F479682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 763 | 406 | 1526 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10011385|Ga0157369_100113852 |
| Length | 374 |
| Sequence | MNLAVDHRGVDLVSVVLELEGSLRTESISIQSFFTQNAYQSLDSGKPDQSLVLRKMTNYNHWFIRARLKTRQLLLLVALAEEGNIHRAAQVLNMTQPAASKLLKDLEDVLEVPLFDRLPRGMRPTWYGETMIRHARVALASLNQAHDELTALKAGRFGQVSVGAITAPGLTLLPPAVAMVKREQPDLRVSLEIETSPVLIERLEQGKLDILVARLFAEHDKAQLRYEALSEEPVCALVRPGHPLLGVSGLTLRDVVSAGWIVPPAGSVLRHRFELMFQEEGLAPPTNTIESPALLFITRMLQQSDMVAVLATDVARYYASHGIVSLLPLNMPCHMDAFGIITRTDRLLSPAARVMMKALKTASLSVYGRKFEID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 85 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 155 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 156 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 157 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 158 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 159 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 160 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 161 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 162 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 169 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 184 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 185 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 186 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 187 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 199 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 200 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 201 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 202 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 205 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 206 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 207 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 208 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 209 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 210 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 211 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 218 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 280 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 288 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 291 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 292 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 293 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 294 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 298 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 304 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 306 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 307 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 313 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 319 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 321 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 322 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 323 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 324 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 325 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 326 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 327 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 328 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 329 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 330 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 331 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 332 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 333 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 334 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 335 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 336 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 337 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 338 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 339 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 340 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 341 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 342 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 343 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 344 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 345 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 346 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 347 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 348 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 349 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 350 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 351 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 352 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 353 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 354 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 355 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 356 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 357 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 358 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 359 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 360 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 361 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 362 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 363 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 364 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 365 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 366 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 367 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 368 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 369 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 370 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 371 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 372 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 373 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 374 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 375 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 376 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 377 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 378 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 379 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 380 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 381 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 382 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 383 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 384 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 385 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 386 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 387 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 388 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 389 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 390 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 391 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 392 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 393 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 394 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 395 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 396 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 397 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 398 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 399 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 400 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 401 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 402 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 403 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 404 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 405 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 406 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.6 |
| Metatranscriptomes | 0.13 |
| Isolates | 11.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 39.84 |
| Nodule | 1.05 |
| Rhizoplane | 4.59 |
| Rhizosphere | 37.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10011385 | 3300013105 | Bacteria | 10101 |
| 2 | JGI24739J22299_10007043 | 3300001989 | Bacteria | 4231 |
| 3 | JGI25156J39149_1000053 | 3300002705 | Bacteria | 88796 |
| 4 | JGI25156J39149_1000229 | 3300002705 | Bacteria | 38688 |
| 5 | JGI25154J39366_1000082 | 3300002738 | Bacteria | 88767 |
| 6 | JGI25154J39366_1002197 | 3300002738 | Bacteria | 5407 |
| 7 | JGI25158J39367_1002974 | 3300002739 | Bacteria | 2668 |
| 8 | JGI25157J39369_1000072 | 3300002741 | Bacteria | 88796 |
| 9 | JGI25157J39369_1000235 | 3300002741 | Bacteria | 42844 |
| 10 | JGI25152J39213_1000942 | 3300002773 | Bacteria | 14276 |
| 11 | JGI25152J39213_1005726 | 3300002773 | Bacteria | 3550 |
| 12 | JGI25152J39213_1006030 | 3300002773 | Bacteria | 3391 |
| 13 | JGI25150J39212_1002720 | 3300002774 | Bacteria | 4305 |
| 14 | JGI25150J39212_1009423 | 3300002774 | Bacteria | 1860 |
| 15 | JGI25159J45721_1006013 | 3300002987 | Bacteria | 3707 |
| 16 | JGI25151J46595_10001345 | 3300003187 | Bacteria | 17082 |
| 17 | JGI25151J46595_10002163 | 3300003187 | Bacteria | 12182 |
| 18 | JGI25151J46595_10010819 | 3300003187 | Bacteria | 4222 |
| 19 | JGI25151J46595_10014236 | 3300003187 | Bacteria | 3550 |
| 20 | JGI25153J46596_10006053 | 3300003215 | Bacteria | 6214 |
| 21 | JGI25153J46596_10012953 | 3300003215 | Bacteria | 3559 |
| 22 | JGI25153J46596_10018814 | 3300003215 | Bacteria | 2667 |
| 23 | rootH1_10121641 | 3300003316 | Bacteria | 2068 |
| 24 | rootH1_10056142 | 3300003323 | Bacteria | 4544 |
| 25 | rootH1_10081981 | 3300003323 | Bacteria | 2678 |
| 26 | JGI25160J50197_1000188 | 3300003354 | Bacteria | 52036 |
| 27 | JGI25160J50197_1000227 | 3300003354 | Bacteria | 44493 |
| 28 | JGI25160J50197_1008812 | 3300003354 | Bacteria | 3805 |
| 29 | JGI25160J50197_1009683 | 3300003354 | Bacteria | 3550 |
| 30 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 31 | JGI25161J50226_1002786 | 3300003374 | Bacteria | 4301 |
| 32 | JGI25161J50226_1004513 | 3300003374 | Bacteria | 2902 |
| 33 | Ga0006562J51391_1162216 | 3300003578 | Bacteria | 2930 |
| 34 | Ga0055539_1001626 | 3300003752 | Bacteria | 4028 |
| 35 | Ga0055539_1001703 | 3300003752 | Bacteria | 3881 |
| 36 | Ga0055533_1000221 | 3300003756 | Bacteria | 40020 |
| 37 | Ga0055532_1000429 | 3300003758 | Bacteria | 20037 |
| 38 | Ga0055532_1000506 | 3300003758 | Bacteria | 17054 |
| 39 | Ga0055532_1000674 | 3300003758 | Bacteria | 12913 |
| 40 | Ga0055527_1000357 | 3300003760 | Bacteria | 21933 |
| 41 | Ga0055535_1000069 | 3300003761 | Bacteria | 115207 |
| 42 | Ga0055535_1000650 | 3300003761 | Bacteria | 27681 |
| 43 | Ga0055535_1000815 | 3300003761 | Bacteria | 22469 |
| 44 | Ga0055535_1010024 | 3300003761 | Bacteria | 1586 |
| 45 | Ga0055542_1000084 | 3300003762 | Bacteria | 125518 |
| 46 | Ga0055542_1000658 | 3300003762 | Bacteria | 28380 |
| 47 | Ga0055542_1012327 | 3300003762 | Bacteria | 1481 |
| 48 | Ga0055529_1000595 | 3300003763 | Bacteria | 28380 |
| 49 | Ga0055529_1000813 | 3300003763 | Bacteria | 18807 |
| 50 | Ga0055529_1003903 | 3300003763 | Bacteria | 2358 |
| 51 | Ga0055526_1000475 | 3300003771 | Bacteria | 31936 |
| 52 | Ga0055526_1008074 | 3300003771 | Bacteria | 5311 |
| 53 | Ga0055526_1012676 | 3300003771 | Bacteria | 3648 |
| 54 | Ga0055526_1013066 | 3300003771 | Bacteria | 3550 |
| 55 | Ga0055537_1000096 | 3300003773 | Bacteria | 65970 |
| 56 | Ga0055537_1000243 | 3300003773 | Bacteria | 39987 |
| 57 | Ga0055537_1001145 | 3300003773 | Bacteria | 11365 |
| 58 | Ga0055537_1002064 | 3300003773 | Bacteria | 7071 |
| 59 | Ga0055537_1011235 | 3300003773 | Bacteria | 1832 |
| 60 | Ga0055524_1000098 | 3300003775 | Bacteria | 108095 |
| 61 | Ga0055524_1000158 | 3300003775 | Bacteria | 78973 |
| 62 | Ga0055524_1001068 | 3300003775 | Bacteria | 16849 |
| 63 | Ga0055524_1010661 | 3300003775 | Bacteria | 3644 |
| 64 | Ga0055524_1011064 | 3300003775 | Bacteria | 3550 |
| 65 | Ga0055536_1003691 | 3300003781 | Bacteria | 8129 |
| 66 | Ga0055536_1005357 | 3300003781 | Bacteria | 6293 |
| 67 | Ga0055534_1000212 | 3300003784 | Bacteria | 42993 |
| 68 | Ga0055534_1000623 | 3300003784 | Bacteria | 18191 |
| 69 | Ga0055534_1005205 | 3300003784 | Bacteria | 3550 |
| 70 | Ga0055534_1007585 | 3300003784 | Bacteria | 2565 |
| 71 | Ga0055528_1000104 | 3300003790 | Bacteria | 67913 |
| 72 | Ga0055528_1000316 | 3300003790 | Bacteria | 40688 |
| 73 | Ga0055528_1000751 | 3300003790 | Bacteria | 22613 |
| 74 | Ga0055528_1006384 | 3300003790 | Bacteria | 5351 |
| 75 | Ga0055528_1011332 | 3300003790 | Bacteria | 3550 |
| 76 | Ga0055530_10000377 | 3300003791 | Bacteria | 40435 |
| 77 | Ga0055530_10003146 | 3300003791 | Bacteria | 9724 |
| 78 | Ga0055530_10005360 | 3300003791 | Bacteria | 6131 |
| 79 | Ga0055530_10008089 | 3300003791 | Bacteria | 4281 |
| 80 | Ga0055530_10031189 | 3300003791 | Bacteria | 1402 |
| 81 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 82 | Ga0055540_1000035 | 3300003792 | Bacteria | 166843 |
| 83 | Ga0055540_1000176 | 3300003792 | Bacteria | 63046 |
| 84 | Ga0055540_1000683 | 3300003792 | Bacteria | 23509 |
| 85 | Ga0055540_1004901 | 3300003792 | Bacteria | 5843 |
| 86 | Ga0055540_1007960 | 3300003792 | Bacteria | 3894 |
| 87 | Ga0055540_1011214 | 3300003792 | Bacteria | 2910 |
| 88 | Ga0055540_1029351 | 3300003792 | Bacteria | 1288 |
| 89 | Ga0055531_10001036 | 3300003794 | Bacteria | 22011 |
| 90 | Ga0055531_10007671 | 3300003794 | Bacteria | 5835 |
| 91 | Ga0055531_10014003 | 3300003794 | Bacteria | 3649 |
| 92 | Ga0055531_10019093 | 3300003794 | Bacteria | 2794 |
| 93 | Ga0058692_1000017 | 3300003856 | Bacteria | 274459 |
| 94 | Ga0058692_1000886 | 3300003856 | Bacteria | 11791 |
| 95 | Ga0055543_1000386 | 3300004625 | Bacteria | 28622 |
| 96 | Ga0055543_1007001 | 3300004625 | Bacteria | 2657 |
| 97 | Ga0055543_1008331 | 3300004625 | Bacteria | 2302 |
| 98 | Ga0065165_1000863 | 3300005262 | Bacteria | 39623 |
| 99 | Ga0065165_1003346 | 3300005262 | Bacteria | 11403 |
| 100 | Ga0065165_1004243 | 3300005262 | Bacteria | 9096 |
| 101 | Ga0065165_1006536 | 3300005262 | Bacteria | 6078 |
| 102 | Ga0065165_1007941 | 3300005262 | Bacteria | 5085 |
| 103 | Ga0065165_1026045 | 3300005262 | Bacteria | 1931 |
| 104 | Ga0070670_100157592 | 3300005331 | Bacteria | 1967 |
| 105 | Ga0068869_100244453 | 3300005334 | Bacteria | 1431 |
| 106 | Ga0070669_100053430 | 3300005353 | Bacteria | 2957 |
| 107 | Ga0070673_100022588 | 3300005364 | Bacteria | 4582 |
| 108 | Ga0070667_100008936 | 3300005367 | Bacteria | 8294 |
| 109 | Ga0070678_100017199 | 3300005456 | Bacteria | 4649 |
| 110 | Ga0070662_100008045 | 3300005457 | Bacteria | 6861 |
| 111 | Ga0070662_100202341 | 3300005457 | Bacteria | 1576 |
| 112 | Ga0070706_100026507 | 3300005467 | Bacteria | 5332 |
| 113 | Ga0068853_100039865 | 3300005539 | Bacteria | 4007 |
| 114 | Ga0068853_100166406 | 3300005539 | Bacteria | 1993 |
| 115 | Ga0070665_100014912 | 3300005548 | Bacteria | 7802 |
| 116 | Ga0070665_100322192 | 3300005548 | Bacteria | 1550 |
| 117 | Ga0068855_100000557 | 3300005563 | Bacteria | 45786 |
| 118 | Ga0068855_100045112 | 3300005563 | Bacteria | 5214 |
| 119 | Ga0068855_100108953 | 3300005563 | Bacteria | 3181 |
| 120 | Ga0070664_100083374 | 3300005564 | Bacteria | 2758 |
| 121 | Ga0068857_100046048 | 3300005577 | Bacteria | 3870 |
| 122 | Ga0068857_100066282 | 3300005577 | Bacteria | 3212 |
| 123 | Ga0068854_100000701 | 3300005578 | Bacteria | 19827 |
| 124 | Ga0068854_100003386 | 3300005578 | Bacteria | 9937 |
| 125 | Ga0068854_100178852 | 3300005578 | Bacteria | 1656 |
| 126 | Ga0068854_100203776 | 3300005578 | Bacteria | 1557 |
| 127 | Ga0068856_100008119 | 3300005614 | Bacteria | 10244 |
| 128 | Ga0068852_100046268 | 3300005616 | Bacteria | 3707 |
| 129 | Ga0068851_10030818 | 3300005834 | Bacteria | 2662 |
| 130 | Ga0068860_100243312 | 3300005843 | Bacteria | 1750 |
| 131 | Ga0075365_10000840 | 3300006038 | Bacteria | 12730 |
| 132 | Ga0075365_10026102 | 3300006038 | Bacteria | 3705 |
| 133 | Ga0075368_10011743 | 3300006042 | Bacteria | 3192 |
| 134 | Ga0075363_100001052 | 3300006048 | Bacteria | 9951 |
| 135 | Ga0075364_10006825 | 3300006051 | Bacteria | 6736 |
| 136 | Ga0075432_10003816 | 3300006058 | Bacteria | 5136 |
| 137 | Ga0075362_10004613 | 3300006177 | Bacteria | 4965 |
| 138 | Ga0075362_10011353 | 3300006177 | Bacteria | 3508 |
| 139 | Ga0075362_10021799 | 3300006177 | Bacteria | 2694 |
| 140 | Ga0075362_10025396 | 3300006177 | Bacteria | 2522 |
| 141 | Ga0075362_10035368 | 3300006177 | Bacteria | 2180 |
| 142 | Ga0075362_10077856 | 3300006177 | Bacteria | 1524 |
| 143 | Ga0075367_10006409 | 3300006178 | Bacteria | 5943 |
| 144 | Ga0075367_10010533 | 3300006178 | Bacteria | 4859 |
| 145 | Ga0075367_10055628 | 3300006178 | Bacteria | 2349 |
| 146 | Ga0075366_10001909 | 3300006195 | Bacteria | 10537 |
| 147 | Ga0075366_10007941 | 3300006195 | Bacteria | 5872 |
| 148 | Ga0075366_10022746 | 3300006195 | Bacteria | 3649 |
| 149 | Ga0075366_10034275 | 3300006195 | Bacteria | 2989 |
| 150 | Ga0075366_10048578 | 3300006195 | Bacteria | 2517 |
| 151 | Ga0075366_10158584 | 3300006195 | Bacteria | 1371 |
| 152 | Ga0075370_10002040 | 3300006353 | Bacteria | 9168 |
| 153 | Ga0075370_10034927 | 3300006353 | Bacteria | 2820 |
| 154 | Ga0075370_10077992 | 3300006353 | Bacteria | 1901 |
| 155 | Ga0079104_1000024 | 3300006946 | Bacteria | 219543 |
| 156 | Ga0099826_10000647 | 3300006948 | Bacteria | 17955 |
| 157 | Ga0105244_10020876 | 3300009036 | Bacteria | 3630 |
| 158 | Ga0105240_10007013 | 3300009093 | Bacteria | 16445 |
| 159 | Ga0105240_10008933 | 3300009093 | Bacteria | 14247 |
| 160 | Ga0105240_10010014 | 3300009093 | Bacteria | 13353 |
| 161 | Ga0105245_10047398 | 3300009098 | Bacteria | 3842 |
| 162 | Ga0105243_10012171 | 3300009148 | Bacteria | 6504 |
| 163 | Ga0105243_10031763 | 3300009148 | Bacteria | 4073 |
| 164 | Ga0105243_10131677 | 3300009148 | Bacteria | 2122 |
| 165 | Ga0105241_10049033 | 3300009174 | Bacteria | 3215 |
| 166 | Ga0105241_10358239 | 3300009174 | Bacteria | 1269 |
| 167 | Ga0105242_10007052 | 3300009176 | Bacteria | 8680 |
| 168 | Ga0105237_10001461 | 3300009545 | Bacteria | 31169 |
| 169 | Ga0105237_10041702 | 3300009545 | Bacteria | 4628 |
| 170 | Ga0105238_10008447 | 3300009551 | Bacteria | 10311 |
| 171 | Ga0105239_10000798 | 3300010375 | Bacteria | 44685 |
| 172 | Ga0105239_10121403 | 3300010375 | Bacteria | 2902 |
| 173 | Ga0105239_10165000 | 3300010375 | Bacteria | 2476 |
| 174 | Ga0105246_10153632 | 3300011119 | Bacteria | 1745 |
| 175 | Ga0157347_1002903 | 3300012502 | Bacteria | 1502 |
| 176 | Ga0157370_10123663 | 3300013104 | Bacteria | 2415 |
| 177 | Ga0157369_10086457 | 3300013105 | Bacteria | 3349 |
| 178 | Ga0157372_10286845 | 3300013307 | Bacteria | 1914 |
| 179 | Ga0157375_10482525 | 3300013308 | Bacteria | 1404 |
| 180 | Ga0182008_10010814 | 3300014497 | Bacteria | 4873 |
| 181 | Ga0182008_10016325 | 3300014497 | Bacteria | 3859 |
| 182 | Ga0182008_10035378 | 3300014497 | Bacteria | 2502 |
| 183 | Ga0182008_10114428 | 3300014497 | Bacteria | 1338 |
| 184 | Ga0157377_10000162 | 3300014745 | Bacteria | 40218 |
| 185 | Ga0157376_10284962 | 3300014969 | Bacteria | 1557 |
| 186 | Ga0182007_10002182 | 3300015262 | Bacteria | 9930 |
| 187 | Ga0182007_10018964 | 3300015262 | Bacteria | 2482 |
| 188 | Ga0182007_10076378 | 3300015262 | Bacteria | 1098 |
| 189 | Ga0182005_1009900 | 3300015265 | Bacteria | 2756 |
| 190 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 191 | Ga0183361_10007 | 3300016635 | Bacteria | 339575 |
| 192 | Ga0163161_10000072 | 3300017792 | Bacteria | 102352 |
| 193 | Ga0213872_10000204 | 3300021361 | Bacteria | 52638 |
| 194 | Ga0213872_10037667 | 3300021361 | Bacteria | 2208 |
| 195 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 196 | Ga0209436_101993 | 3300025208 | Bacteria | 6493 |
| 197 | Ga0209436_105375 | 3300025208 | Bacteria | 2959 |
| 198 | Ga0209566_100929 | 3300025225 | Bacteria | 13474 |
| 199 | Ga0209674_100270 | 3300025226 | Bacteria | 39854 |
| 200 | Ga0209674_101471 | 3300025226 | Bacteria | 6154 |
| 201 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 202 | Ga0209672_100063 | 3300025228 | Bacteria | 204903 |
| 203 | Ga0209672_101126 | 3300025228 | Bacteria | 11150 |
| 204 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 205 | Ga0209147_100077 | 3300025229 | Bacteria | 205964 |
| 206 | Ga0209147_100116 | 3300025229 | Bacteria | 143881 |
| 207 | Ga0209147_101467 | 3300025229 | Bacteria | 8459 |
| 208 | Ga0209563_100178 | 3300025230 | Bacteria | 41597 |
| 209 | Ga0207427_100650 | 3300025231 | Bacteria | 16837 |
| 210 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 211 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 212 | Ga0209258_100105 | 3300025242 | Bacteria | 207862 |
| 213 | Ga0209258_100370 | 3300025242 | Bacteria | 59033 |
| 214 | Ga0209258_100714 | 3300025242 | Bacteria | 22241 |
| 215 | Ga0207425_1000904 | 3300025245 | Bacteria | 14295 |
| 216 | Ga0207425_1003217 | 3300025245 | Bacteria | 5336 |
| 217 | Ga0207425_1004431 | 3300025245 | Bacteria | 4214 |
| 218 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 219 | Ga0209646_1000157 | 3300025246 | Bacteria | 94054 |
| 220 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 221 | Ga0209026_1000328 | 3300025250 | Bacteria | 47719 |
| 222 | Ga0209677_101668 | 3300025253 | Bacteria | 9325 |
| 223 | Ga0209677_101743 | 3300025253 | Bacteria | 9049 |
| 224 | Ga0209677_101779 | 3300025253 | Bacteria | 8903 |
| 225 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 226 | Ga0209148_1000107 | 3300025254 | Bacteria | 207862 |
| 227 | Ga0209148_1000277 | 3300025254 | Bacteria | 79813 |
| 228 | Ga0209148_1006066 | 3300025254 | Bacteria | 2665 |
| 229 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 230 | Ga0209759_1000448 | 3300025256 | Bacteria | 47719 |
| 231 | Ga0209759_1004057 | 3300025256 | Bacteria | 5604 |
| 232 | Ga0209759_1005894 | 3300025256 | Bacteria | 4192 |
| 233 | Ga0209759_1012386 | 3300025256 | Bacteria | 2366 |
| 234 | Ga0209759_1012670 | 3300025256 | Bacteria | 2323 |
| 235 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 236 | Ga0209129_1000147 | 3300025258 | Bacteria | 115120 |
| 237 | Ga0209129_1001795 | 3300025258 | Bacteria | 11407 |
| 238 | Ga0209129_1002493 | 3300025258 | Bacteria | 8978 |
| 239 | Ga0209129_1003595 | 3300025258 | Bacteria | 6632 |
| 240 | Ga0209233_1002309 | 3300025261 | Bacteria | 7113 |
| 241 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 242 | Ga0209565_1000026 | 3300025263 | Bacteria | 365910 |
| 243 | Ga0209565_1000117 | 3300025263 | Bacteria | 113536 |
| 244 | Ga0209565_1000482 | 3300025263 | Bacteria | 29305 |
| 245 | Ga0209565_1000534 | 3300025263 | Bacteria | 26749 |
| 246 | Ga0209565_1002047 | 3300025263 | Bacteria | 7746 |
| 247 | Ga0209565_1002308 | 3300025263 | Bacteria | 6987 |
| 248 | Ga0209455_1000100 | 3300025272 | Bacteria | 207862 |
| 249 | Ga0209455_1000590 | 3300025272 | Bacteria | 23490 |
| 250 | Ga0209455_1000594 | 3300025272 | Bacteria | 23265 |
| 251 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 252 | Ga0209673_1000137 | 3300025273 | Bacteria | 158691 |
| 253 | Ga0209673_1000218 | 3300025273 | Bacteria | 113542 |
| 254 | Ga0209673_1000415 | 3300025273 | Bacteria | 74762 |
| 255 | Ga0209673_1001234 | 3300025273 | Bacteria | 26811 |
| 256 | Ga0209673_1004918 | 3300025273 | Bacteria | 6955 |
| 257 | Ga0209673_1007869 | 3300025273 | Bacteria | 4824 |
| 258 | Ga0209673_1013506 | 3300025273 | Bacteria | 3216 |
| 259 | Ga0209130_1000289 | 3300025284 | Bacteria | 61485 |
| 260 | Ga0209130_1000477 | 3300025284 | Bacteria | 41244 |
| 261 | Ga0209130_1000916 | 3300025284 | Bacteria | 23720 |
| 262 | Ga0209130_1001348 | 3300025284 | Bacteria | 16621 |
| 263 | Ga0209130_1002132 | 3300025284 | Bacteria | 10500 |
| 264 | Ga0209675_1000113 | 3300025291 | Bacteria | 113542 |
| 265 | Ga0209675_1000379 | 3300025291 | Bacteria | 36995 |
| 266 | Ga0209675_1000540 | 3300025291 | Bacteria | 27687 |
| 267 | Ga0209675_1000559 | 3300025291 | Bacteria | 26945 |
| 268 | Ga0209675_1001092 | 3300025291 | Bacteria | 16691 |
| 269 | Ga0209675_1002524 | 3300025291 | Bacteria | 9333 |
| 270 | Ga0209675_1013669 | 3300025291 | Bacteria | 2521 |
| 271 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 272 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 273 | Ga0209676_1000216 | 3300025292 | Bacteria | 125759 |
| 274 | Ga0209676_1002084 | 3300025292 | Bacteria | 15495 |
| 275 | Ga0209676_1002944 | 3300025292 | Bacteria | 11117 |
| 276 | Ga0209676_1004555 | 3300025292 | Bacteria | 7671 |
| 277 | Ga0209676_1015854 | 3300025292 | Bacteria | 2752 |
| 278 | Ga0209025_1000194 | 3300025294 | Bacteria | 148593 |
| 279 | Ga0209025_1000375 | 3300025294 | Bacteria | 93043 |
| 280 | Ga0209025_1000503 | 3300025294 | Bacteria | 75048 |
| 281 | Ga0209025_1000728 | 3300025294 | Bacteria | 55852 |
| 282 | Ga0209025_1000890 | 3300025294 | Bacteria | 46568 |
| 283 | Ga0209025_1002918 | 3300025294 | Bacteria | 17042 |
| 284 | Ga0209025_1003283 | 3300025294 | Bacteria | 15570 |
| 285 | Ga0209025_1010170 | 3300025294 | Bacteria | 6418 |
| 286 | Ga0209025_1044232 | 3300025294 | Bacteria | 1864 |
| 287 | Ga0209564_1000129 | 3300025295 | Bacteria | 195163 |
| 288 | Ga0209564_1000220 | 3300025295 | Bacteria | 129579 |
| 289 | Ga0209564_1000327 | 3300025295 | Bacteria | 92740 |
| 290 | Ga0209564_1000452 | 3300025295 | Bacteria | 69505 |
| 291 | Ga0209564_1000579 | 3300025295 | Bacteria | 58010 |
| 292 | Ga0209564_1000620 | 3300025295 | Bacteria | 54301 |
| 293 | Ga0209564_1003725 | 3300025295 | Bacteria | 9987 |
| 294 | Ga0209564_1015900 | 3300025295 | Bacteria | 3035 |
| 295 | Ga0209758_1000177 | 3300025297 | Bacteria | 142824 |
| 296 | Ga0209758_1000199 | 3300025297 | Bacteria | 133164 |
| 297 | Ga0209758_1000600 | 3300025297 | Bacteria | 55923 |
| 298 | Ga0209758_1010313 | 3300025297 | Bacteria | 5612 |
| 299 | Ga0209758_1017476 | 3300025297 | Bacteria | 3569 |
| 300 | Ga0209758_1024055 | 3300025297 | Bacteria | 2727 |
| 301 | Ga0209758_1028680 | 3300025297 | Bacteria | 2347 |
| 302 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 303 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 304 | Ga0209050_1000133 | 3300025298 | Bacteria | 184688 |
| 305 | Ga0209050_1001320 | 3300025298 | Bacteria | 27764 |
| 306 | Ga0209050_1001869 | 3300025298 | Bacteria | 20247 |
| 307 | Ga0209050_1005260 | 3300025298 | Bacteria | 8243 |
| 308 | Ga0209050_1006508 | 3300025298 | Bacteria | 6887 |
| 309 | Ga0209050_1017137 | 3300025298 | Bacteria | 2911 |
| 310 | Ga0209050_1018842 | 3300025298 | Bacteria | 2657 |
| 311 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 312 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 313 | Ga0209256_1000117 | 3300025299 | Bacteria | 169435 |
| 314 | Ga0209256_1000151 | 3300025299 | Bacteria | 145299 |
| 315 | Ga0209256_1003336 | 3300025299 | Bacteria | 11391 |
| 316 | Ga0209256_1015232 | 3300025299 | Bacteria | 2704 |
| 317 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 318 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 319 | Ga0207426_1000166 | 3300025302 | Bacteria | 169435 |
| 320 | Ga0207426_1007743 | 3300025302 | Bacteria | 4454 |
| 321 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 322 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 323 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 324 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 325 | Ga0209051_1000255 | 3300025303 | Bacteria | 89418 |
| 326 | Ga0209051_1000370 | 3300025303 | Bacteria | 64642 |
| 327 | Ga0209051_1001607 | 3300025303 | Bacteria | 18438 |
| 328 | Ga0209051_1002201 | 3300025303 | Bacteria | 14399 |
| 329 | Ga0209051_1002454 | 3300025303 | Bacteria | 13276 |
| 330 | Ga0209051_1015174 | 3300025303 | Bacteria | 3556 |
| 331 | Ga0209051_1019974 | 3300025303 | Bacteria | 2906 |
| 332 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 333 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 334 | Ga0209257_1000095 | 3300025304 | Bacteria | 259437 |
| 335 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 336 | Ga0209257_1004198 | 3300025304 | Bacteria | 11424 |
| 337 | Ga0209257_1006583 | 3300025304 | Bacteria | 7408 |
| 338 | Ga0209257_1016654 | 3300025304 | Bacteria | 2957 |
| 339 | Ga0207656_10019756 | 3300025321 | Bacteria | 2668 |
| 340 | Ga0207655_1004027 | 3300025728 | Bacteria | 10604 |
| 341 | Ga0207705_10053393 | 3300025909 | Bacteria | 2911 |
| 342 | Ga0207654_10044386 | 3300025911 | Bacteria | 2524 |
| 343 | Ga0207654_10199045 | 3300025911 | Bacteria | 1318 |
| 344 | Ga0207695_10000527 | 3300025913 | Bacteria | 80644 |
| 345 | Ga0207695_10007898 | 3300025913 | Bacteria | 13428 |
| 346 | Ga0207695_10024312 | 3300025913 | Bacteria | 6819 |
| 347 | Ga0207695_10029912 | 3300025913 | Bacteria | 6008 |
| 348 | Ga0207695_10096745 | 3300025913 | Bacteria | 2954 |
| 349 | Ga0207671_10001730 | 3300025914 | Bacteria | 24566 |
| 350 | Ga0207657_10035279 | 3300025919 | Bacteria | 4486 |
| 351 | Ga0207657_10369786 | 3300025919 | Bacteria | 1130 |
| 352 | Ga0207646_10135490 | 3300025922 | Bacteria | 2217 |
| 353 | Ga0207681_10013022 | 3300025923 | Bacteria | 5142 |
| 354 | Ga0207681_10251338 | 3300025923 | Bacteria | 1380 |
| 355 | Ga0207694_10050113 | 3300025924 | Bacteria | 3232 |
| 356 | Ga0207687_10041458 | 3300025927 | Bacteria | 3161 |
| 357 | Ga0207690_10015128 | 3300025932 | Bacteria | 4671 |
| 358 | Ga0207706_10010455 | 3300025933 | Bacteria | 8478 |
| 359 | Ga0207706_10045858 | 3300025933 | Bacteria | 3871 |
| 360 | Ga0207709_10000208 | 3300025935 | Bacteria | 76530 |
| 361 | Ga0207709_10000320 | 3300025935 | Bacteria | 52414 |
| 362 | Ga0207709_10004923 | 3300025935 | Bacteria | 7644 |
| 363 | Ga0207709_10023154 | 3300025935 | Bacteria | 3532 |
| 364 | Ga0207667_10000062 | 3300025949 | Bacteria | 190422 |
| 365 | Ga0207667_10030142 | 3300025949 | Bacteria | 5870 |
| 366 | Ga0207667_10072465 | 3300025949 | Bacteria | 3581 |
| 367 | Ga0207651_10008063 | 3300025960 | Bacteria | 5654 |
| 368 | Ga0207640_10000022 | 3300025981 | Bacteria | 167526 |
| 369 | Ga0207640_10001829 | 3300025981 | Bacteria | 11415 |
| 370 | Ga0207640_10127458 | 3300025981 | Bacteria | 1834 |
| 371 | Ga0207658_10182865 | 3300025986 | Bacteria | 1736 |
| 372 | Ga0207658_10222756 | 3300025986 | Bacteria | 1588 |
| 373 | Ga0207677_10100124 | 3300026023 | Bacteria | 2130 |
| 374 | Ga0207639_10039751 | 3300026041 | Bacteria | 3507 |
| 375 | Ga0207702_10006258 | 3300026078 | Bacteria | 10288 |
| 376 | Ga0207648_10000267 | 3300026089 | Bacteria | 56681 |
| 377 | Ga0207674_10056200 | 3300026116 | Bacteria | 3998 |
| 378 | Ga0207674_10065678 | 3300026116 | Bacteria | 3656 |
| 379 | Ga0207683_10021631 | 3300026121 | Bacteria | 5511 |
| 380 | Ga0207683_10082862 | 3300026121 | Bacteria | 2850 |
| 381 | Ga0207683_10281990 | 3300026121 | Bacteria | 1518 |
| 382 | Ga0207698_10080606 | 3300026142 | Bacteria | 2623 |
| 383 | Ga0207698_10216036 | 3300026142 | Bacteria | 1729 |
| 384 | Ga0209281_1000104 | 3300027111 | Bacteria | 221056 |
| 385 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 386 | Ga0209371_1000113 | 3300027312 | Bacteria | 139649 |
| 387 | Ga0209282_1000725 | 3300027666 | Bacteria | 16563 |
| 388 | Ga0209813_10047421 | 3300027866 | Bacteria | 1331 |
| 389 | Ga0209974_10003849 | 3300027876 | Bacteria | 5376 |
| 390 | Ga0268264_10352020 | 3300028381 | Bacteria | 1402 |
| 391 | Ga0265336_10000016 | 3300028666 | Bacteria | 238832 |
| 392 | Ga0307515_10000109 | 3300028794 | Bacteria | 195895 |
| 393 | Ga0307515_10000399 | 3300028794 | Bacteria | 105068 |
| 394 | Ga0307515_10000722 | 3300028794 | Bacteria | 75999 |
| 395 | Ga0307515_10005885 | 3300028794 | Bacteria | 24748 |
| 396 | Ga0307515_10008040 | 3300028794 | Bacteria | 20665 |
| 397 | Ga0307515_10010556 | 3300028794 | Bacteria | 17684 |
| 398 | Ga0307515_10298755 | 3300028794 | Bacteria | 1298 |
| 399 | Ga0265324_10000715 | 3300029957 | Bacteria | 22057 |
| 400 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 401 | Ga0268256_1000184 | 3300030500 | Bacteria | 74040 |
| 402 | Ga0307511_10000445 | 3300030521 | Bacteria | 44375 |
| 403 | Ga0307511_10091949 | 3300030521 | Bacteria | 2050 |
| 404 | Ga0307511_10100764 | 3300030521 | Bacteria | 1898 |
| 405 | Ga0307512_10014807 | 3300030522 | Bacteria | 7256 |
| 406 | Ga0316177_1069991 | 3300030731 | Bacteria | 3971 |
| 407 | Ga0316176_1079393 | 3300030732 | Bacteria | 1560 |
| 408 | Ga0316179_1073240 | 3300030734 | Bacteria | 2267 |
| 409 | Ga0316180_1101777 | 3300030736 | Bacteria | 3663 |
| 410 | Ga0316183_1070234 | 3300030742 | Bacteria | 6252 |
| 411 | Ga0316181_1024359 | 3300030744 | Bacteria | 2954 |
| 412 | Ga0316182_1385109 | 3300030745 | Bacteria | 2024 |
| 413 | Ga0265328_10056687 | 3300031239 | Bacteria | 1438 |
| 414 | Ga0265327_10000327 | 3300031251 | Bacteria | 90721 |
| 415 | Ga0265327_10034433 | 3300031251 | Bacteria | 2811 |
| 416 | Ga0307513_10000256 | 3300031456 | Bacteria | 76296 |
| 417 | Ga0307513_10000990 | 3300031456 | Bacteria | 41065 |
| 418 | Ga0307513_10016752 | 3300031456 | Bacteria | 8818 |
| 419 | Ga0307513_10020012 | 3300031456 | Bacteria | 7945 |
| 420 | Ga0307513_10113649 | 3300031456 | Bacteria | 2695 |
| 421 | Ga0307513_10337480 | 3300031456 | Bacteria | 1259 |
| 422 | Ga0307509_10044218 | 3300031507 | Bacteria | 4814 |
| 423 | Ga0307509_10159866 | 3300031507 | Bacteria | 2153 |
| 424 | Ga0307408_100000754 | 3300031548 | Bacteria | 26065 |
| 425 | Ga0307408_100040095 | 3300031548 | Bacteria | 3314 |
| 426 | Ga0307408_100065813 | 3300031548 | Bacteria | 2659 |
| 427 | Ga0307508_10001040 | 3300031616 | Bacteria | 32178 |
| 428 | Ga0307514_10001900 | 3300031649 | Bacteria | 23013 |
| 429 | Ga0307514_10002253 | 3300031649 | Bacteria | 20544 |
| 430 | Ga0307514_10012705 | 3300031649 | Bacteria | 6998 |
| 431 | Ga0307514_10030858 | 3300031649 | Bacteria | 4300 |
| 432 | Ga0307516_10000262 | 3300031730 | Bacteria | 67427 |
| 433 | Ga0307516_10000326 | 3300031730 | Bacteria | 61941 |
| 434 | Ga0307516_10001328 | 3300031730 | Bacteria | 34313 |
| 435 | Ga0307516_10007742 | 3300031730 | Bacteria | 12285 |
| 436 | Ga0307516_10044959 | 3300031730 | Bacteria | 4365 |
| 437 | Ga0307405_10002643 | 3300031731 | Bacteria | 7965 |
| 438 | Ga0307405_10052728 | 3300031731 | Bacteria | 2530 |
| 439 | Ga0307406_10000960 | 3300031901 | Bacteria | 16138 |
| 440 | Ga0307406_10009507 | 3300031901 | Bacteria | 5456 |
| 441 | Ga0307407_10025543 | 3300031903 | Unclassified | 3115 |
| 442 | Ga0307412_10060369 | 3300031911 | Bacteria | 2544 |
| 443 | Ga0307416_100022272 | 3300032002 | Bacteria | 4570 |
| 444 | Ga0307416_100024847 | 3300032002 | Bacteria | 4381 |
| 445 | Ga0307416_100284995 | 3300032002 | Bacteria | 1631 |
| 446 | Ga0307411_10035231 | 3300032005 | Bacteria | 3123 |
| 447 | Ga0307411_10101685 | 3300032005 | Bacteria | 2035 |
| 448 | Ga0373934_0008002 | 3300035086 | Bacteria | 3934 |
| 449 | Ga0395899_0116704 | 3300037312 | Bacteria | 1915 |
| 450 | Ga0395898_0026223 | 3300037466 | Bacteria | 5867 |
| 451 | Ga0395905_0008573 | 3300037471 | Bacteria | 10075 |
| 452 | Ga0395905_0032656 | 3300037471 | Bacteria | 4895 |
| 453 | Ga0395905_0197342 | 3300037471 | Bacteria | 1887 |
| 454 | Ga0395905_0217110 | 3300037471 | Bacteria | 1790 |
| 455 | Ga0395901_0001189 | 3300038443 | Bacteria | 27686 |
| 456 | Ga0436361_0350058 | 3300039447 | Bacteria | 4835 |
| 457 | Ga0436361_0356037 | 3300039447 | Bacteria | 1949 |
| 458 | Ga0436361_0722191 | 3300039447 | Bacteria | 17181 |
| 459 | Ga0439436_0008157 | 3300041404 | Bacteria | 3219 |
| 460 | Ga0439461_0002794 | 3300041410 | Bacteria | 2821 |
| 461 | Ga0439466_0013820 | 3300041411 | Bacteria | 2951 |
| 462 | Ga0439465_0000738 | 3300041413 | Bacteria | 10126 |
| 463 | Ga0439465_0008530 | 3300041413 | Bacteria | 3232 |
| 464 | Ga0451789_0762496 | 3300041443 | Bacteria | 1483 |
| 465 | Ga0451793_0783358 | 3300041452 | Bacteria | 1400 |
| 466 | Ga0451793_1285781 | 3300041452 | Bacteria | 5125 |
| 467 | Ga0451797_0213656 | 3300041453 | Bacteria | 1269 |
| 468 | Ga0451797_1526663 | 3300041453 | Bacteria | 3414 |
| 469 | Ga0451798_0127830 | 3300041458 | Bacteria | 2643 |
| 470 | Ga0451800_0231280 | 3300041459 | Bacteria | 1881 |
| 471 | Ga0451800_0519897 | 3300041459 | Bacteria | 1718 |
| 472 | Ga0451800_0763839 | 3300041459 | Bacteria | 6447 |
| 473 | Ga0451800_1022907 | 3300041459 | Bacteria | 1435 |
| 474 | Ga0451802_2191706 | 3300041460 | Bacteria | 2113 |
| 475 | Ga0451806_025862 | 3300041462 | Bacteria | 6474 |
| 476 | Ga0451804_0357091 | 3300041463 | Bacteria | 2197 |
| 477 | Ga0451807_1401611 | 3300041486 | Bacteria | 6384 |
| 478 | Ga0451847_0891648 | 3300041503 | Bacteria | 1217 |
| 479 | Ga0451853_0237679 | 3300041512 | Bacteria | 3137 |
| 480 | Ga0439431_0002489 | 3300041997 | Bacteria | 4079 |
| 481 | Ga0439433_0004457 | 3300041999 | Bacteria | 3018 |
| 482 | Ga0439433_0037280 | 3300041999 | Bacteria | 1125 |
| 483 | Ga0439442_001397 | 3300042002 | Bacteria | 4772 |
| 484 | Ga0439442_009143 | 3300042002 | Bacteria | 2003 |
| 485 | Ga0439445_0009709 | 3300042004 | Bacteria | 2269 |
| 486 | Ga0439445_0035496 | 3300042004 | Bacteria | 1310 |
| 487 | Ga0439432_007467 | 3300042006 | Bacteria | 3874 |
| 488 | Ga0439432_010001 | 3300042006 | Bacteria | 3299 |
| 489 | Ga0439449_0000136 | 3300042007 | Bacteria | 24746 |
| 490 | Ga0439449_0007643 | 3300042007 | Bacteria | 4107 |
| 491 | Ga0439449_0047719 | 3300042007 | Bacteria | 1586 |
| 492 | Ga0439462_0004736 | 3300042015 | Bacteria | 3333 |
| 493 | Ga0439462_0028764 | 3300042015 | Bacteria | 1469 |
| 494 | Ga0450911_000152 | 3300042115 | Bacteria | 27922 |
| 495 | Ga0450923_001103 | 3300042125 | Bacteria | 3412 |
| 496 | Ga0450906_003231 | 3300042145 | Bacteria | 3518 |
| 497 | Ga0450906_007782 | 3300042145 | Bacteria | 2102 |
| 498 | Ga0450910_001480 | 3300042147 | Bacteria | 2968 |
| 499 | Ga0439446_0055681 | 3300042156 | Bacteria | 1187 |
| 500 | Ga0439434_0014765 | 3300042435 | Bacteria | 2324 |
| 501 | Ga0450918_003383 | 3300042531 | Bacteria | 2967 |
| 502 | Ga0451577_0000540 | 3300042876 | Bacteria | 62191 |
| 503 | Ga0451577_0086391 | 3300042876 | Bacteria | 2798 |
| 504 | Ga0466969_0000006 | 3300044656 | Bacteria | 152970 |
| 505 | Ga0466969_0017949 | 3300044656 | Bacteria | 3690 |
| 506 | Ga0466969_0041774 | 3300044656 | Bacteria | 2292 |
| 507 | Ga0466969_0068496 | 3300044656 | Bacteria | 1709 |
| 508 | Ga0466972_0001343 | 3300044658 | Bacteria | 11924 |
| 509 | Ga0453683_0064853 | 3300044673 | Bacteria | 2283 |
| 510 | Ga0466965_0024751 | 3300044683 | Bacteria | 2905 |
| 511 | Ga0466965_0033042 | 3300044683 | Bacteria | 2527 |
| 512 | Ga0466966_0001902 | 3300044684 | Bacteria | 13557 |
| 513 | Ga0466961_0002561 | 3300044693 | Bacteria | 11265 |
| 514 | Ga0466961_0012053 | 3300044693 | Bacteria | 5524 |
| 515 | Ga0466961_0015752 | 3300044693 | Bacteria | 4851 |
| 516 | Ga0466961_0020160 | 3300044693 | Bacteria | 4291 |
| 517 | Ga0466963_0010495 | 3300044694 | Bacteria | 5608 |
| 518 | Ga0466964_0025174 | 3300044706 | Bacteria | 2322 |
| 519 | Ga0453684_0058170 | 3300044712 | Bacteria | 4995 |
| 520 | Ga0453684_0217640 | 3300044712 | Bacteria | 2215 |
| 521 | Ga0466968_0110227 | 3300044735 | Bacteria | 1237 |
| 522 | Ga0466970_0007910 | 3300044765 | Bacteria | 5339 |
| 523 | Ga0466957_0008245 | 3300044842 | Bacteria | 5920 |
| 524 | Ga0466957_0041476 | 3300044842 | Bacteria | 2784 |
| 525 | Ga0466960_0010487 | 3300044901 | Bacteria | 3850 |
| 526 | Ga0466959_0001297 | 3300045049 | Bacteria | 15136 |
| 527 | Ga0466959_0009080 | 3300045049 | Bacteria | 7056 |
| 528 | Ga0466959_0052769 | 3300045049 | Bacteria | 2976 |
| 529 | Ga0466959_0067068 | 3300045049 | Bacteria | 2602 |
| 530 | Ga0451576_0038144 | 3300045051 | Bacteria | 5085 |
| 531 | Ga0466958_0010228 | 3300045836 | Bacteria | 5248 |
| 532 | Ga0466958_0030727 | 3300045836 | Bacteria | 3191 |
| 533 | Ga0466958_0046062 | 3300045836 | Bacteria | 2631 |
| 534 | Ga0466967_0070353 | 3300045976 | Bacteria | 3130 |
| 535 | Ga0466967_0194886 | 3300045976 | Bacteria | 1916 |
| 536 | Ga0495629_0125590 | 3300046459 | Bacteria | 1787 |
| 537 | Ga0495638_0030787 | 3300046460 | Bacteria | 3451 |
| 538 | Ga0495650_0015256 | 3300046471 | Bacteria | 3949 |
| 539 | Ga0495650_0107966 | 3300046471 | Bacteria | 1037 |
| 540 | Ga0495583_0000887 | 3300046506 | Bacteria | 35851 |
| 541 | Ga0495606_0013623 | 3300046507 | Bacteria | 6411 |
| 542 | Ga0495610_0010959 | 3300046512 | Bacteria | 5584 |
| 543 | Ga0495610_0022178 | 3300046512 | Bacteria | 3478 |
| 544 | Ga0495616_0021967 | 3300046513 | Bacteria | 3448 |
| 545 | Ga0495631_0000269 | 3300046518 | Bacteria | 36247 |
| 546 | Ga0495632_0002677 | 3300046519 | Bacteria | 13352 |
| 547 | Ga0495637_0008985 | 3300046520 | Bacteria | 4885 |
| 548 | Ga0495643_0120451 | 3300046522 | Bacteria | 1326 |
| 549 | Ga0495642_0058377 | 3300046528 | Bacteria | 1597 |
| 550 | Ga0495654_0014582 | 3300046530 | Bacteria | 4181 |
| 551 | Ga0495621_0029871 | 3300046539 | Bacteria | 1860 |
| 552 | Ga0495656_0000092 | 3300046615 | Bacteria | 38741 |
| 553 | Ga0495625_0000329 | 3300046660 | Bacteria | 72358 |
| 554 | Ga0495625_0008735 | 3300046660 | Bacteria | 8588 |
| 555 | Ga0495625_0027131 | 3300046660 | Bacteria | 4318 |
| 556 | Ga0495588_0022693 | 3300046674 | Bacteria | 3103 |
| 557 | Ga0495588_0031258 | 3300046674 | Bacteria | 2679 |
| 558 | Ga0495671_0004489 | 3300046692 | Bacteria | 8336 |
| 559 | Ga0495649_0026249 | 3300046694 | Bacteria | 3241 |
| 560 | Ga0495636_0067187 | 3300047318 | Bacteria | 1525 |
| 561 | Ga0495676_0000908 | 3300047321 | Bacteria | 24784 |
| 562 | Ga0495687_000018 | 3300047443 | Bacteria | 342973 |
| 563 | Ga0495687_032153 | 3300047443 | Bacteria | 2399 |
| 564 | Ga0495686_0018057 | 3300047472 | Bacteria | 4740 |
| 565 | Ga0495686_0087005 | 3300047472 | Bacteria | 1901 |
| 566 | Ga0495593_0011600 | 3300047673 | Bacteria | 5056 |
| 567 | Ga0495614_0000940 | 3300048089 | Bacteria | 12402 |
| 568 | Ga0496100_0079863 | 3300048903 | Bacteria | 2205 |
| 569 | Ga0496101_0042258 | 3300048904 | Bacteria | 3253 |
| 570 | Ga0496101_0102067 | 3300048904 | Bacteria | 2148 |
| 571 | Ga0496102_0000896 | 3300048905 | Bacteria | 28249 |
| 572 | Ga0496102_0004296 | 3300048905 | Bacteria | 12046 |
| 573 | Ga0496102_0229038 | 3300048905 | Bacteria | 1752 |
| 574 | Ga0496103_0029212 | 3300048906 | Bacteria | 3350 |
| 575 | Ga0496103_0262120 | 3300048906 | Bacteria | 1112 |
| 576 | Ga0496104_0063970 | 3300048907 | Bacteria | 3490 |
| 577 | Ga0496105_0002227 | 3300048908 | Bacteria | 14047 |
| 578 | Ga0496110_0054145 | 3300048913 | Bacteria | 3529 |
| 579 | Ga0496110_0061588 | 3300048913 | Bacteria | 3312 |
| 580 | Ga0496111_0346614 | 3300048914 | Bacteria | 1099 |
| 581 | Ga0496114_0075664 | 3300048917 | Bacteria | 2836 |
| 582 | Ga0496116_0015863 | 3300048919 | Bacteria | 5929 |
| 583 | Ga0496116_0068353 | 3300048919 | Bacteria | 2264 |
| 584 | Ga0496116_0077621 | 3300048919 | Bacteria | 2074 |
| 585 | Ga0496117_0001420 | 3300048920 | Bacteria | 34726 |
| 586 | Ga0496117_0042042 | 3300048920 | Bacteria | 3340 |
| 587 | Ga0496117_0081993 | 3300048920 | Bacteria | 2114 |
| 588 | Ga0496118_0007782 | 3300048921 | Bacteria | 11252 |
| 589 | Ga0496118_0033946 | 3300048921 | Bacteria | 4174 |
| 590 | Ga0496118_0083211 | 3300048921 | Bacteria | 2238 |
| 591 | Ga0496119_0001696 | 3300048922 | Bacteria | 25735 |
| 592 | Ga0496120_0001046 | 3300048923 | Bacteria | 36836 |
| 593 | Ga0496121_0002493 | 3300048924 | Bacteria | 27989 |
| 594 | Ga0496121_0122743 | 3300048924 | Bacteria | 1958 |
| 595 | Ga0496122_0000383 | 3300048925 | Bacteria | 94797 |
| 596 | Ga0496122_0001519 | 3300048925 | Bacteria | 36969 |
| 597 | Ga0496122_0161101 | 3300048925 | Bacteria | 1368 |
| 598 | Ga0496123_0000249 | 3300048926 | Bacteria | 108969 |
| 599 | Ga0496123_0001314 | 3300048926 | Bacteria | 35172 |
| 600 | Ga0496123_0086902 | 3300048926 | Bacteria | 1873 |
| 601 | Ga0496124_0030511 | 3300048927 | Bacteria | 4784 |
| 602 | Ga0496124_0031495 | 3300048927 | Bacteria | 4694 |
| 603 | Ga0496124_0131233 | 3300048927 | Bacteria | 1990 |
| 604 | Ga0496124_0190079 | 3300048927 | Bacteria | 1572 |
| 605 | Ga0496125_0052208 | 3300048928 | Bacteria | 3363 |
| 606 | Ga0496125_0072598 | 3300048928 | Bacteria | 2680 |
| 607 | Ga0496125_0116532 | 3300048928 | Bacteria | 1918 |
| 608 | Ga0496126_0007881 | 3300048929 | Bacteria | 11598 |
| 609 | Ga0496126_0080563 | 3300048929 | Bacteria | 2881 |
| 610 | Ga0496126_0256536 | 3300048929 | Bacteria | 1455 |
| 611 | Ga0501043_0000108 | 3300049579 | Bacteria | 77329 |
| 612 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 613 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 614 | Ga0501048_0000695 | 3300049582 | Bacteria | 24464 |
| 615 | Ga0501206_002627 | 3300049653 | Bacteria | 2260 |
| 616 | Ga0501262_000046 | 3300049759 | Bacteria | 15811 |
| 617 | Ga0501266_001027 | 3300049763 | Bacteria | 3600 |
| 618 | Ga0501269_007728 | 3300049766 | Bacteria | 1300 |
| 619 | nmdc:mga03683_124840_c1 | 3300050489 | Bacteria | 1147 |
| 620 | nmdc:mga03683_1416_c1 | 3300050489 | Bacteria | 7147 |
| 621 | nmdc:mga03683_27920_c1 | 3300050489 | Bacteria | 2240 |
| 622 | nmdc:mga03683_47770_c1 | 3300050489 | Bacteria | 1777 |
| 623 | nmdc:mga03683_57164_c1 | 3300050489 | Bacteria | 1641 |
| 624 | nmdc:mga03n38_15232_c1 | 3300050490 | Bacteria | 2965 |
| 625 | nmdc:mga00v17_135363_c1 | 3300050491 | Bacteria | 1577 |
| 626 | nmdc:mga00v17_27916_c1 | 3300050491 | Bacteria | 3300 |
| 627 | nmdc:mga0yw44_3842_c1 | 3300050492 | Bacteria | 6751 |
| 628 | nmdc:mga0k408_138684_c1 | 3300050493 | Bacteria | 1446 |
| 629 | nmdc:mga0k408_20398_c1 | 3300050493 | Bacteria | 3712 |
| 630 | nmdc:mga0k408_2702_c1 | 3300050493 | Bacteria | 7158 |
| 631 | nmdc:mga0k408_33323_c1 | 3300050493 | Bacteria | 2946 |
| 632 | nmdc:mga0k408_49077_c1 | 3300050493 | Bacteria | 2443 |
| 633 | nmdc:mga0k408_52437_c1 | 3300050493 | Bacteria | 2364 |
| 634 | nmdc:mga0k408_6702_c1 | 3300050493 | Bacteria | 6139 |
| 635 | nmdc:mga06z11_15473_c1 | 3300050494 | Bacteria | 3406 |
| 636 | nmdc:mga07m45_31557_c1 | 3300050496 | Bacteria | 2936 |
| 637 | nmdc:mga07m45_39103_c1 | 3300050496 | Bacteria | 2650 |
| 638 | nmdc:mga07m45_41749_c1 | 3300050496 | Bacteria | 2570 |
| 639 | Ga0500610_0021151 | 3300053079 | Bacteria | 3187 |
| 640 | Ga0500635_0000104 | 3300053080 | Bacteria | 50334 |
| 641 | Ga0500578_0000622 | 3300053086 | Bacteria | 43056 |
| 642 | Ga0500646_0007208 | 3300053090 | Bacteria | 2837 |
| 643 | Ga0500583_0008227 | 3300053092 | Bacteria | 3728 |
| 644 | Ga0500651_0000044 | 3300053093 | Bacteria | 86444 |
| 645 | Ga0500651_0019870 | 3300053093 | Bacteria | 4179 |
| 646 | Ga0500651_0166268 | 3300053093 | Bacteria | 1317 |
| 647 | Ga0500650_0021440 | 3300053098 | Bacteria | 2846 |
| 648 | Ga0500562_018421 | 3300053108 | Bacteria | 1803 |
| 649 | Ga0500571_000021 | 3300053110 | Bacteria | 57203 |
| 650 | Ga0500593_000247 | 3300053117 | Bacteria | 22153 |
| 651 | Ga0500593_001518 | 3300053117 | Bacteria | 8343 |
| 652 | Ga0500593_055702 | 3300053117 | Bacteria | 1747 |
| 653 | Ga0500607_004925 | 3300053121 | Bacteria | 8916 |
| 654 | Ga0500608_002712 | 3300053122 | Bacteria | 6506 |
| 655 | Ga0500608_032230 | 3300053122 | Bacteria | 2489 |
| 656 | Ga0500618_011856 | 3300053125 | Bacteria | 2301 |
| 657 | Ga0500623_020393 | 3300053127 | Bacteria | 3436 |
| 658 | Ga0500642_0017579 | 3300053130 | Bacteria | 2744 |
| 659 | Ga0500652_000085 | 3300053131 | Bacteria | 39352 |
| 660 | Ga0500655_000337 | 3300053133 | Bacteria | 10351 |
| 661 | Ga0500658_0046887 | 3300053134 | Bacteria | 1752 |
| 662 | Ga0500559_0042822 | 3300053136 | Bacteria | 1977 |
| 663 | Ga0500568_0013917 | 3300053139 | Bacteria | 3651 |
| 664 | Ga0500568_0016153 | 3300053139 | Bacteria | 3325 |
| 665 | Ga0500574_042912 | 3300053141 | Bacteria | 1268 |
| 666 | Ga0500577_0095269 | 3300053142 | Bacteria | 1209 |
| 667 | Ga0500588_0017756 | 3300053146 | Bacteria | 1863 |
| 668 | Ga0500616_0014247 | 3300053153 | Bacteria | 4576 |
| 669 | Ga0500616_0099514 | 3300053153 | Bacteria | 1424 |
| 670 | Ga0500619_000362 | 3300053154 | Bacteria | 8499 |
| 671 | Ga0500638_032290 | 3300053162 | Bacteria | 2528 |
| 672 | Ga0500636_0058722 | 3300053177 | Bacteria | 2248 |
| 673 | Ga0500645_025151 | 3300053730 | Bacteria | 1817 |
| 674 | Ga0500656_002820 | 3300053732 | Bacteria | 1595 |
| 675 | Ga0500587_000338 | 3300053739 | Bacteria | 5292 |
| 676 | Ga0466962_0003928 | 3300061719 | Bacteria | 7114 |
| 677 | Ga0466962_0018283 | 3300061719 | Bacteria | 3371 |
| 678 | 2511246265 | 2511231002 | Bacteria | 5042903 |
| 679 | 2513228469 | 2513020051 | Bacteria | 6053213 |
| 680 | 2513953410 | 2513237150 | Bacteria | 6553639 |
| 681 | 2514044649 | 2513237165 | Bacteria | 6771773 |
| 682 | 2548498734 | 2547132374 | Bacteria | 5530232 |
| 683 | 2587729915 | 2585428057 | Bacteria | 6737412 |
| 684 | 2587733469 | 2585428058 | Bacteria | 6853932 |
| 685 | 2587759871 | 2585428062 | Bacteria | 6842168 |
| 686 | 2588294449 | 2588253510 | Bacteria | 6901809 |
| 687 | 2599620761 | 2599185214 | Bacteria | 8209958 |
| 688 | 2599674060 | 2599185226 | Bacteria | 8233575 |
| 689 | 2599678623 | 2599185227 | Bacteria | 8246414 |
| 690 | 2599690272 | 2599185229 | Bacteria | 8216126 |
| 691 | 2599736369 | 2599185239 | Bacteria | 8686614 |
| 692 | 2599746224 | 2599185240 | Bacteria | 7968121 |
| 693 | 2600207942 | 2599185355 | Bacteria | 7968906 |
| 694 | 2643865517 | 2643221570 | Bacteria | 5103772 |
| 695 | 2643968883 | 2643221592 | Bacteria | 6608788 |
| 696 | 2643992056 | 2643221596 | Bacteria | 5006805 |
| 697 | 2644063240 | 2643221609 | Bacteria | 6756331 |
| 698 | 2644071723 | 2643221611 | Bacteria | 6820941 |
| 699 | 2644139812 | 2643221625 | Bacteria | 6512927 |
| 700 | 2644161444 | 2643221628 | Bacteria | 5745828 |
| 701 | 2644245667 | 2643221644 | Bacteria | 6865017 |
| 702 | 2644273798 | 2643221648 | Bacteria | 6521465 |
| 703 | 2644296227 | 2643221652 | Bacteria | 5140275 |
| 704 | 2644324161 | 2643221658 | Bacteria | 6064537 |
| 705 | 2644400596 | 2643221672 | Bacteria | 6322190 |
| 706 | 2644465116 | 2643221683 | Bacteria | 5749203 |
| 707 | 2644649464 | 2643221717 | Bacteria | 5676132 |
| 708 | 2676743815 | 2675903129 | Bacteria | 7964495 |
| 709 | 2738720606 | 2738541277 | Bacteria | 7458140 |
| 710 | 2738884197 | 2738541307 | Bacteria | 8606193 |
| 711 | 2739246354 | 2738543012 | Bacteria | 7115078 |
| 712 | 2739250253 | 2738543013 | Bacteria | 5618633 |
| 713 | 2739279805 | 2738543019 | Bacteria | 7459457 |
| 714 | 2746091257 | 2744054900 | Bacteria | 8399525 |
| 715 | 2746097690 | 2744054901 | Bacteria | 8397047 |
| 716 | 2792833274 | 2791355137 | Bacteria | 9654227 |
| 717 | 2816475431 | 2816332133 | Bacteria | 7249298 |
| 718 | 2819601292 | 2818991446 | Bacteria | 7757362 |
| 719 | 2819634180 | 2818991452 | Bacteria | 8442785 |
| 720 | 2831269302 | 2831265667 | Bacteria | 7184833 |
| 721 | 2834645787 | 2834641062 | Bacteria | 5559922 |
| 722 | 2838055296 | 2838054893 | Bacteria | 7451788 |
| 723 | 2842679450 | 2842677519 | Bacteria | 5615038 |
| 724 | 2842749768 | 2842747753 | Bacteria | 5578255 |
| 725 | 2852689152 | 2852684882 | Bacteria | 5463342 |
| 726 | 2863423991 | 2863421361 | Bacteria | 7300805 |
| 727 | 2870074056 | 2870068957 | Bacteria | 8925310 |
| 728 | 2885197185 | 2885192300 | Bacteria | 5882526 |
| 729 | 2885201643 | 2885198086 | Bacteria | 7212419 |
| 730 | 2885215646 | 2885211737 | Bacteria | 7212420 |
| 731 | 2899927361 | 2899924645 | Bacteria | 7487985 |
| 732 | 2904450899 | 2904449895 | Bacteria | 6927402 |
| 733 | 2904459598 | 2904456579 | Bacteria | 6819253 |
| 734 | 2904549251 | 2904541872 | Bacteria | 8915136 |
| 735 | 2904570312 | 2904564687 | Bacteria | 7609577 |
| 736 | 2904577445 | 2904571731 | Bacteria | 7608790 |
| 737 | 2919130411 | 2919130084 | Bacteria | 5301837 |
| 738 | 2919462573 | 2919462493 | Bacteria | 5817112 |
| 739 | 2919707685 | 2919704043 | Bacteria | 5560311 |
| 740 | 2928042727 | 2928037797 | Bacteria | 7273642 |
| 741 | 2928048846 | 2928044640 | Bacteria | 7271509 |
| 742 | 2928055179 | 2928051484 | Bacteria | 7773759 |
| 743 | 2928068605 | 2928064002 | Bacteria | 7419480 |
| 744 | 2928073487 | 2928070936 | Bacteria | 8062541 |
| 745 | 2928089960 | 2928084124 | Bacteria | 7159212 |
| 746 | 2928118318 | 2928115317 | Bacteria | 6477646 |
| 747 | 2928171220 | 2928170801 | Bacteria | 8785406 |
| 748 | 2928536425 | 2928536128 | Bacteria | 7657547 |
| 749 | 2929161427 | 2929160207 | Bacteria | 9075316 |
| 750 | 2929198581 | 2929195423 | Bacteria | 5325372 |
| 751 | 2929521697 | 2929520902 | Bacteria | 6765052 |
| 752 | 2945914088 | 2945909444 | Bacteria | 7065066 |
| 753 | 2945949636 | 2945945610 | Bacteria | 5951079 |
| 754 | 2945990518 | 2945984333 | Bacteria | 7358892 |
| 755 | 2954770705 | 2954767861 | Bacteria | 5535784 |
| 756 | 2990712106 | 2990710928 | Bacteria | 5002431 |
| 757 | 644750283 | 644736347 | Bacteria | 6476522 |
| 758 | 8018849326 | 8018845410 | Bacteria | 8933938 |
| 759 | 8020938435 | 8020938398 | Bacteria | 7472757 |
| 760 | 8020949964 | 8020945358 | Bacteria | 8467355 |
| 761 | 8020957168 | 8020953355 | Bacteria | 7439080 |
| 762 | 8021123351 | 8021120328 | Bacteria | 8782274 |
| 763 | 8040171239 | 8040167225 | Bacteria | 6542727 |
| 764 | Ga0157369_10011385 | |||
| 765 | JGI24739J22299_10007043 | |||
| 766 | JGI25156J39149_1000053 | |||
| 767 | JGI25156J39149_1000229 | |||
| 768 | JGI25154J39366_1000082 | |||
| 769 | JGI25154J39366_1002197 | |||
| 770 | JGI25158J39367_1002974 | |||
| 771 | JGI25157J39369_1000072 | |||
| 772 | JGI25157J39369_1000235 | |||
| 773 | JGI25152J39213_1000942 | |||
| 774 | JGI25152J39213_1005726 | |||
| 775 | JGI25152J39213_1006030 | |||
| 776 | JGI25150J39212_1002720 | |||
| 777 | JGI25150J39212_1009423 | |||
| 778 | JGI25159J45721_1006013 | |||
| 779 | JGI25151J46595_10001345 | |||
| 780 | JGI25151J46595_10002163 | |||
| 781 | JGI25151J46595_10010819 | |||
| 782 | JGI25151J46595_10014236 | |||
| 783 | JGI25153J46596_10006053 | |||
| 784 | JGI25153J46596_10012953 | |||
| 785 | JGI25153J46596_10018814 | |||
| 786 | rootH1_10121641 | |||
| 787 | rootH1_10056142 | |||
| 788 | rootH1_10081981 | |||
| 789 | JGI25160J50197_1000188 | |||
| 790 | JGI25160J50197_1000227 | |||
| 791 | JGI25160J50197_1008812 | |||
| 792 | JGI25160J50197_1009683 | |||
| 793 | JGI25161J50226_1000007 | |||
| 794 | JGI25161J50226_1002786 | |||
| 795 | JGI25161J50226_1004513 | |||
| 796 | Ga0006562J51391_1162216 | |||
| 797 | Ga0055539_1001626 | |||
| 798 | Ga0055539_1001703 | |||
| 799 | Ga0055533_1000221 | |||
| 800 | Ga0055532_1000429 | |||
| 801 | Ga0055532_1000506 | |||
| 802 | Ga0055532_1000674 | |||
| 803 | Ga0055527_1000357 | |||
| 804 | Ga0055535_1000069 | |||
| 805 | Ga0055535_1000650 | |||
| 806 | Ga0055535_1000815 | |||
| 807 | Ga0055535_1010024 | |||
| 808 | Ga0055542_1000084 | |||
| 809 | Ga0055542_1000658 | |||
| 810 | Ga0055542_1012327 | |||
| 811 | Ga0055529_1000595 | |||
| 812 | Ga0055529_1000813 | |||
| 813 | Ga0055529_1003903 | |||
| 814 | Ga0055526_1000475 | |||
| 815 | Ga0055526_1008074 | |||
| 816 | Ga0055526_1012676 | |||
| 817 | Ga0055526_1013066 | |||
| 818 | Ga0055537_1000096 | |||
| 819 | Ga0055537_1000243 | |||
| 820 | Ga0055537_1001145 | |||
| 821 | Ga0055537_1002064 | |||
| 822 | Ga0055537_1011235 | |||
| 823 | Ga0055524_1000098 | |||
| 824 | Ga0055524_1000158 | |||
| 825 | Ga0055524_1001068 | |||
| 826 | Ga0055524_1010661 | |||
| 827 | Ga0055524_1011064 | |||
| 828 | Ga0055536_1003691 | |||
| 829 | Ga0055536_1005357 | |||
| 830 | Ga0055534_1000212 | |||
| 831 | Ga0055534_1000623 | |||
| 832 | Ga0055534_1005205 | |||
| 833 | Ga0055534_1007585 | |||
| 834 | Ga0055528_1000104 | |||
| 835 | Ga0055528_1000316 | |||
| 836 | Ga0055528_1000751 | |||
| 837 | Ga0055528_1006384 | |||
| 838 | Ga0055528_1011332 | |||
| 839 | Ga0055530_10000377 | |||
| 840 | Ga0055530_10003146 | |||
| 841 | Ga0055530_10005360 | |||
| 842 | Ga0055530_10008089 | |||
| 843 | Ga0055530_10031189 | |||
| 844 | Ga0055540_1000004 | |||
| 845 | Ga0055540_1000035 | |||
| 846 | Ga0055540_1000176 | |||
| 847 | Ga0055540_1000683 | |||
| 848 | Ga0055540_1004901 | |||
| 849 | Ga0055540_1007960 | |||
| 850 | Ga0055540_1011214 | |||
| 851 | Ga0055540_1029351 | |||
| 852 | Ga0055531_10001036 | |||
| 853 | Ga0055531_10007671 | |||
| 854 | Ga0055531_10014003 | |||
| 855 | Ga0055531_10019093 | |||
| 856 | Ga0058692_1000017 | |||
| 857 | Ga0058692_1000886 | |||
| 858 | Ga0055543_1000386 | |||
| 859 | Ga0055543_1007001 | |||
| 860 | Ga0055543_1008331 | |||
| 861 | Ga0065165_1000863 | |||
| 862 | Ga0065165_1003346 | |||
| 863 | Ga0065165_1004243 | |||
| 864 | Ga0065165_1006536 | |||
| 865 | Ga0065165_1007941 | |||
| 866 | Ga0065165_1026045 | |||
| 867 | Ga0070670_100157592 | |||
| 868 | Ga0068869_100244453 | |||
| 869 | Ga0070669_100053430 | |||
| 870 | Ga0070673_100022588 | |||
| 871 | Ga0070667_100008936 | |||
| 872 | Ga0070678_100017199 | |||
| 873 | Ga0070662_100008045 | |||
| 874 | Ga0070662_100202341 | |||
| 875 | Ga0070706_100026507 | |||
| 876 | Ga0068853_100039865 | |||
| 877 | Ga0068853_100166406 | |||
| 878 | Ga0070665_100014912 | |||
| 879 | Ga0070665_100322192 | |||
| 880 | Ga0068855_100000557 | |||
| 881 | Ga0068855_100045112 | |||
| 882 | Ga0068855_100108953 | |||
| 883 | Ga0070664_100083374 | |||
| 884 | Ga0068857_100046048 | |||
| 885 | Ga0068857_100066282 | |||
| 886 | Ga0068854_100000701 | |||
| 887 | Ga0068854_100003386 | |||
| 888 | Ga0068854_100178852 | |||
| 889 | Ga0068854_100203776 | |||
| 890 | Ga0068856_100008119 | |||
| 891 | Ga0068852_100046268 | |||
| 892 | Ga0068851_10030818 | |||
| 893 | Ga0068860_100243312 | |||
| 894 | Ga0075365_10000840 | |||
| 895 | Ga0075365_10026102 | |||
| 896 | Ga0075368_10011743 | |||
| 897 | Ga0075363_100001052 | |||
| 898 | Ga0075364_10006825 | |||
| 899 | Ga0075432_10003816 | |||
| 900 | Ga0075362_10004613 | |||
| 901 | Ga0075362_10011353 | |||
| 902 | Ga0075362_10021799 | |||
| 903 | Ga0075362_10025396 | |||
| 904 | Ga0075362_10035368 | |||
| 905 | Ga0075362_10077856 | |||
| 906 | Ga0075367_10006409 | |||
| 907 | Ga0075367_10010533 | |||
| 908 | Ga0075367_10055628 | |||
| 909 | Ga0075366_10001909 | |||
| 910 | Ga0075366_10007941 | |||
| 911 | Ga0075366_10022746 | |||
| 912 | Ga0075366_10034275 | |||
| 913 | Ga0075366_10048578 | |||
| 914 | Ga0075366_10158584 | |||
| 915 | Ga0075370_10002040 | |||
| 916 | Ga0075370_10034927 | |||
| 917 | Ga0075370_10077992 | |||
| 918 | Ga0079104_1000024 | |||
| 919 | Ga0099826_10000647 | |||
| 920 | Ga0105244_10020876 | |||
| 921 | Ga0105240_10007013 | |||
| 922 | Ga0105240_10008933 | |||
| 923 | Ga0105240_10010014 | |||
| 924 | Ga0105245_10047398 | |||
| 925 | Ga0105243_10012171 | |||
| 926 | Ga0105243_10031763 | |||
| 927 | Ga0105243_10131677 | |||
| 928 | Ga0105241_10049033 | |||
| 929 | Ga0105241_10358239 | |||
| 930 | Ga0105242_10007052 | |||
| 931 | Ga0105237_10001461 | |||
| 932 | Ga0105237_10041702 | |||
| 933 | Ga0105238_10008447 | |||
| 934 | Ga0105239_10000798 | |||
| 935 | Ga0105239_10121403 | |||
| 936 | Ga0105239_10165000 | |||
| 937 | Ga0105246_10153632 | |||
| 938 | Ga0157347_1002903 | |||
| 939 | Ga0157370_10123663 | |||
| 940 | Ga0157369_10086457 | |||
| 941 | Ga0157372_10286845 | |||
| 942 | Ga0157375_10482525 | |||
| 943 | Ga0182008_10010814 | |||
| 944 | Ga0182008_10016325 | |||
| 945 | Ga0182008_10035378 | |||
| 946 | Ga0182008_10114428 | |||
| 947 | Ga0157377_10000162 | |||
| 948 | Ga0157376_10284962 | |||
| 949 | Ga0182007_10002182 | |||
| 950 | Ga0182007_10018964 | |||
| 951 | Ga0182007_10076378 | |||
| 952 | Ga0182005_1009900 | |||
| 953 | Ga0183362_10003 | |||
| 954 | Ga0183361_10007 | |||
| 955 | Ga0163161_10000072 | |||
| 956 | Ga0213872_10000204 | |||
| 957 | Ga0213872_10037667 | |||
| 958 | Ga0209435_100019 | |||
| 959 | Ga0209436_101993 | |||
| 960 | Ga0209436_105375 | |||
| 961 | Ga0209566_100929 | |||
| 962 | Ga0209674_100270 | |||
| 963 | Ga0209674_101471 | |||
| 964 | Ga0209672_100012 | |||
| 965 | Ga0209672_100063 | |||
| 966 | Ga0209672_101126 | |||
| 967 | Ga0209147_100007 | |||
| 968 | Ga0209147_100077 | |||
| 969 | Ga0209147_100116 | |||
| 970 | Ga0209147_101467 | |||
| 971 | Ga0209563_100178 | |||
| 972 | Ga0207427_100650 | |||
| 973 | Ga0209258_100014 | |||
| 974 | Ga0209258_100093 | |||
| 975 | Ga0209258_100105 | |||
| 976 | Ga0209258_100370 | |||
| 977 | Ga0209258_100714 | |||
| 978 | Ga0207425_1000904 | |||
| 979 | Ga0207425_1003217 | |||
| 980 | Ga0207425_1004431 | |||
| 981 | Ga0209646_1000038 | |||
| 982 | Ga0209646_1000157 | |||
| 983 | Ga0209026_1000048 | |||
| 984 | Ga0209026_1000328 | |||
| 985 | Ga0209677_101668 | |||
| 986 | Ga0209677_101743 | |||
| 987 | Ga0209677_101779 | |||
| 988 | Ga0209148_1000007 | |||
| 989 | Ga0209148_1000107 | |||
| 990 | Ga0209148_1000277 | |||
| 991 | Ga0209148_1006066 | |||
| 992 | Ga0209759_1000038 | |||
| 993 | Ga0209759_1000448 | |||
| 994 | Ga0209759_1004057 | |||
| 995 | Ga0209759_1005894 | |||
| 996 | Ga0209759_1012386 | |||
| 997 | Ga0209759_1012670 | |||
| 998 | Ga0209129_1000038 | |||
| 999 | Ga0209129_1000147 | |||
| 1000 | Ga0209129_1001795 | |||
| 1001 | Ga0209129_1002493 | |||
| 1002 | Ga0209129_1003595 | |||
| 1003 | Ga0209233_1002309 | |||
| 1004 | Ga0209565_1000021 | |||
| 1005 | Ga0209565_1000026 | |||
| 1006 | Ga0209565_1000117 | |||
| 1007 | Ga0209565_1000482 | |||
| 1008 | Ga0209565_1000534 | |||
| 1009 | Ga0209565_1002047 | |||
| 1010 | Ga0209565_1002308 | |||
| 1011 | Ga0209455_1000100 | |||
| 1012 | Ga0209455_1000590 | |||
| 1013 | Ga0209455_1000594 | |||
| 1014 | Ga0209673_1000009 | |||
| 1015 | Ga0209673_1000137 | |||
| 1016 | Ga0209673_1000218 | |||
| 1017 | Ga0209673_1000415 | |||
| 1018 | Ga0209673_1001234 | |||
| 1019 | Ga0209673_1004918 | |||
| 1020 | Ga0209673_1007869 | |||
| 1021 | Ga0209673_1013506 | |||
| 1022 | Ga0209130_1000289 | |||
| 1023 | Ga0209130_1000477 | |||
| 1024 | Ga0209130_1000916 | |||
| 1025 | Ga0209130_1001348 | |||
| 1026 | Ga0209130_1002132 | |||
| 1027 | Ga0209675_1000113 | |||
| 1028 | Ga0209675_1000379 | |||
| 1029 | Ga0209675_1000540 | |||
| 1030 | Ga0209675_1000559 | |||
| 1031 | Ga0209675_1001092 | |||
| 1032 | Ga0209675_1002524 | |||
| 1033 | Ga0209675_1013669 | |||
| 1034 | Ga0209676_1000013 | |||
| 1035 | Ga0209676_1000028 | |||
| 1036 | Ga0209676_1000216 | |||
| 1037 | Ga0209676_1002084 | |||
| 1038 | Ga0209676_1002944 | |||
| 1039 | Ga0209676_1004555 | |||
| 1040 | Ga0209676_1015854 | |||
| 1041 | Ga0209025_1000194 | |||
| 1042 | Ga0209025_1000375 | |||
| 1043 | Ga0209025_1000503 | |||
| 1044 | Ga0209025_1000728 | |||
| 1045 | Ga0209025_1000890 | |||
| 1046 | Ga0209025_1002918 | |||
| 1047 | Ga0209025_1003283 | |||
| 1048 | Ga0209025_1010170 | |||
| 1049 | Ga0209025_1044232 | |||
| 1050 | Ga0209564_1000129 | |||
| 1051 | Ga0209564_1000220 | |||
| 1052 | Ga0209564_1000327 | |||
| 1053 | Ga0209564_1000452 | |||
| 1054 | Ga0209564_1000579 | |||
| 1055 | Ga0209564_1000620 | |||
| 1056 | Ga0209564_1003725 | |||
| 1057 | Ga0209564_1015900 | |||
| 1058 | Ga0209758_1000177 | |||
| 1059 | Ga0209758_1000199 | |||
| 1060 | Ga0209758_1000600 | |||
| 1061 | Ga0209758_1010313 | |||
| 1062 | Ga0209758_1017476 | |||
| 1063 | Ga0209758_1024055 | |||
| 1064 | Ga0209758_1028680 | |||
| 1065 | Ga0209050_1000008 | |||
| 1066 | Ga0209050_1000072 | |||
| 1067 | Ga0209050_1000133 | |||
| 1068 | Ga0209050_1001320 | |||
| 1069 | Ga0209050_1001869 | |||
| 1070 | Ga0209050_1005260 | |||
| 1071 | Ga0209050_1006508 | |||
| 1072 | Ga0209050_1017137 | |||
| 1073 | Ga0209050_1018842 | |||
| 1074 | Ga0209256_1000003 | |||
| 1075 | Ga0209256_1000011 | |||
| 1076 | Ga0209256_1000117 | |||
| 1077 | Ga0209256_1000151 | |||
| 1078 | Ga0209256_1003336 | |||
| 1079 | Ga0209256_1015232 | |||
| 1080 | Ga0207426_1000049 | |||
| 1081 | Ga0207426_1000091 | |||
| 1082 | Ga0207426_1000166 | |||
| 1083 | Ga0207426_1007743 | |||
| 1084 | Ga0209051_1000005 | |||
| 1085 | Ga0209051_1000015 | |||
| 1086 | Ga0209051_1000016 | |||
| 1087 | Ga0209051_1000056 | |||
| 1088 | Ga0209051_1000255 | |||
| 1089 | Ga0209051_1000370 | |||
| 1090 | Ga0209051_1001607 | |||
| 1091 | Ga0209051_1002201 | |||
| 1092 | Ga0209051_1002454 | |||
| 1093 | Ga0209051_1015174 | |||
| 1094 | Ga0209051_1019974 | |||
| 1095 | Ga0209257_1000037 | |||
| 1096 | Ga0209257_1000048 | |||
| 1097 | Ga0209257_1000095 | |||
| 1098 | Ga0209257_1000102 | |||
| 1099 | Ga0209257_1004198 | |||
| 1100 | Ga0209257_1006583 | |||
| 1101 | Ga0209257_1016654 | |||
| 1102 | Ga0207656_10019756 | |||
| 1103 | Ga0207655_1004027 | |||
| 1104 | Ga0207705_10053393 | |||
| 1105 | Ga0207654_10044386 | |||
| 1106 | Ga0207654_10199045 | |||
| 1107 | Ga0207695_10000527 | |||
| 1108 | Ga0207695_10007898 | |||
| 1109 | Ga0207695_10024312 | |||
| 1110 | Ga0207695_10029912 | |||
| 1111 | Ga0207695_10096745 | |||
| 1112 | Ga0207671_10001730 | |||
| 1113 | Ga0207657_10035279 | |||
| 1114 | Ga0207657_10369786 | |||
| 1115 | Ga0207646_10135490 | |||
| 1116 | Ga0207681_10013022 | |||
| 1117 | Ga0207681_10251338 | |||
| 1118 | Ga0207694_10050113 | |||
| 1119 | Ga0207687_10041458 | |||
| 1120 | Ga0207690_10015128 | |||
| 1121 | Ga0207706_10010455 | |||
| 1122 | Ga0207706_10045858 | |||
| 1123 | Ga0207709_10000208 | |||
| 1124 | Ga0207709_10000320 | |||
| 1125 | Ga0207709_10004923 | |||
| 1126 | Ga0207709_10023154 | |||
| 1127 | Ga0207667_10000062 | |||
| 1128 | Ga0207667_10030142 | |||
| 1129 | Ga0207667_10072465 | |||
| 1130 | Ga0207651_10008063 | |||
| 1131 | Ga0207640_10000022 | |||
| 1132 | Ga0207640_10001829 | |||
| 1133 | Ga0207640_10127458 | |||
| 1134 | Ga0207658_10182865 | |||
| 1135 | Ga0207658_10222756 | |||
| 1136 | Ga0207677_10100124 | |||
| 1137 | Ga0207639_10039751 | |||
| 1138 | Ga0207702_10006258 | |||
| 1139 | Ga0207648_10000267 | |||
| 1140 | Ga0207674_10056200 | |||
| 1141 | Ga0207674_10065678 | |||
| 1142 | Ga0207683_10021631 | |||
| 1143 | Ga0207683_10082862 | |||
| 1144 | Ga0207683_10281990 | |||
| 1145 | Ga0207698_10080606 | |||
| 1146 | Ga0207698_10216036 | |||
| 1147 | Ga0209281_1000104 | |||
| 1148 | Ga0209371_1000044 | |||
| 1149 | Ga0209371_1000113 | |||
| 1150 | Ga0209282_1000725 | |||
| 1151 | Ga0209813_10047421 | |||
| 1152 | Ga0209974_10003849 | |||
| 1153 | Ga0268264_10352020 | |||
| 1154 | Ga0265336_10000016 | |||
| 1155 | Ga0307515_10000109 | |||
| 1156 | Ga0307515_10000399 | |||
| 1157 | Ga0307515_10000722 | |||
| 1158 | Ga0307515_10005885 | |||
| 1159 | Ga0307515_10008040 | |||
| 1160 | Ga0307515_10010556 | |||
| 1161 | Ga0307515_10298755 | |||
| 1162 | Ga0265324_10000715 | |||
| 1163 | Ga0268256_1000046 | |||
| 1164 | Ga0268256_1000184 | |||
| 1165 | Ga0307511_10000445 | |||
| 1166 | Ga0307511_10091949 | |||
| 1167 | Ga0307511_10100764 | |||
| 1168 | Ga0307512_10014807 | |||
| 1169 | Ga0316177_1069991 | |||
| 1170 | Ga0316176_1079393 | |||
| 1171 | Ga0316179_1073240 | |||
| 1172 | Ga0316180_1101777 | |||
| 1173 | Ga0316183_1070234 | |||
| 1174 | Ga0316181_1024359 | |||
| 1175 | Ga0316182_1385109 | |||
| 1176 | Ga0265328_10056687 | |||
| 1177 | Ga0265327_10000327 | |||
| 1178 | Ga0265327_10034433 | |||
| 1179 | Ga0307513_10000256 | |||
| 1180 | Ga0307513_10000990 | |||
| 1181 | Ga0307513_10016752 | |||
| 1182 | Ga0307513_10020012 | |||
| 1183 | Ga0307513_10113649 | |||
| 1184 | Ga0307513_10337480 | |||
| 1185 | Ga0307509_10044218 | |||
| 1186 | Ga0307509_10159866 | |||
| 1187 | Ga0307408_100000754 | |||
| 1188 | Ga0307408_100040095 | |||
| 1189 | Ga0307408_100065813 | |||
| 1190 | Ga0307508_10001040 | |||
| 1191 | Ga0307514_10001900 | |||
| 1192 | Ga0307514_10002253 | |||
| 1193 | Ga0307514_10012705 | |||
| 1194 | Ga0307514_10030858 | |||
| 1195 | Ga0307516_10000262 | |||
| 1196 | Ga0307516_10000326 | |||
| 1197 | Ga0307516_10001328 | |||
| 1198 | Ga0307516_10007742 | |||
| 1199 | Ga0307516_10044959 | |||
| 1200 | Ga0307405_10002643 | |||
| 1201 | Ga0307405_10052728 | |||
| 1202 | Ga0307406_10000960 | |||
| 1203 | Ga0307406_10009507 | |||
| 1204 | Ga0307407_10025543 | |||
| 1205 | Ga0307412_10060369 | |||
| 1206 | Ga0307416_100022272 | |||
| 1207 | Ga0307416_100024847 | |||
| 1208 | Ga0307416_100284995 | |||
| 1209 | Ga0307411_10035231 | |||
| 1210 | Ga0307411_10101685 | |||
| 1211 | Ga0373934_0008002 | |||
| 1212 | Ga0395899_0116704 | |||
| 1213 | Ga0395898_0026223 | |||
| 1214 | Ga0395905_0008573 | |||
| 1215 | Ga0395905_0032656 | |||
| 1216 | Ga0395905_0197342 | |||
| 1217 | Ga0395905_0217110 | |||
| 1218 | Ga0395901_0001189 | |||
| 1219 | Ga0436361_0350058 | |||
| 1220 | Ga0436361_0356037 | |||
| 1221 | Ga0436361_0722191 | |||
| 1222 | Ga0439436_0008157 | |||
| 1223 | Ga0439461_0002794 | |||
| 1224 | Ga0439466_0013820 | |||
| 1225 | Ga0439465_0000738 | |||
| 1226 | Ga0439465_0008530 | |||
| 1227 | Ga0451789_0762496 | |||
| 1228 | Ga0451793_0783358 | |||
| 1229 | Ga0451793_1285781 | |||
| 1230 | Ga0451797_0213656 | |||
| 1231 | Ga0451797_1526663 | |||
| 1232 | Ga0451798_0127830 | |||
| 1233 | Ga0451800_0231280 | |||
| 1234 | Ga0451800_0519897 | |||
| 1235 | Ga0451800_0763839 | |||
| 1236 | Ga0451800_1022907 | |||
| 1237 | Ga0451802_2191706 | |||
| 1238 | Ga0451806_025862 | |||
| 1239 | Ga0451804_0357091 | |||
| 1240 | Ga0451807_1401611 | |||
| 1241 | Ga0451847_0891648 | |||
| 1242 | Ga0451853_0237679 | |||
| 1243 | Ga0439431_0002489 | |||
| 1244 | Ga0439433_0004457 | |||
| 1245 | Ga0439433_0037280 | |||
| 1246 | Ga0439442_001397 | |||
| 1247 | Ga0439442_009143 | |||
| 1248 | Ga0439445_0009709 | |||
| 1249 | Ga0439445_0035496 | |||
| 1250 | Ga0439432_007467 | |||
| 1251 | Ga0439432_010001 | |||
| 1252 | Ga0439449_0000136 | |||
| 1253 | Ga0439449_0007643 | |||
| 1254 | Ga0439449_0047719 | |||
| 1255 | Ga0439462_0004736 | |||
| 1256 | Ga0439462_0028764 | |||
| 1257 | Ga0450911_000152 | |||
| 1258 | Ga0450923_001103 | |||
| 1259 | Ga0450906_003231 | |||
| 1260 | Ga0450906_007782 | |||
| 1261 | Ga0450910_001480 | |||
| 1262 | Ga0439446_0055681 | |||
| 1263 | Ga0439434_0014765 | |||
| 1264 | Ga0450918_003383 | |||
| 1265 | Ga0451577_0000540 | |||
| 1266 | Ga0451577_0086391 | |||
| 1267 | Ga0466969_0000006 | |||
| 1268 | Ga0466969_0017949 | |||
| 1269 | Ga0466969_0041774 | |||
| 1270 | Ga0466969_0068496 | |||
| 1271 | Ga0466972_0001343 | |||
| 1272 | Ga0453683_0064853 | |||
| 1273 | Ga0466965_0024751 | |||
| 1274 | Ga0466965_0033042 | |||
| 1275 | Ga0466966_0001902 | |||
| 1276 | Ga0466961_0002561 | |||
| 1277 | Ga0466961_0012053 | |||
| 1278 | Ga0466961_0015752 | |||
| 1279 | Ga0466961_0020160 | |||
| 1280 | Ga0466963_0010495 | |||
| 1281 | Ga0466964_0025174 | |||
| 1282 | Ga0453684_0058170 | |||
| 1283 | Ga0453684_0217640 | |||
| 1284 | Ga0466968_0110227 | |||
| 1285 | Ga0466970_0007910 | |||
| 1286 | Ga0466957_0008245 | |||
| 1287 | Ga0466957_0041476 | |||
| 1288 | Ga0466960_0010487 | |||
| 1289 | Ga0466959_0001297 | |||
| 1290 | Ga0466959_0009080 | |||
| 1291 | Ga0466959_0052769 | |||
| 1292 | Ga0466959_0067068 | |||
| 1293 | Ga0451576_0038144 | |||
| 1294 | Ga0466958_0010228 | |||
| 1295 | Ga0466958_0030727 | |||
| 1296 | Ga0466958_0046062 | |||
| 1297 | Ga0466967_0070353 | |||
| 1298 | Ga0466967_0194886 | |||
| 1299 | Ga0495629_0125590 | |||
| 1300 | Ga0495638_0030787 | |||
| 1301 | Ga0495650_0015256 | |||
| 1302 | Ga0495650_0107966 | |||
| 1303 | Ga0495583_0000887 | |||
| 1304 | Ga0495606_0013623 | |||
| 1305 | Ga0495610_0010959 | |||
| 1306 | Ga0495610_0022178 | |||
| 1307 | Ga0495616_0021967 | |||
| 1308 | Ga0495631_0000269 | |||
| 1309 | Ga0495632_0002677 | |||
| 1310 | Ga0495637_0008985 | |||
| 1311 | Ga0495643_0120451 | |||
| 1312 | Ga0495642_0058377 | |||
| 1313 | Ga0495654_0014582 | |||
| 1314 | Ga0495621_0029871 | |||
| 1315 | Ga0495656_0000092 | |||
| 1316 | Ga0495625_0000329 | |||
| 1317 | Ga0495625_0008735 | |||
| 1318 | Ga0495625_0027131 | |||
| 1319 | Ga0495588_0022693 | |||
| 1320 | Ga0495588_0031258 | |||
| 1321 | Ga0495671_0004489 | |||
| 1322 | Ga0495649_0026249 | |||
| 1323 | Ga0495636_0067187 | |||
| 1324 | Ga0495676_0000908 | |||
| 1325 | Ga0495687_000018 | |||
| 1326 | Ga0495687_032153 | |||
| 1327 | Ga0495686_0018057 | |||
| 1328 | Ga0495686_0087005 | |||
| 1329 | Ga0495593_0011600 | |||
| 1330 | Ga0495614_0000940 | |||
| 1331 | Ga0496100_0079863 | |||
| 1332 | Ga0496101_0042258 | |||
| 1333 | Ga0496101_0102067 | |||
| 1334 | Ga0496102_0000896 | |||
| 1335 | Ga0496102_0004296 | |||
| 1336 | Ga0496102_0229038 | |||
| 1337 | Ga0496103_0029212 | |||
| 1338 | Ga0496103_0262120 | |||
| 1339 | Ga0496104_0063970 | |||
| 1340 | Ga0496105_0002227 | |||
| 1341 | Ga0496110_0054145 | |||
| 1342 | Ga0496110_0061588 | |||
| 1343 | Ga0496111_0346614 | |||
| 1344 | Ga0496114_0075664 | |||
| 1345 | Ga0496116_0015863 | |||
| 1346 | Ga0496116_0068353 | |||
| 1347 | Ga0496116_0077621 | |||
| 1348 | Ga0496117_0001420 | |||
| 1349 | Ga0496117_0042042 | |||
| 1350 | Ga0496117_0081993 | |||
| 1351 | Ga0496118_0007782 | |||
| 1352 | Ga0496118_0033946 | |||
| 1353 | Ga0496118_0083211 | |||
| 1354 | Ga0496119_0001696 | |||
| 1355 | Ga0496120_0001046 | |||
| 1356 | Ga0496121_0002493 | |||
| 1357 | Ga0496121_0122743 | |||
| 1358 | Ga0496122_0000383 | |||
| 1359 | Ga0496122_0001519 | |||
| 1360 | Ga0496122_0161101 | |||
| 1361 | Ga0496123_0000249 | |||
| 1362 | Ga0496123_0001314 | |||
| 1363 | Ga0496123_0086902 | |||
| 1364 | Ga0496124_0030511 | |||
| 1365 | Ga0496124_0031495 | |||
| 1366 | Ga0496124_0131233 | |||
| 1367 | Ga0496124_0190079 | |||
| 1368 | Ga0496125_0052208 | |||
| 1369 | Ga0496125_0072598 | |||
| 1370 | Ga0496125_0116532 | |||
| 1371 | Ga0496126_0007881 | |||
| 1372 | Ga0496126_0080563 | |||
| 1373 | Ga0496126_0256536 | |||
| 1374 | Ga0501043_0000108 | |||
| 1375 | Ga0501046_0000050 | |||
| 1376 | Ga0501047_0000012 | |||
| 1377 | Ga0501048_0000695 | |||
| 1378 | Ga0501206_002627 | |||
| 1379 | Ga0501262_000046 | |||
| 1380 | Ga0501266_001027 | |||
| 1381 | Ga0501269_007728 | |||
| 1382 | nmdc:mga03683_124840_c1 | |||
| 1383 | nmdc:mga03683_1416_c1 | |||
| 1384 | nmdc:mga03683_27920_c1 | |||
| 1385 | nmdc:mga03683_47770_c1 | |||
| 1386 | nmdc:mga03683_57164_c1 | |||
| 1387 | nmdc:mga03n38_15232_c1 | |||
| 1388 | nmdc:mga00v17_135363_c1 | |||
| 1389 | nmdc:mga00v17_27916_c1 | |||
| 1390 | nmdc:mga0yw44_3842_c1 | |||
| 1391 | nmdc:mga0k408_138684_c1 | |||
| 1392 | nmdc:mga0k408_20398_c1 | |||
| 1393 | nmdc:mga0k408_2702_c1 | |||
| 1394 | nmdc:mga0k408_33323_c1 | |||
| 1395 | nmdc:mga0k408_49077_c1 | |||
| 1396 | nmdc:mga0k408_52437_c1 | |||
| 1397 | nmdc:mga0k408_6702_c1 | |||
| 1398 | nmdc:mga06z11_15473_c1 | |||
| 1399 | nmdc:mga07m45_31557_c1 | |||
| 1400 | nmdc:mga07m45_39103_c1 | |||
| 1401 | nmdc:mga07m45_41749_c1 | |||
| 1402 | Ga0500610_0021151 | |||
| 1403 | Ga0500635_0000104 | |||
| 1404 | Ga0500578_0000622 | |||
| 1405 | Ga0500646_0007208 | |||
| 1406 | Ga0500583_0008227 | |||
| 1407 | Ga0500651_0000044 | |||
| 1408 | Ga0500651_0019870 | |||
| 1409 | Ga0500651_0166268 | |||
| 1410 | Ga0500650_0021440 | |||
| 1411 | Ga0500562_018421 | |||
| 1412 | Ga0500571_000021 | |||
| 1413 | Ga0500593_000247 | |||
| 1414 | Ga0500593_001518 | |||
| 1415 | Ga0500593_055702 | |||
| 1416 | Ga0500607_004925 | |||
| 1417 | Ga0500608_002712 | |||
| 1418 | Ga0500608_032230 | |||
| 1419 | Ga0500618_011856 | |||
| 1420 | Ga0500623_020393 | |||
| 1421 | Ga0500642_0017579 | |||
| 1422 | Ga0500652_000085 | |||
| 1423 | Ga0500655_000337 | |||
| 1424 | Ga0500658_0046887 | |||
| 1425 | Ga0500559_0042822 | |||
| 1426 | Ga0500568_0013917 | |||
| 1427 | Ga0500568_0016153 | |||
| 1428 | Ga0500574_042912 | |||
| 1429 | Ga0500577_0095269 | |||
| 1430 | Ga0500588_0017756 | |||
| 1431 | Ga0500616_0014247 | |||
| 1432 | Ga0500616_0099514 | |||
| 1433 | Ga0500619_000362 | |||
| 1434 | Ga0500638_032290 | |||
| 1435 | Ga0500636_0058722 | |||
| 1436 | Ga0500645_025151 | |||
| 1437 | Ga0500656_002820 | |||
| 1438 | Ga0500587_000338 | |||
| 1439 | Ga0466962_0003928 | |||
| 1440 | Ga0466962_0018283 | |||
| 1441 | 2511246265 | |||
| 1442 | 2513228469 | |||
| 1443 | 2513953410 | |||
| 1444 | 2514044649 | |||
| 1445 | 2548498734 | |||
| 1446 | 2587729915 | |||
| 1447 | 2587733469 | |||
| 1448 | 2587759871 | |||
| 1449 | 2588294449 | |||
| 1450 | 2599620761 | |||
| 1451 | 2599674060 | |||
| 1452 | 2599678623 | |||
| 1453 | 2599690272 | |||
| 1454 | 2599736369 | |||
| 1455 | 2599746224 | |||
| 1456 | 2600207942 | |||
| 1457 | 2643865517 | |||
| 1458 | 2643968883 | |||
| 1459 | 2643992056 | |||
| 1460 | 2644063240 | |||
| 1461 | 2644071723 | |||
| 1462 | 2644139812 | |||
| 1463 | 2644161444 | |||
| 1464 | 2644245667 | |||
| 1465 | 2644273798 | |||
| 1466 | 2644296227 | |||
| 1467 | 2644324161 | |||
| 1468 | 2644400596 | |||
| 1469 | 2644465116 | |||
| 1470 | 2644649464 | |||
| 1471 | 2676743815 | |||
| 1472 | 2738720606 | |||
| 1473 | 2738884197 | |||
| 1474 | 2739246354 | |||
| 1475 | 2739250253 | |||
| 1476 | 2739279805 | |||
| 1477 | 2746091257 | |||
| 1478 | 2746097690 | |||
| 1479 | 2792833274 | |||
| 1480 | 2816475431 | |||
| 1481 | 2819601292 | |||
| 1482 | 2819634180 | |||
| 1483 | 2831269302 | |||
| 1484 | 2834645787 | |||
| 1485 | 2838055296 | |||
| 1486 | 2842679450 | |||
| 1487 | 2842749768 | |||
| 1488 | 2852689152 | |||
| 1489 | 2863423991 | |||
| 1490 | 2870074056 | |||
| 1491 | 2885197185 | |||
| 1492 | 2885201643 | |||
| 1493 | 2885215646 | |||
| 1494 | 2899927361 | |||
| 1495 | 2904450899 | |||
| 1496 | 2904459598 | |||
| 1497 | 2904549251 | |||
| 1498 | 2904570312 | |||
| 1499 | 2904577445 | |||
| 1500 | 2919130411 | |||
| 1501 | 2919462573 | |||
| 1502 | 2919707685 | |||
| 1503 | 2928042727 | |||
| 1504 | 2928048846 | |||
| 1505 | 2928055179 | |||
| 1506 | 2928068605 | |||
| 1507 | 2928073487 | |||
| 1508 | 2928089960 | |||
| 1509 | 2928118318 | |||
| 1510 | 2928171220 | |||
| 1511 | 2928536425 | |||
| 1512 | 2929161427 | |||
| 1513 | 2929198581 | |||
| 1514 | 2929521697 | |||
| 1515 | 2945914088 | |||
| 1516 | 2945949636 | |||
| 1517 | 2945990518 | |||
| 1518 | 2954770705 | |||
| 1519 | 2990712106 | |||
| 1520 | 644750283 | |||
| 1521 | 8018849326 | |||
| 1522 | 8020938435 | |||
| 1523 | 8020949964 | |||
| 1524 | 8020957168 | |||
| 1525 | 8021123351 | |||
| 1526 | 8040171239 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9373 | 13 | 101 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9346 | 13 | 101 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.9291 | 13 | 100 |
| 4iht-assembly2.cif.gz_C | crystal structure of benm_dbd/bena site 1 dna complex | 0.9287 | 13 | 97 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9248 | 13 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACQ7_8_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9788 | 14 | 97 | 1.10.10.10 |
| af_P77700_7_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9718 | 16 | 97 | 1.10.10.10 |
| af_P77171_5_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.97 | 12 | 92 | 1.10.10.10 |
| af_Q2G0C6_1_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9686 | 13 | 93 | 1.10.10.10 |
| af_Q47005_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9654 | 13 | 98 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833KNX1-F1-model_v4 | deleted | 0.9822 | 13 | 85 |
|
| AF-A0A5N7Y677-F1-model_v4 | deleted | 0.9771 | 9 | 96 |
|
| AF-W1XG19-F1-model_v4 | HTH-type transcriptional regulator abgR | 0.9739 | 9 | 91 |
GO:0003700
GO:0005829 |
| AF-A0A399P388-F1-model_v4 | LysR family transcriptional regulator | 0.9739 | 11 | 83 |
GO:0003700
|
| AF-A0A6N3U979-F1-model_v4 | deleted | 0.9545 | 13 | 85 |
|