11415
370 Ga0207640_10127458 3300025981 Bacteria 1834
371 Ga0207658_10182865 3300025986 Bacteria 1736
372 Ga0207658_10222756 3300025986 Bacteria 1588
373 Ga0207677_10100124 3300026023 Bacteria 2130
374 Ga0207639_10039751 3300026041 Bacteria 3507
375 Ga0207702_10006258 3300026078 Bacteria 10288
376 Ga0207648_10000267 3300026089 Bacteria 56681
377 Ga0207674_10056200 3300026116 Bacteria 3998
378 Ga0207674_10065678 3300026116 Bacteria 3656
379 Ga0207683_10021631 3300026121 Bacteria 5511
380 Ga0207683_10082862 3300026121 Bacteria 2850
381 Ga0207683_10281990 3300026121 Bacteria 1518
382 Ga0207698_10080606 3300026142 Bacteria 2623
383 Ga0207698_10216036 3300026142 Bacteria 1729
384 Ga0209281_1000104 3300027111 Bacteria 221056
385 Ga0209371_1000044 3300027312 Bacteria 327086
386 Ga0209371_1000113 3300027312 Bacteria 139649
387 Ga0209282_1000725 3300027666 Bacteria 16563
388 Ga0209813_10047421 3300027866 Bacteria 1331
389 Ga0209974_10003849 3300027876 Bacteria 5376
390 Ga0268264_10352020 3300028381 Bacteria 1402
391 Ga0265336_10000016 3300028666 Bacteria 238832
392 Ga0307515_10000109 3300028794 Bacteria 195895
393 Ga0307515_10000399 3300028794 Bacteria 105068
394 Ga0307515_10000722 3300028794 Bacteria 75999
395 Ga0307515_10005885 3300028794 Bacteria 24748
396 Ga0307515_10008040 3300028794 Bacteria 20665
397 Ga0307515_10010556 3300028794 Bacteria 17684
398 Ga0307515_10298755 3300028794 Bacteria 1298
399 Ga0265324_10000715 3300029957 Bacteria 22057
400 Ga0268256_1000046 3300030500 Bacteria 327003
401 Ga0268256_1000184 3300030500 Bacteria 74040
402 Ga0307511_10000445 3300030521 Bacteria 44375
403 Ga0307511_10091949 3300030521 Bacteria 2050
404 Ga0307511_10100764 3300030521 Bacteria 1898
405 Ga0307512_10014807 3300030522 Bacteria 7256
406 Ga0316177_1069991 3300030731 Bacteria 3971
407 Ga0316176_1079393 3300030732 Bacteria 1560
408 Ga0316179_1073240 3300030734 Bacteria 2267
409 Ga0316180_1101777 3300030736 Bacteria 3663
410 Ga0316183_1070234 3300030742 Bacteria 6252
411 Ga0316181_1024359 3300030744 Bacteria 2954
412 Ga0316182_1385109 3300030745 Bacteria 2024
413 Ga0265328_10056687 3300031239 Bacteria 1438
414 Ga0265327_10000327 3300031251 Bacteria 90721
415 Ga0265327_10034433 3300031251 Bacteria 2811
416 Ga0307513_10000256 3300031456 Bacteria 76296
417 Ga0307513_10000990 3300031456 Bacteria 41065
418 Ga0307513_10016752 3300031456 Bacteria 8818
419 Ga0307513_10020012 3300031456 Bacteria 7945
420 Ga0307513_10113649 3300031456 Bacteria 2695
421 Ga0307513_10337480 3300031456 Bacteria 1259
422 Ga0307509_10044218 3300031507 Bacteria 4814
423 Ga0307509_10159866 3300031507 Bacteria 2153
424 Ga0307408_100000754 3300031548 Bacteria 26065
425 Ga0307408_100040095 3300031548 Bacteria 3314
426 Ga0307408_100065813 3300031548 Bacteria 2659
427 Ga0307508_10001040 3300031616 Bacteria 32178
428 Ga0307514_10001900 3300031649 Bacteria 23013
429 Ga0307514_10002253 3300031649 Bacteria 20544
430 Ga0307514_10012705 3300031649 Bacteria 6998
431 Ga0307514_10030858 3300031649 Bacteria 4300
432 Ga0307516_10000262 3300031730 Bacteria 67427
433 Ga0307516_10000326 3300031730 Bacteria 61941
434 Ga0307516_10001328 3300031730 Bacteria 34313
435 Ga0307516_10007742 3300031730 Bacteria 12285
436 Ga0307516_10044959 3300031730 Bacteria 4365
437 Ga0307405_10002643 3300031731 Bacteria 7965
438 Ga0307405_10052728 3300031731 Bacteria 2530
439 Ga0307406_10000960 3300031901 Bacteria 16138
440 Ga0307406_10009507 3300031901 Bacteria 5456
441 Ga0307407_10025543 3300031903 Unclassified 3115
442 Ga0307412_10060369 3300031911 Bacteria 2544
443 Ga0307416_100022272 3300032002 Bacteria 4570
444 Ga0307416_100024847 3300032002 Bacteria 4381
445 Ga0307416_100284995 3300032002 Bacteria 1631
446 Ga0307411_10035231 3300032005 Bacteria 3123
447 Ga0307411_10101685 3300032005 Bacteria 2035
448 Ga0373934_0008002 3300035086 Bacteria 3934
449 Ga0395899_0116704 3300037312 Bacteria 1915
450 Ga0395898_0026223 3300037466 Bacteria 5867
451 Ga0395905_0008573 3300037471 Bacteria 10075
452 Ga0395905_0032656 3300037471 Bacteria 4895
453 Ga0395905_0197342 3300037471 Bacteria 1887
454 Ga0395905_0217110 3300037471 Bacteria 1790
455 Ga0395901_0001189 3300038443 Bacteria 27686
456 Ga0436361_0350058 3300039447 Bacteria 4835
457 Ga0436361_0356037 3300039447 Bacteria 1949
458 Ga0436361_0722191 3300039447 Bacteria 17181
459 Ga0439436_0008157 3300041404 Bacteria 3219
460 Ga0439461_0002794 3300041410 Bacteria 2821
461 Ga0439466_0013820 3300041411 Bacteria 2951
462 Ga0439465_0000738 3300041413 Bacteria 10126
463 Ga0439465_0008530 3300041413 Bacteria 3232
464 Ga0451789_0762496 3300041443 Bacteria 1483
465 Ga0451793_0783358 3300041452 Bacteria 1400
466 Ga0451793_1285781 3300041452 Bacteria 5125
467 Ga0451797_0213656 3300041453 Bacteria 1269
468 Ga0451797_1526663 3300041453 Bacteria 3414
469 Ga0451798_0127830 3300041458 Bacteria 2643
470 Ga0451800_0231280 3300041459 Bacteria 1881
471 Ga0451800_0519897 3300041459 Bacteria 1718
472 Ga0451800_0763839 3300041459 Bacteria 6447
473 Ga0451800_1022907 3300041459 Bacteria 1435
474 Ga0451802_2191706 3300041460 Bacteria 2113
475 Ga0451806_025862 3300041462 Bacteria 6474
476 Ga0451804_0357091 3300041463 Bacteria 2197
477 Ga0451807_1401611 3300041486 Bacteria 6384
478 Ga0451847_0891648 3300041503 Bacteria 1217
479 Ga0451853_0237679 3300041512 Bacteria 3137
480 Ga0439431_0002489 3300041997 Bacteria 4079
481 Ga0439433_0004457 3300041999 Bacteria 3018
482 Ga0439433_0037280 3300041999 Bacteria 1125
483 Ga0439442_001397 3300042002 Bacteria 4772
484 Ga0439442_009143 3300042002 Bacteria 2003
485 Ga0439445_0009709 3300042004 Bacteria 2269
486 Ga0439445_0035496 3300042004 Bacteria 1310
487 Ga0439432_007467 3300042006 Bacteria 3874
488 Ga0439432_010001 3300042006 Bacteria 3299
489 Ga0439449_0000136 3300042007 Bacteria 24746
490 Ga0439449_0007643 3300042007 Bacteria 4107
491 Ga0439449_0047719 3300042007 Bacteria 1586
492 Ga0439462_0004736 3300042015 Bacteria 3333
493 Ga0439462_0028764 3300042015 Bacteria 1469
494 Ga0450911_000152 3300042115 Bacteria 27922
495 Ga0450923_001103 3300042125 Bacteria 3412
496 Ga0450906_003231 3300042145 Bacteria 3518
497 Ga0450906_007782 3300042145 Bacteria 2102
498 Ga0450910_001480 3300042147 Bacteria 2968
499 Ga0439446_0055681 3300042156 Bacteria 1187
500 Ga0439434_0014765 3300042435 Bacteria 2324
501 Ga0450918_003383 3300042531 Bacteria 2967
502 Ga0451577_0000540 3300042876 Bacteria 62191
503 Ga0451577_0086391 3300042876 Bacteria 2798
504 Ga0466969_0000006 3300044656 Bacteria 152970
505 Ga0466969_0017949 3300044656 Bacteria 3690
506 Ga0466969_0041774 3300044656 Bacteria 2292
507 Ga0466969_0068496 3300044656 Bacteria 1709
508 Ga0466972_0001343 3300044658 Bacteria 11924
509 Ga0453683_0064853 3300044673 Bacteria 2283
510 Ga0466965_0024751 3300044683 Bacteria 2905
511 Ga0466965_0033042 3300044683 Bacteria 2527
512 Ga0466966_0001902 3300044684 Bacteria 13557
513 Ga0466961_0002561 3300044693 Bacteria 11265
514 Ga0466961_0012053 3300044693 Bacteria 5524
515 Ga0466961_0015752 3300044693 Bacteria 4851
516 Ga0466961_0020160 3300044693 Bacteria 4291
517 Ga0466963_0010495 3300044694 Bacteria 5608
518 Ga0466964_0025174 3300044706 Bacteria 2322
519 Ga0453684_0058170 3300044712 Bacteria 4995
520 Ga0453684_0217640 3300044712 Bacteria 2215
521 Ga0466968_0110227 3300044735 Bacteria 1237
522 Ga0466970_0007910 3300044765 Bacteria 5339
523 Ga0466957_0008245 3300044842 Bacteria 5920
524 Ga0466957_0041476 3300044842 Bacteria 2784
525 Ga0466960_0010487 3300044901 Bacteria 3850
526 Ga0466959_0001297 3300045049 Bacteria 15136
527 Ga0466959_0009080 3300045049 Bacteria 7056
528 Ga0466959_0052769 3300045049 Bacteria 2976
529 Ga0466959_0067068 3300045049 Bacteria 2602
530 Ga0451576_0038144 3300045051 Bacteria 5085
531 Ga0466958_0010228 3300045836 Bacteria 5248
532 Ga0466958_0030727 3300045836 Bacteria 3191
533 Ga0466958_0046062 3300045836 Bacteria 2631
534 Ga0466967_0070353 3300045976 Bacteria 3130
535 Ga0466967_0194886 3300045976 Bacteria 1916
536 Ga0495629_0125590 3300046459 Bacteria 1787
537 Ga0495638_0030787 3300046460 Bacteria 3451
538 Ga0495650_0015256 3300046471 Bacteria 3949
539 Ga0495650_0107966 3300046471 Bacteria 1037
540 Ga0495583_0000887 3300046506 Bacteria 35851
541 Ga0495606_0013623 3300046507 Bacteria 6411
542 Ga0495610_0010959 3300046512 Bacteria 5584
543 Ga0495610_0022178 3300046512 Bacteria 3478
544 Ga0495616_0021967 3300046513 Bacteria 3448
545 Ga0495631_0000269 3300046518 Bacteria 36247
546 Ga0495632_0002677 3300046519 Bacteria 13352
547 Ga0495637_0008985 3300046520 Bacteria 4885
548 Ga0495643_0120451 3300046522 Bacteria 1326
549 Ga0495642_0058377 3300046528 Bacteria 1597
550 Ga0495654_0014582 3300046530 Bacteria 4181
551 Ga0495621_0029871 3300046539 Bacteria 1860
552 Ga0495656_0000092 3300046615 Bacteria 38741
553 Ga0495625_0000329 3300046660 Bacteria 72358
554 Ga0495625_0008735 3300046660 Bacteria 8588
555 Ga0495625_0027131 3300046660 Bacteria 4318
556 Ga0495588_0022693 3300046674 Bacteria 3103
557 Ga0495588_0031258 3300046674 Bacteria 2679
558 Ga0495671_0004489 3300046692 Bacteria 8336
559 Ga0495649_0026249 3300046694 Bacteria 3241
560 Ga0495636_0067187 3300047318 Bacteria 1525
561 Ga0495676_0000908 3300047321 Bacteria 24784
562 Ga0495687_000018 3300047443 Bacteria 342973
563 Ga0495687_032153 3300047443 Bacteria 2399
564 Ga0495686_0018057 3300047472 Bacteria 4740
565 Ga0495686_0087005 3300047472 Bacteria 1901
566 Ga0495593_0011600 3300047673 Bacteria 5056
567 Ga0495614_0000940 3300048089 Bacteria 12402
568 Ga0496100_0079863 3300048903 Bacteria 2205
569 Ga0496101_0042258 3300048904 Bacteria 3253
570 Ga0496101_0102067 3300048904 Bacteria 2148
571 Ga0496102_0000896 3300048905 Bacteria 28249
572 Ga0496102_0004296 3300048905 Bacteria 12046
573 Ga0496102_0229038 3300048905 Bacteria 1752
574 Ga0496103_0029212 3300048906 Bacteria 3350
575 Ga0496103_0262120 3300048906 Bacteria 1112
576 Ga0496104_0063970 3300048907 Bacteria 3490
577 Ga0496105_0002227 3300048908 Bacteria 14047
578 Ga0496110_0054145 3300048913 Bacteria 3529
579 Ga0496110_0061588 3300048913 Bacteria 3312
580 Ga0496111_0346614 3300048914 Bacteria 1099
581 Ga0496114_0075664 3300048917 Bacteria 2836
582 Ga0496116_0015863 3300048919 Bacteria 5929
583 Ga0496116_0068353 3300048919 Bacteria 2264
584 Ga0496116_0077621 3300048919 Bacteria 2074
585 Ga0496117_0001420 3300048920 Bacteria 34726
586 Ga0496117_0042042 3300048920 Bacteria 3340
587 Ga0496117_0081993 3300048920 Bacteria 2114
588 Ga0496118_0007782 3300048921 Bacteria 11252
589 Ga0496118_0033946 3300048921 Bacteria 4174
590 Ga0496118_0083211 3300048921 Bacteria 2238
591 Ga0496119_0001696 3300048922 Bacteria 25735
592 Ga0496120_0001046 3300048923 Bacteria 36836
593 Ga0496121_0002493 3300048924 Bacteria 27989
594 Ga0496121_0122743 3300048924 Bacteria 1958
595 Ga0496122_0000383 3300048925 Bacteria 94797
596 Ga0496122_0001519 3300048925 Bacteria 36969
597 Ga0496122_0161101 3300048925 Bacteria 1368
598 Ga0496123_0000249 3300048926 Bacteria 108969
599 Ga0496123_0001314 3300048926 Bacteria 35172
600 Ga0496123_0086902 3300048926 Bacteria 1873
601 Ga0496124_0030511 3300048927 Bacteria 4784
602 Ga0496124_0031495 3300048927 Bacteria 4694
603 Ga0496124_0131233 3300048927 Bacteria 1990
604 Ga0496124_0190079 3300048927 Bacteria 1572
605 Ga0496125_0052208 3300048928 Bacteria 3363
606 Ga0496125_0072598 3300048928 Bacteria 2680
607 Ga0496125_0116532 3300048928 Bacteria 1918
608 Ga0496126_0007881 3300048929 Bacteria 11598
609 Ga0496126_0080563 3300048929 Bacteria 2881
610 Ga0496126_0256536 3300048929 Bacteria 1455
611 Ga0501043_0000108 3300049579 Bacteria 77329
612 Ga0501046_0000050 3300049580 Bacteria 134922
613 Ga0501047_0000012 3300049581 Bacteria 368824
614 Ga0501048_0000695 3300049582 Bacteria 24464
615 Ga0501206_002627 3300049653 Bacteria 2260
616 Ga0501262_000046 3300049759 Bacteria 15811
617 Ga0501266_001027 3300049763 Bacteria 3600
618 Ga0501269_007728 3300049766 Bacteria 1300
619 nmdc:mga03683_124840_c1 3300050489 Bacteria 1147
620 nmdc:mga03683_1416_c1 3300050489 Bacteria 7147
621 nmdc:mga03683_27920_c1 3300050489 Bacteria 2240
622 nmdc:mga03683_47770_c1 3300050489 Bacteria 1777
623 nmdc:mga03683_57164_c1 3300050489 Bacteria 1641
624 nmdc:mga03n38_15232_c1 3300050490 Bacteria 2965
625 nmdc:mga00v17_135363_c1 3300050491 Bacteria 1577
626 nmdc:mga00v17_27916_c1 3300050491 Bacteria 3300
627 nmdc:mga0yw44_3842_c1 3300050492 Bacteria 6751
628 nmdc:mga0k408_138684_c1 3300050493 Bacteria 1446
629 nmdc:mga0k408_20398_c1 3300050493 Bacteria 3712
630 nmdc:mga0k408_2702_c1 3300050493 Bacteria 7158
631 nmdc:mga0k408_33323_c1 3300050493 Bacteria 2946
632 nmdc:mga0k408_49077_c1 3300050493 Bacteria 2443
633 nmdc:mga0k408_52437_c1 3300050493 Bacteria 2364
634 nmdc:mga0k408_6702_c1 3300050493 Bacteria 6139
635 nmdc:mga06z11_15473_c1 3300050494 Bacteria 3406
636 nmdc:mga07m45_31557_c1 3300050496 Bacteria 2936
637 nmdc:mga07m45_39103_c1 3300050496 Bacteria 2650
638 nmdc:mga07m45_41749_c1 3300050496 Bacteria 2570
639 Ga0500610_0021151 3300053079 Bacteria 3187
640 Ga0500635_0000104 3300053080 Bacteria 50334
641 Ga0500578_0000622 3300053086 Bacteria 43056
642 Ga0500646_0007208 3300053090 Bacteria 2837
643 Ga0500583_0008227 3300053092 Bacteria 3728
644 Ga0500651_0000044 3300053093 Bacteria 86444
645 Ga0500651_0019870 3300053093 Bacteria 4179
646 Ga0500651_0166268 3300053093 Bacteria 1317
647 Ga0500650_0021440 3300053098 Bacteria 2846
648 Ga0500562_018421 3300053108 Bacteria 1803
649 Ga0500571_000021 3300053110 Bacteria 57203
650 Ga0500593_000247 3300053117 Bacteria 22153
651 Ga0500593_001518 3300053117 Bacteria 8343
652 Ga0500593_055702 3300053117 Bacteria 1747
653 Ga0500607_004925 3300053121 Bacteria 8916
654 Ga0500608_002712 3300053122 Bacteria 6506
655 Ga0500608_032230 3300053122 Bacteria 2489
656 Ga0500618_011856 3300053125 Bacteria 2301
657 Ga0500623_020393 3300053127 Bacteria 3436
658 Ga0500642_0017579 3300053130 Bacteria 2744
659 Ga0500652_000085 3300053131 Bacteria 39352
660 Ga0500655_000337 3300053133 Bacteria 10351
661 Ga0500658_0046887 3300053134 Bacteria 1752
662 Ga0500559_0042822 3300053136 Bacteria 1977
663 Ga0500568_0013917 3300053139 Bacteria 3651
664 Ga0500568_0016153 3300053139 Bacteria 3325
665 Ga0500574_042912 3300053141 Bacteria 1268
666 Ga0500577_0095269 3300053142 Bacteria 1209
667 Ga0500588_0017756 3300053146 Bacteria 1863
668 Ga0500616_0014247 3300053153 Bacteria 4576
669 Ga0500616_0099514 3300053153 Bacteria 1424
670 Ga0500619_000362 3300053154 Bacteria 8499
671 Ga0500638_032290 3300053162 Bacteria 2528
672 Ga0500636_0058722 3300053177 Bacteria 2248
673 Ga0500645_025151 3300053730 Bacteria 1817
674 Ga0500656_002820 3300053732 Bacteria 1595
675 Ga0500587_000338 3300053739 Bacteria 5292
676 Ga0466962_0003928 3300061719 Bacteria 7114
677 Ga0466962_0018283 3300061719 Bacteria 3371
678 2511246265 2511231002 Bacteria 5042903
679 2513228469 2513020051 Bacteria 6053213
680 2513953410 2513237150 Bacteria 6553639
681 2514044649 2513237165 Bacteria 6771773
682 2548498734 2547132374 Bacteria 5530232
683 2587729915 2585428057 Bacteria 6737412
684 2587733469 2585428058 Bacteria 6853932
685 2587759871 2585428062 Bacteria 6842168
686 2588294449 2588253510 Bacteria 6901809
687 2599620761 2599185214 Bacteria 8209958
688 2599674060 2599185226 Bacteria 8233575
689 2599678623 2599185227 Bacteria 8246414
690 2599690272 2599185229 Bacteria 8216126
691 2599736369 2599185239 Bacteria 8686614
692 2599746224 2599185240 Bacteria 7968121
693 2600207942 2599185355 Bacteria 7968906
694 2643865517 2643221570 Bacteria 5103772
695 2643968883 2643221592 Bacteria 6608788
696 2643992056 2643221596 Bacteria 5006805
697 2644063240 2643221609 Bacteria 6756331
698 2644071723 2643221611 Bacteria 6820941
699 2644139812 2643221625 Bacteria 6512927
700 2644161444 2643221628 Bacteria 5745828
701 2644245667 2643221644 Bacteria 6865017
702 2644273798 2643221648 Bacteria 6521465
703 2644296227 2643221652 Bacteria 5140275
704 2644324161 2643221658 Bacteria 6064537
705 2644400596 2643221672 Bacteria 6322190
706 2644465116 2643221683 Bacteria 5749203
707 2644649464 2643221717 Bacteria 5676132
708 2676743815 2675903129 Bacteria 7964495
709 2738720606 2738541277 Bacteria 7458140
710 2738884197 2738541307 Bacteria 8606193
711 2739246354 2738543012 Bacteria 7115078
712 2739250253 2738543013 Bacteria 5618633
713 2739279805 2738543019 Bacteria 7459457
714 2746091257 2744054900 Bacteria 8399525
715 2746097690 2744054901 Bacteria 8397047
716 2792833274 2791355137 Bacteria 9654227
717 2816475431 2816332133 Bacteria 7249298
718 2819601292 2818991446 Bacteria 7757362
719 2819634180 2818991452 Bacteria 8442785
720 2831269302 2831265667 Bacteria 7184833
721 2834645787 2834641062 Bacteria 5559922
722 2838055296 2838054893 Bacteria 7451788
723 2842679450 2842677519 Bacteria 5615038
724 2842749768 2842747753 Bacteria 5578255
725 2852689152 2852684882 Bacteria 5463342
726 2863423991 2863421361 Bacteria 7300805
727 2870074056 2870068957 Bacteria 8925310
728 2885197185 2885192300 Bacteria 5882526
729 2885201643 2885198086 Bacteria 7212419
730 2885215646 2885211737 Bacteria 7212420
731 2899927361 2899924645 Bacteria 7487985
732 2904450899 2904449895 Bacteria 6927402
733 2904459598 2904456579 Bacteria 6819253
734 2904549251 2904541872 Bacteria 8915136
735 2904570312 2904564687 Bacteria 7609577
736 2904577445 2904571731 Bacteria 7608790
737 2919130411 2919130084 Bacteria 5301837
738 2919462573 2919462493 Bacteria 5817112
739 2919707685 2919704043 Bacteria 5560311
740 2928042727 2928037797 Bacteria 7273642
741 2928048846 2928044640 Bacteria 7271509
742 2928055179 2928051484 Bacteria 7773759
743 2928068605 2928064002 Bacteria 7419480
744 2928073487 2928070936 Bacteria 8062541
745 2928089960 2928084124 Bacteria 7159212
746 2928118318 2928115317 Bacteria 6477646
747 2928171220 2928170801 Bacteria 8785406
748 2928536425 2928536128 Bacteria 7657547
749 2929161427 2929160207 Bacteria 9075316
750 2929198581 2929195423 Bacteria 5325372
751 2929521697 2929520902 Bacteria 6765052
752 2945914088 2945909444 Bacteria 7065066
753 2945949636 2945945610 Bacteria 5951079
754 2945990518 2945984333 Bacteria 7358892
755 2954770705 2954767861 Bacteria 5535784
756 2990712106 2990710928 Bacteria 5002431
757 644750283 644736347 Bacteria 6476522
758 8018849326 8018845410 Bacteria 8933938
759 8020938435 8020938398 Bacteria 7472757
760 8020949964 8020945358 Bacteria 8467355
761 8020957168 8020953355 Bacteria 7439080
762 8021123351 8021120328 Bacteria 8782274
763 8040171239 8040167225 Bacteria 6542727
764 Ga0157369_10011385
765 JGI24739J22299_10007043
766 JGI25156J39149_1000053
767 JGI25156J39149_1000229
768 JGI25154J39366_1000082
769 JGI25154J39366_1002197
770 JGI25158J39367_1002974
771 JGI25157J39369_1000072
772 JGI25157J39369_1000235
773 JGI25152J39213_1000942
774 JGI25152J39213_1005726
775 JGI25152J39213_1006030
776 JGI25150J39212_1002720
777 JGI25150J39212_1009423
778 JGI25159J45721_1006013
779 JGI25151J46595_10001345
780 JGI25151J46595_10002163
781 JGI25151J46595_10010819
782 JGI25151J46595_10014236
783 JGI25153J46596_10006053
784 JGI25153J46596_10012953
785 JGI25153J46596_10018814
786 rootH1_10121641
787 rootH1_10056142
788 rootH1_10081981
789 JGI25160J50197_1000188
790 JGI25160J50197_1000227
791 JGI25160J50197_1008812
792 JGI25160J50197_1009683
793 JGI25161J50226_1000007
794 JGI25161J50226_1002786
795 JGI25161J50226_1004513
796 Ga0006562J51391_1162216
797 Ga0055539_1001626
798 Ga0055539_1001703
799 Ga0055533_1000221
800 Ga0055532_1000429
801 Ga0055532_1000506
802 Ga0055532_1000674
803 Ga0055527_1000357
804 Ga0055535_1000069
805 Ga0055535_1000650
806 Ga0055535_1000815
807 Ga0055535_1010024
808 Ga0055542_1000084
809 Ga0055542_1000658
810 Ga0055542_1012327
811 Ga0055529_1000595
812 Ga0055529_1000813
813 Ga0055529_1003903
814 Ga0055526_1000475
815 Ga0055526_1008074
816 Ga0055526_1012676
817 Ga0055526_1013066
818 Ga0055537_1000096
819 Ga0055537_1000243
820 Ga0055537_1001145
821 Ga0055537_1002064
822 Ga0055537_1011235
823 Ga0055524_1000098
824 Ga0055524_1000158
825 Ga0055524_1001068
826 Ga0055524_1010661
827 Ga0055524_1011064
828 Ga0055536_1003691
829 Ga0055536_1005357
830 Ga0055534_1000212
831 Ga0055534_1000623
832 Ga0055534_1005205
833 Ga0055534_1007585
834 Ga0055528_1000104
835 Ga0055528_1000316
836 Ga0055528_1000751
837 Ga0055528_1006384
838 Ga0055528_1011332
839 Ga0055530_10000377
840 Ga0055530_10003146
841 Ga0055530_10005360
842 Ga0055530_10008089
843 Ga0055530_10031189
844 Ga0055540_1000004
845 Ga0055540_1000035
846 Ga0055540_1000176
847 Ga0055540_1000683
848 Ga0055540_1004901
849 Ga0055540_1007960
850 Ga0055540_1011214
851 Ga0055540_1029351
852 Ga0055531_10001036
853 Ga0055531_10007671
854 Ga0055531_10014003
855 Ga0055531_10019093
856 Ga0058692_1000017
857 Ga0058692_1000886
858 Ga0055543_1000386
859 Ga0055543_1007001
860 Ga0055543_1008331
861 Ga0065165_1000863
862 Ga0065165_1003346
863 Ga0065165_1004243
864 Ga0065165_1006536
865 Ga0065165_1007941
866 Ga0065165_1026045
867 Ga0070670_100157592
868 Ga0068869_100244453
869 Ga0070669_100053430
870 Ga0070673_100022588
871 Ga0070667_100008936
872 Ga0070678_100017199
873 Ga0070662_100008045
874 Ga0070662_100202341
875 Ga0070706_100026507
876 Ga0068853_100039865
877 Ga0068853_100166406
878 Ga0070665_100014912
879 Ga0070665_100322192
880 Ga0068855_100000557
881 Ga0068855_100045112
882 Ga0068855_100108953
883 Ga0070664_100083374
884 Ga0068857_100046048
885 Ga0068857_100066282
886 Ga0068854_100000701
887 Ga0068854_100003386
888 Ga0068854_100178852
889 Ga0068854_100203776
890 Ga0068856_100008119
891 Ga0068852_100046268
892 Ga0068851_10030818
893 Ga0068860_100243312
894 Ga0075365_10000840
895 Ga0075365_10026102
896 Ga0075368_10011743
897 Ga0075363_100001052
898 Ga0075364_10006825
899 Ga0075432_10003816
900 Ga0075362_10004613
901 Ga0075362_10011353
902 Ga0075362_10021799
903 Ga0075362_10025396
904 Ga0075362_10035368
905 Ga0075362_10077856
906 Ga0075367_10006409
907 Ga0075367_10010533
908 Ga0075367_10055628
909 Ga0075366_10001909
910 Ga0075366_10007941
911 Ga0075366_10022746
912 Ga0075366_10034275
913 Ga0075366_10048578
914 Ga0075366_10158584
915 Ga0075370_10002040
916 Ga0075370_10034927
917 Ga0075370_10077992
918 Ga0079104_1000024
919 Ga0099826_10000647
920 Ga0105244_10020876
921 Ga0105240_10007013
922 Ga0105240_10008933
923 Ga0105240_10010014
924 Ga0105245_10047398
925 Ga0105243_10012171
926 Ga0105243_10031763
927 Ga0105243_10131677
928 Ga0105241_10049033
929 Ga0105241_10358239
930 Ga0105242_10007052
931 Ga0105237_10001461
932 Ga0105237_10041702
933 Ga0105238_10008447
934 Ga0105239_10000798
935 Ga0105239_10121403
936 Ga0105239_10165000
937 Ga0105246_10153632
938 Ga0157347_1002903
939 Ga0157370_10123663
940 Ga0157369_10086457
941 Ga0157372_10286845
942 Ga0157375_10482525
943 Ga0182008_10010814
944 Ga0182008_10016325
945 Ga0182008_10035378
946 Ga0182008_10114428
947 Ga0157377_10000162
948 Ga0157376_10284962
949 Ga0182007_10002182
950 Ga0182007_10018964
951 Ga0182007_10076378
952 Ga0182005_1009900
953 Ga0183362_10003
954 Ga0183361_10007
955 Ga0163161_10000072
956 Ga0213872_10000204
957 Ga0213872_10037667
958 Ga0209435_100019
959 Ga0209436_101993
960 Ga0209436_105375
961 Ga0209566_100929
962 Ga0209674_100270
963 Ga0209674_101471
964 Ga0209672_100012
965 Ga0209672_100063
966 Ga0209672_101126
967 Ga0209147_100007
968 Ga0209147_100077
969 Ga0209147_100116
970 Ga0209147_101467
971 Ga0209563_100178
972 Ga0207427_100650
973 Ga0209258_100014
974 Ga0209258_100093
975 Ga0209258_100105
976 Ga0209258_100370
977 Ga0209258_100714
978 Ga0207425_1000904
979 Ga0207425_1003217
980 Ga0207425_1004431
981 Ga0209646_1000038
982 Ga0209646_1000157
983 Ga0209026_1000048
984 Ga0209026_1000328
985 Ga0209677_101668
986 Ga0209677_101743
987 Ga0209677_101779
988 Ga0209148_1000007
989 Ga0209148_1000107
990 Ga0209148_1000277
991 Ga0209148_1006066
992 Ga0209759_1000038
993 Ga0209759_1000448
994 Ga0209759_1004057
995 Ga0209759_1005894
996 Ga0209759_1012386
997 Ga0209759_1012670
998 Ga0209129_1000038
999 Ga0209129_1000147
1000 Ga0209129_1001795
1001 Ga0209129_1002493
1002 Ga0209129_1003595
1003 Ga0209233_1002309
1004 Ga0209565_1000021
1005 Ga0209565_1000026
1006 Ga0209565_1000117
1007 Ga0209565_1000482
1008 Ga0209565_1000534
1009 Ga0209565_1002047
1010 Ga0209565_1002308
1011 Ga0209455_1000100
1012 Ga0209455_1000590
1013 Ga0209455_1000594
1014 Ga0209673_1000009
1015 Ga0209673_1000137
1016 Ga0209673_1000218
1017 Ga0209673_1000415
1018 Ga0209673_1001234
1019 Ga0209673_1004918
1020 Ga0209673_1007869
1021 Ga0209673_1013506
1022 Ga0209130_1000289
1023 Ga0209130_1000477
1024 Ga0209130_1000916
1025 Ga0209130_1001348
1026 Ga0209130_1002132
1027 Ga0209675_1000113
1028 Ga0209675_1000379
1029 Ga0209675_1000540
1030 Ga0209675_1000559
1031 Ga0209675_1001092
1032 Ga0209675_1002524
1033 Ga0209675_1013669
1034 Ga0209676_1000013
1035 Ga0209676_1000028
1036 Ga0209676_1000216
1037 Ga0209676_1002084
1038 Ga0209676_1002944
1039 Ga0209676_1004555
1040 Ga0209676_1015854
1041 Ga0209025_1000194
1042 Ga0209025_1000375
1043 Ga0209025_1000503
1044 Ga0209025_1000728
1045 Ga0209025_1000890
1046 Ga0209025_1002918
1047 Ga0209025_1003283
1048 Ga0209025_1010170
1049 Ga0209025_1044232
1050 Ga0209564_1000129
1051 Ga0209564_1000220
1052 Ga0209564_1000327
1053 Ga0209564_1000452
1054 Ga0209564_1000579
1055 Ga0209564_1000620
1056 Ga0209564_1003725
1057 Ga0209564_1015900
1058 Ga0209758_1000177
1059 Ga0209758_1000199
1060 Ga0209758_1000600
1061 Ga0209758_1010313
1062 Ga0209758_1017476
1063 Ga0209758_1024055
1064 Ga0209758_1028680
1065 Ga0209050_1000008
1066 Ga0209050_1000072
1067 Ga0209050_1000133
1068 Ga0209050_1001320
1069 Ga0209050_1001869
1070 Ga0209050_1005260
1071 Ga0209050_1006508
1072 Ga0209050_1017137
1073 Ga0209050_1018842
1074 Ga0209256_1000003
1075 Ga0209256_1000011
1076 Ga0209256_1000117
1077 Ga0209256_1000151
1078 Ga0209256_1003336
1079 Ga0209256_1015232
1080 Ga0207426_1000049
1081 Ga0207426_1000091
1082 Ga0207426_1000166
1083 Ga0207426_1007743
1084 Ga0209051_1000005
1085 Ga0209051_1000015
1086 Ga0209051_1000016
1087 Ga0209051_1000056
1088 Ga0209051_1000255
1089 Ga0209051_1000370
1090 Ga0209051_1001607
1091 Ga0209051_1002201
1092 Ga0209051_1002454
1093 Ga0209051_1015174
1094 Ga0209051_1019974
1095 Ga0209257_1000037
1096 Ga0209257_1000048
1097 Ga0209257_1000095
1098 Ga0209257_1000102
1099 Ga0209257_1004198
1100 Ga0209257_1006583
1101 Ga0209257_1016654
1102 Ga0207656_10019756
1103 Ga0207655_1004027
1104 Ga0207705_10053393
1105 Ga0207654_10044386
1106 Ga0207654_10199045
1107 Ga0207695_10000527
1108 Ga0207695_10007898
1109 Ga0207695_10024312
1110 Ga0207695_10029912
1111 Ga0207695_10096745
1112 Ga0207671_10001730
1113 Ga0207657_10035279
1114 Ga0207657_10369786
1115 Ga0207646_10135490
1116 Ga0207681_10013022
1117 Ga0207681_10251338
1118 Ga0207694_10050113
1119 Ga0207687_10041458
1120 Ga0207690_10015128
1121 Ga0207706_10010455
1122 Ga0207706_10045858
1123 Ga0207709_10000208
1124 Ga0207709_10000320
1125 Ga0207709_10004923
1126 Ga0207709_10023154
1127 Ga0207667_10000062
1128 Ga0207667_10030142
1129 Ga0207667_10072465
1130 Ga0207651_10008063
1131 Ga0207640_10000022
1132 Ga0207640_10001829
1133 Ga0207640_10127458
1134 Ga0207658_10182865
1135 Ga0207658_10222756
1136 Ga0207677_10100124
1137 Ga0207639_10039751
1138 Ga0207702_10006258
1139 Ga0207648_10000267
1140 Ga0207674_10056200
1141 Ga0207674_10065678
1142 Ga0207683_10021631
1143 Ga0207683_10082862
1144 Ga0207683_10281990
1145 Ga0207698_10080606
1146 Ga0207698_10216036
1147 Ga0209281_1000104
1148 Ga0209371_1000044
1149 Ga0209371_1000113
1150 Ga0209282_1000725
1151 Ga0209813_10047421
1152 Ga0209974_10003849
1153 Ga0268264_10352020
1154 Ga0265336_10000016
1155 Ga0307515_10000109
1156 Ga0307515_10000399
1157 Ga0307515_10000722
1158 Ga0307515_10005885
1159 Ga0307515_10008040
1160 Ga0307515_10010556
1161 Ga0307515_10298755
1162 Ga0265324_10000715
1163 Ga0268256_1000046
1164 Ga0268256_1000184
1165 Ga0307511_10000445
1166 Ga0307511_10091949
1167 Ga0307511_10100764
1168 Ga0307512_10014807
1169 Ga0316177_1069991
1170 Ga0316176_1079393
1171 Ga0316179_1073240
1172 Ga0316180_1101777
1173 Ga0316183_1070234
1174 Ga0316181_1024359
1175 Ga0316182_1385109
1176 Ga0265328_10056687
1177 Ga0265327_10000327
1178 Ga0265327_10034433
1179 Ga0307513_10000256
1180 Ga0307513_10000990
1181 Ga0307513_10016752
1182 Ga0307513_10020012
1183 Ga0307513_10113649
1184 Ga0307513_10337480
1185 Ga0307509_10044218
1186 Ga0307509_10159866
1187 Ga0307408_100000754
1188 Ga0307408_100040095
1189 Ga0307408_100065813
1190 Ga0307508_10001040
1191 Ga0307514_10001900
1192 Ga0307514_10002253
1193 Ga0307514_10012705
1194 Ga0307514_10030858
1195 Ga0307516_10000262
1196 Ga0307516_10000326
1197 Ga0307516_10001328
1198 Ga0307516_10007742
1199 Ga0307516_10044959
1200 Ga0307405_10002643
1201 Ga0307405_10052728
1202 Ga0307406_10000960
1203 Ga0307406_10009507
1204 Ga0307407_10025543
1205 Ga0307412_10060369
1206 Ga0307416_100022272
1207 Ga0307416_100024847
1208 Ga0307416_100284995
1209 Ga0307411_10035231
1210 Ga0307411_10101685
1211 Ga0373934_0008002
1212 Ga0395899_0116704
1213 Ga0395898_0026223
1214 Ga0395905_0008573
1215 Ga0395905_0032656
1216 Ga0395905_0197342
1217 Ga0395905_0217110
1218 Ga0395901_0001189
1219 Ga0436361_0350058
1220 Ga0436361_0356037
1221 Ga0436361_0722191
1222 Ga0439436_0008157
1223 Ga0439461_0002794
1224 Ga0439466_0013820
1225 Ga0439465_0000738
1226 Ga0439465_0008530
1227 Ga0451789_0762496
1228 Ga0451793_0783358
1229 Ga0451793_1285781
1230 Ga0451797_0213656
1231 Ga0451797_1526663
1232 Ga0451798_0127830
1233 Ga0451800_0231280
1234 Ga0451800_0519897
1235 Ga0451800_0763839
1236 Ga0451800_1022907
1237 Ga0451802_2191706
1238 Ga0451806_025862
1239 Ga0451804_0357091
1240 Ga0451807_1401611
1241 Ga0451847_0891648
1242 Ga0451853_0237679
1243 Ga0439431_0002489
1244 Ga0439433_0004457
1245 Ga0439433_0037280
1246 Ga0439442_001397
1247 Ga0439442_009143
1248 Ga0439445_0009709
1249 Ga0439445_0035496
1250 Ga0439432_007467
1251 Ga0439432_010001
1252 Ga0439449_0000136
1253 Ga0439449_0007643
1254 Ga0439449_0047719
1255 Ga0439462_0004736
1256 Ga0439462_0028764
1257 Ga0450911_000152
1258 Ga0450923_001103
1259 Ga0450906_003231
1260 Ga0450906_007782
1261 Ga0450910_001480
1262 Ga0439446_0055681
1263 Ga0439434_0014765
1264 Ga0450918_003383
1265 Ga0451577_0000540
1266 Ga0451577_0086391
1267 Ga0466969_0000006
1268 Ga0466969_0017949
1269 Ga0466969_0041774
1270 Ga0466969_0068496
1271 Ga0466972_0001343
1272 Ga0453683_0064853
1273 Ga0466965_0024751
1274 Ga0466965_0033042
1275 Ga0466966_0001902
1276 Ga0466961_0002561
1277 Ga0466961_0012053
1278 Ga0466961_0015752
1279 Ga0466961_0020160
1280 Ga0466963_0010495
1281 Ga0466964_0025174
1282 Ga0453684_0058170
1283 Ga0453684_0217640
1284 Ga0466968_0110227
1285 Ga0466970_0007910
1286 Ga0466957_0008245
1287 Ga0466957_0041476
1288 Ga0466960_0010487
1289 Ga0466959_0001297
1290 Ga0466959_0009080
1291 Ga0466959_0052769
1292 Ga0466959_0067068
1293 Ga0451576_0038144
1294 Ga0466958_0010228
1295 Ga0466958_0030727
1296 Ga0466958_0046062
1297 Ga0466967_0070353
1298 Ga0466967_0194886
1299 Ga0495629_0125590
1300 Ga0495638_0030787
1301 Ga0495650_0015256
1302 Ga0495650_0107966
1303 Ga0495583_0000887
1304 Ga0495606_0013623
1305 Ga0495610_0010959
1306 Ga0495610_0022178
1307 Ga0495616_0021967
1308 Ga0495631_0000269
1309 Ga0495632_0002677
1310 Ga0495637_0008985
1311 Ga0495643_0120451
1312 Ga0495642_0058377
1313 Ga0495654_0014582
1314 Ga0495621_0029871
1315 Ga0495656_0000092
1316 Ga0495625_0000329
1317 Ga0495625_0008735
1318 Ga0495625_0027131
1319 Ga0495588_0022693
1320 Ga0495588_0031258
1321 Ga0495671_0004489
1322 Ga0495649_0026249
1323 Ga0495636_0067187
1324 Ga0495676_0000908
1325 Ga0495687_000018
1326 Ga0495687_032153
1327 Ga0495686_0018057
1328 Ga0495686_0087005
1329 Ga0495593_0011600
1330 Ga0495614_0000940
1331 Ga0496100_0079863
1332 Ga0496101_0042258
1333 Ga0496101_0102067
1334 Ga0496102_0000896
1335 Ga0496102_0004296
1336 Ga0496102_0229038
1337 Ga0496103_0029212
1338 Ga0496103_0262120
1339 Ga0496104_0063970
1340 Ga0496105_0002227
1341 Ga0496110_0054145
1342 Ga0496110_0061588
1343 Ga0496111_0346614
1344 Ga0496114_0075664
1345 Ga0496116_0015863
1346 Ga0496116_0068353
1347 Ga0496116_0077621
1348 Ga0496117_0001420
1349 Ga0496117_0042042
1350 Ga0496117_0081993
1351 Ga0496118_0007782
1352 Ga0496118_0033946
1353 Ga0496118_0083211
1354 Ga0496119_0001696
1355 Ga0496120_0001046
1356 Ga0496121_0002493
1357 Ga0496121_0122743
1358 Ga0496122_0000383
1359 Ga0496122_0001519
1360 Ga0496122_0161101
1361 Ga0496123_0000249
1362 Ga0496123_0001314
1363 Ga0496123_0086902
1364 Ga0496124_0030511
1365 Ga0496124_0031495
1366 Ga0496124_0131233
1367 Ga0496124_0190079
1368 Ga0496125_0052208
1369 Ga0496125_0072598
1370 Ga0496125_0116532
1371 Ga0496126_0007881
1372 Ga0496126_0080563
1373 Ga0496126_0256536
1374 Ga0501043_0000108
1375 Ga0501046_0000050
1376 Ga0501047_0000012
1377 Ga0501048_0000695
1378 Ga0501206_002627
1379 Ga0501262_000046
1380 Ga0501266_001027
1381 Ga0501269_007728
1382 nmdc:mga03683_124840_c1
1383 nmdc:mga03683_1416_c1
1384 nmdc:mga03683_27920_c1
1385 nmdc:mga03683_47770_c1
1386 nmdc:mga03683_57164_c1
1387 nmdc:mga03n38_15232_c1
1388 nmdc:mga00v17_135363_c1
1389 nmdc:mga00v17_27916_c1
1390 nmdc:mga0yw44_3842_c1
1391 nmdc:mga0k408_138684_c1
1392 nmdc:mga0k408_20398_c1
1393 nmdc:mga0k408_2702_c1
1394 nmdc:mga0k408_33323_c1
1395 nmdc:mga0k408_49077_c1
1396 nmdc:mga0k408_52437_c1
1397 nmdc:mga0k408_6702_c1
1398 nmdc:mga06z11_15473_c1
1399 nmdc:mga07m45_31557_c1
1400 nmdc:mga07m45_39103_c1
1401 nmdc:mga07m45_41749_c1
1402 Ga0500610_0021151
1403 Ga0500635_0000104
1404 Ga0500578_0000622
1405 Ga0500646_0007208
1406 Ga0500583_0008227
1407 Ga0500651_0000044
1408 Ga0500651_0019870
1409 Ga0500651_0166268
1410 Ga0500650_0021440
1411 Ga0500562_018421
1412 Ga0500571_000021
1413 Ga0500593_000247
1414 Ga0500593_001518
1415 Ga0500593_055702
1416 Ga0500607_004925
1417 Ga0500608_002712
1418 Ga0500608_032230
1419 Ga0500618_011856
1420 Ga0500623_020393
1421 Ga0500642_0017579
1422 Ga0500652_000085
1423 Ga0500655_000337
1424 Ga0500658_0046887
1425 Ga0500559_0042822
1426 Ga0500568_0013917
1427 Ga0500568_0016153
1428 Ga0500574_042912
1429 Ga0500577_0095269
1430 Ga0500588_0017756
1431 Ga0500616_0014247
1432 Ga0500616_0099514
1433 Ga0500619_000362
1434 Ga0500638_032290
1435 Ga0500636_0058722
1436 Ga0500645_025151
1437 Ga0500656_002820
1438 Ga0500587_000338
1439 Ga0466962_0003928
1440 Ga0466962_0018283
1441 2511246265
1442 2513228469
1443 2513953410
1444 2514044649
1445 2548498734
1446 2587729915
1447 2587733469
1448 2587759871
1449 2588294449
1450 2599620761
1451 2599674060
1452 2599678623
1453 2599690272
1454 2599736369
1455 2599746224
1456 2600207942
1457 2643865517
1458 2643968883
1459 2643992056
1460 2644063240
1461 2644071723
1462 2644139812
1463 2644161444
1464 2644245667
1465 2644273798
1466 2644296227
1467 2644324161
1468 2644400596
1469 2644465116
1470 2644649464
1471 2676743815
1472 2738720606
1473 2738884197
1474 2739246354
1475 2739250253
1476 2739279805
1477 2746091257
1478 2746097690
1479 2792833274
1480 2816475431
1481 2819601292
1482 2819634180
1483 2831269302
1484 2834645787
1485 2838055296
1486 2842679450
1487 2842749768
1488 2852689152
1489 2863423991
1490 2870074056
1491 2885197185
1492 2885201643
1493 2885215646
1494 2899927361
1495 2904450899
1496 2904459598
1497 2904549251
1498 2904570312
1499 2904577445
1500 2919130411
1501 2919462573
1502 2919707685
1503 2928042727
1504 2928048846
1505 2928055179
1506 2928068605
1507 2928073487
1508 2928089960
1509 2928118318
1510 2928171220
1511 2928536425
1512 2929161427
1513 2929198581
1514 2929521697
1515 2945914088
1516 2945949636
1517 2945990518
1518 2954770705
1519 2990712106
1520 644750283
1521 8018849326
1522 8020938435
1523 8020949964
1524 8020957168
1525 8021123351
1526 8040171239

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

70

129

0.98

PF03466

LysR_substrate

LysR substrate binding domain

153

363

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9373 13 101
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9346 13 101
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9291 13 100
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9287 13 97
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9248 13 101
ID Description Score Start End Superfamily
af_P0ACQ7_8_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9788 14 97 1.10.10.10
af_P77700_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9718 16 97 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.97 12 92 1.10.10.10
af_Q2G0C6_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9686 13 93 1.10.10.10
af_Q47005_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9654 13 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A833KNX1-F1-model_v4 deleted 0.9822 13 85
AF-A0A5N7Y677-F1-model_v4 deleted 0.9771 9 96
AF-W1XG19-F1-model_v4 HTH-type transcriptional regulator abgR 0.9739 9 91 GO:0003700
GO:0005829
AF-A0A399P388-F1-model_v4 LysR family transcriptional regulator 0.9739 11 83 GO:0003700
AF-A0A6N3U979-F1-model_v4 deleted 0.9545 13 85

Map