F479643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 398 | 702 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0029663|Ga0451577_0029663_2692_3411 |
| Length | 239 |
| Sequence | VGLFLFPHKHNPTMIRLFVGLGNPGPDYENTRHNAGFWWIDAVARALNAQLVVDKSYHGLVARTSVNGQTIWLLEPQTFMNLSGKSVAALAHFFKISPQEILVAHDELDVVPGEAKLKLGGSHAGHNGLRDIHAQLGTDQYWRLRLGIGHPGNKAEVVHWVLKKPSLDHRIAVDQTIDRAIKALPQLLSGDMEQATRLIHTSKPPRPKVPRPTPALTASDARVSTPMDSQPRPASTPSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 10 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 11 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 15 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 16 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 17 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 18 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 19 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 20 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 21 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 22 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 23 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 24 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 25 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 26 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 27 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 28 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 29 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 30 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 31 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 32 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 33 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 34 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 35 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 36 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 37 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 38 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 39 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 40 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 41 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 42 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 43 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 44 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 45 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 46 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 47 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 48 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 49 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 50 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 51 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 52 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 53 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 54 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 55 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 56 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 57 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 58 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 59 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 60 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 61 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 62 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 63 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 64 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 65 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 68 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 69 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 74 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 75 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 89 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 106 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 108 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 119 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 221 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 222 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 223 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 224 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 225 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 226 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 227 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 257 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 258 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 259 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 260 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 261 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 268 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 269 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 270 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 271 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 276 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 277 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 278 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 279 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 280 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 281 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 282 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 283 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 284 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 285 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 286 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 287 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 288 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 289 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 292 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 293 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 294 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 300 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 301 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 302 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 303 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 306 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 307 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 351 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 365 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 377 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 378 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 379 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 381 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 385 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 387 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 388 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 389 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 393 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 396 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 397 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 398 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.73 |
| Metatranscriptomes | 0.39 |
| Isolates | 7.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 34.91 |
| Nodule | 0.79 |
| Rhizoplane | 3.15 |
| Rhizosphere | 48.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009214 | 3300001979 | Bacteria | 3878 |
| 2 | JGI24740J21852_10009701 | 3300001979 | Bacteria | 3752 |
| 3 | JGI25155J39150_1000102 | 3300002704 | Bacteria | 45181 |
| 4 | JGI25156J39149_1000010 | 3300002705 | Bacteria | 200080 |
| 5 | JGI25154J39366_1000027 | 3300002738 | Bacteria | 200075 |
| 6 | JGI25158J39367_1006527 | 3300002739 | Bacteria | 1668 |
| 7 | JGI25157J39369_1000146 | 3300002741 | Bacteria | 59929 |
| 8 | JGI25152J39213_1000516 | 3300002773 | Bacteria | 21501 |
| 9 | JGI25152J39213_1010222 | 3300002773 | Bacteria | 2165 |
| 10 | JGI25152J39213_1011717 | 3300002773 | Bacteria | 1924 |
| 11 | JGI25150J39212_1003244 | 3300002774 | Bacteria | 3841 |
| 12 | JGI25150J39212_1007486 | 3300002774 | Bacteria | 2189 |
| 13 | JGI25150J39212_1009352 | 3300002774 | Bacteria | 1871 |
| 14 | JGI25150J39212_1010392 | 3300002774 | Bacteria | 1733 |
| 15 | JGI25159J45721_1000345 | 3300002987 | Bacteria | 21479 |
| 16 | JGI25159J45721_1001064 | 3300002987 | Bacteria | 11731 |
| 17 | JGI25159J45721_1012661 | 3300002987 | Bacteria | 1999 |
| 18 | JGI25159J45721_1013590 | 3300002987 | Bacteria | 1877 |
| 19 | JGI25151J46595_10010095 | 3300003187 | Bacteria | 4418 |
| 20 | JGI25151J46595_10019873 | 3300003187 | Bacteria | 2842 |
| 21 | JGI25151J46595_10029663 | 3300003187 | Bacteria | 2162 |
| 22 | JGI25151J46595_10033026 | 3300003187 | Bacteria | 1999 |
| 23 | JGI25151J46595_10033391 | 3300003187 | Bacteria | 1982 |
| 24 | JGI25153J46596_10002374 | 3300003215 | Bacteria | 10904 |
| 25 | JGI25153J46596_10003174 | 3300003215 | Bacteria | 9261 |
| 26 | JGI25153J46596_10027356 | 3300003215 | Bacteria | 1999 |
| 27 | JGI25160J50197_1000129 | 3300003354 | Bacteria | 68068 |
| 28 | JGI25160J50197_1017895 | 3300003354 | Bacteria | 2227 |
| 29 | JGI25160J50197_1020407 | 3300003354 | Bacteria | 1999 |
| 30 | JGI25160J50197_1040051 | 3300003354 | Bacteria | 1090 |
| 31 | JGI25161J50226_1000080 | 3300003374 | Bacteria | 79971 |
| 32 | JGI25161J50226_1006781 | 3300003374 | Bacteria | 2015 |
| 33 | Ga0006562J51391_1041255 | 3300003578 | Bacteria | 1347 |
| 34 | Ga0006562J51391_1049985 | 3300003578 | Bacteria | 1500 |
| 35 | Ga0006562J51391_1049987 | 3300003578 | Bacteria | 880 |
| 36 | Ga0055532_1010136 | 3300003758 | Bacteria | 1131 |
| 37 | Ga0055535_1002183 | 3300003761 | Bacteria | 7482 |
| 38 | Ga0055542_1000583 | 3300003762 | Bacteria | 31637 |
| 39 | Ga0055526_1002127 | 3300003771 | Bacteria | 13599 |
| 40 | Ga0055526_1008955 | 3300003771 | Bacteria | 4902 |
| 41 | Ga0055526_1024178 | 3300003771 | Bacteria | 1999 |
| 42 | Ga0055526_1024290 | 3300003771 | Bacteria | 1988 |
| 43 | Ga0055526_1027178 | 3300003771 | Bacteria | 1777 |
| 44 | Ga0055526_1033320 | 3300003771 | Bacteria | 1432 |
| 45 | Ga0055537_1000049 | 3300003773 | Bacteria | 87244 |
| 46 | Ga0055537_1000779 | 3300003773 | Bacteria | 16033 |
| 47 | Ga0055537_1007736 | 3300003773 | Bacteria | 2553 |
| 48 | Ga0055537_1010200 | 3300003773 | Bacteria | 1999 |
| 49 | Ga0055537_1010260 | 3300003773 | Bacteria | 1988 |
| 50 | Ga0055524_1000120 | 3300003775 | Bacteria | 91299 |
| 51 | Ga0055524_1000247 | 3300003775 | Bacteria | 56379 |
| 52 | Ga0055524_1023266 | 3300003775 | Bacteria | 1999 |
| 53 | Ga0055536_1001351 | 3300003781 | Bacteria | 14939 |
| 54 | Ga0055536_1002957 | 3300003781 | Bacteria | 9316 |
| 55 | Ga0055536_1011940 | 3300003781 | Bacteria | 3272 |
| 56 | Ga0055536_1015377 | 3300003781 | Bacteria | 2624 |
| 57 | Ga0055536_1019458 | 3300003781 | Bacteria | 2133 |
| 58 | Ga0055534_1000049 | 3300003784 | Bacteria | 92974 |
| 59 | Ga0055534_1001408 | 3300003784 | Bacteria | 9598 |
| 60 | Ga0055534_1010119 | 3300003784 | Bacteria | 1999 |
| 61 | Ga0055528_1001145 | 3300003790 | Bacteria | 17246 |
| 62 | Ga0055528_1002656 | 3300003790 | Bacteria | 9437 |
| 63 | Ga0055528_1022011 | 3300003790 | Bacteria | 1999 |
| 64 | Ga0055528_1022152 | 3300003790 | Bacteria | 1988 |
| 65 | Ga0055528_1026378 | 3300003790 | Bacteria | 1670 |
| 66 | Ga0055530_10001709 | 3300003791 | Bacteria | 15489 |
| 67 | Ga0055530_10003781 | 3300003791 | Bacteria | 8345 |
| 68 | Ga0055530_10010625 | 3300003791 | Bacteria | 3380 |
| 69 | Ga0055530_10013164 | 3300003791 | Bacteria | 2838 |
| 70 | Ga0055540_1000067 | 3300003792 | Bacteria | 122108 |
| 71 | Ga0055540_1000260 | 3300003792 | Bacteria | 47714 |
| 72 | Ga0055540_1006805 | 3300003792 | Bacteria | 4458 |
| 73 | Ga0055540_1007545 | 3300003792 | Bacteria | 4077 |
| 74 | Ga0055540_1009661 | 3300003792 | Bacteria | 3301 |
| 75 | Ga0055540_1012700 | 3300003792 | Bacteria | 2624 |
| 76 | Ga0055540_1017793 | 3300003792 | Bacteria | 1971 |
| 77 | Ga0055531_10001090 | 3300003794 | Bacteria | 21279 |
| 78 | Ga0055531_10001465 | 3300003794 | Bacteria | 17364 |
| 79 | Ga0055531_10001523 | 3300003794 | Bacteria | 16987 |
| 80 | Ga0055531_10006230 | 3300003794 | Bacteria | 6813 |
| 81 | Ga0055531_10018314 | 3300003794 | Bacteria | 2897 |
| 82 | Ga0055531_10019468 | 3300003794 | Bacteria | 2743 |
| 83 | Ga0055531_10027088 | 3300003794 | Bacteria | 2023 |
| 84 | Ga0055543_1000202 | 3300004625 | Bacteria | 48648 |
| 85 | Ga0055543_1009803 | 3300004625 | Bacteria | 2037 |
| 86 | Ga0065165_1001775 | 3300005262 | Bacteria | 21338 |
| 87 | Ga0065165_1005815 | 3300005262 | Bacteria | 6728 |
| 88 | Ga0065165_1014928 | 3300005262 | Bacteria | 2991 |
| 89 | Ga0065165_1024230 | 3300005262 | Bacteria | 2042 |
| 90 | Ga0065165_1050712 | 3300005262 | Bacteria | 1180 |
| 91 | Ga0065165_1061976 | 3300005262 | Bacteria | 1021 |
| 92 | Ga0065714_10014213 | 3300005288 | Bacteria | 2291 |
| 93 | Ga0065704_10076112 | 3300005289 | Bacteria | 5260 |
| 94 | Ga0070658_10629042 | 3300005327 | Bacteria | 931 |
| 95 | Ga0068869_100174378 | 3300005334 | Bacteria | 1682 |
| 96 | Ga0068868_100338173 | 3300005338 | Bacteria | 1286 |
| 97 | Ga0068868_100974123 | 3300005338 | Bacteria | 774 |
| 98 | Ga0070660_100201923 | 3300005339 | Bacteria | 1613 |
| 99 | Ga0070661_100000361 | 3300005344 | Bacteria | 35932 |
| 100 | Ga0070661_100021114 | 3300005344 | Bacteria | 4649 |
| 101 | Ga0070661_100162841 | 3300005344 | Bacteria | 1690 |
| 102 | Ga0070668_100107656 | 3300005347 | Bacteria | 2216 |
| 103 | Ga0070669_100032646 | 3300005353 | Bacteria | 3761 |
| 104 | Ga0070675_100415574 | 3300005354 | Bacteria | 1202 |
| 105 | Ga0070674_100089594 | 3300005356 | Bacteria | 2217 |
| 106 | Ga0070673_100145557 | 3300005364 | Bacteria | 2002 |
| 107 | Ga0070673_100192083 | 3300005364 | Bacteria | 1754 |
| 108 | Ga0070673_100368749 | 3300005364 | Bacteria | 1278 |
| 109 | Ga0070673_100397158 | 3300005364 | Bacteria | 1232 |
| 110 | Ga0070659_100002940 | 3300005366 | Bacteria | 12145 |
| 111 | Ga0070710_10191055 | 3300005437 | Bacteria | 1288 |
| 112 | Ga0070678_100050277 | 3300005456 | Bacteria | 3014 |
| 113 | Ga0070678_100597495 | 3300005456 | Bacteria | 985 |
| 114 | Ga0070678_100602417 | 3300005456 | Bacteria | 981 |
| 115 | Ga0070662_100001973 | 3300005457 | Bacteria | 12604 |
| 116 | Ga0068853_100084615 | 3300005539 | Bacteria | 2779 |
| 117 | Ga0068853_100176055 | 3300005539 | Bacteria | 1938 |
| 118 | Ga0068853_100203649 | 3300005539 | Bacteria | 1801 |
| 119 | Ga0070672_100105050 | 3300005543 | Bacteria | 2296 |
| 120 | Ga0068855_100610875 | 3300005563 | Bacteria | 1175 |
| 121 | Ga0070664_100012768 | 3300005564 | Bacteria | 6834 |
| 122 | Ga0070664_100031855 | 3300005564 | Bacteria | 4408 |
| 123 | Ga0068857_100107264 | 3300005577 | Bacteria | 2508 |
| 124 | Ga0068857_100362586 | 3300005577 | Bacteria | 1343 |
| 125 | Ga0068854_100157576 | 3300005578 | Bacteria | 1756 |
| 126 | Ga0068854_101000924 | 3300005578 | Bacteria | 740 |
| 127 | Ga0068854_101087652 | 3300005578 | Bacteria | 712 |
| 128 | Ga0068852_100016390 | 3300005616 | Bacteria | 5776 |
| 129 | Ga0068852_100229803 | 3300005616 | Bacteria | 1768 |
| 130 | Ga0068851_10014139 | 3300005834 | Bacteria | 3786 |
| 131 | Ga0068858_100804872 | 3300005842 | Bacteria | 917 |
| 132 | Ga0068862_100011728 | 3300005844 | Bacteria | 7234 |
| 133 | Ga0075365_10024063 | 3300006038 | Bacteria | 3837 |
| 134 | Ga0075363_100086618 | 3300006048 | Bacteria | 1720 |
| 135 | Ga0075364_10069982 | 3300006051 | Bacteria | 2309 |
| 136 | Ga0075364_10075286 | 3300006051 | Bacteria | 2227 |
| 137 | Ga0075364_10132379 | 3300006051 | Bacteria | 1674 |
| 138 | Ga0075432_10007264 | 3300006058 | Bacteria | 3773 |
| 139 | Ga0075432_10065093 | 3300006058 | Bacteria | 1303 |
| 140 | Ga0075432_10107833 | 3300006058 | Bacteria | 1035 |
| 141 | Ga0075362_10014486 | 3300006177 | Bacteria | 3184 |
| 142 | Ga0075362_10028411 | 3300006177 | Bacteria | 2402 |
| 143 | Ga0075362_10031463 | 3300006177 | Bacteria | 2296 |
| 144 | Ga0075362_10048721 | 3300006177 | Bacteria | 1891 |
| 145 | Ga0075362_10209693 | 3300006177 | Bacteria | 950 |
| 146 | Ga0075367_10092119 | 3300006178 | Bacteria | 1845 |
| 147 | Ga0075367_10150449 | 3300006178 | Bacteria | 1444 |
| 148 | Ga0075367_10437290 | 3300006178 | Bacteria | 829 |
| 149 | Ga0075369_10023885 | 3300006186 | Bacteria | 2530 |
| 150 | Ga0075366_10009278 | 3300006195 | Bacteria | 5493 |
| 151 | Ga0075366_10017692 | 3300006195 | Bacteria | 4107 |
| 152 | Ga0075366_10056332 | 3300006195 | Bacteria | 2335 |
| 153 | Ga0075366_10140381 | 3300006195 | Bacteria | 1460 |
| 154 | Ga0097621_100388322 | 3300006237 | Bacteria | 1248 |
| 155 | Ga0097621_100459103 | 3300006237 | Bacteria | 1148 |
| 156 | Ga0075370_10000282 | 3300006353 | Bacteria | 18351 |
| 157 | Ga0075370_10000918 | 3300006353 | Bacteria | 12102 |
| 158 | Ga0075370_10018552 | 3300006353 | Bacteria | 3777 |
| 159 | Ga0075370_10028661 | 3300006353 | Bacteria | 3096 |
| 160 | Ga0075370_10047822 | 3300006353 | Bacteria | 2422 |
| 161 | Ga0075370_10132707 | 3300006353 | Bacteria | 1454 |
| 162 | Ga0075429_100488514 | 3300006880 | Bacteria | 1079 |
| 163 | Ga0068865_100572676 | 3300006881 | Bacteria | 951 |
| 164 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 165 | Ga0079104_1000714 | 3300006946 | Bacteria | 30116 |
| 166 | Ga0105244_10004556 | 3300009036 | Bacteria | 9491 |
| 167 | Ga0105250_10000934 | 3300009092 | Bacteria | 17188 |
| 168 | Ga0105240_10281395 | 3300009093 | Bacteria | 1910 |
| 169 | Ga0105240_10651654 | 3300009093 | Bacteria | 1154 |
| 170 | Ga0105245_10197255 | 3300009098 | Bacteria | 1932 |
| 171 | Ga0105243_10003653 | 3300009148 | Bacteria | 12382 |
| 172 | Ga0105243_10012778 | 3300009148 | Bacteria | 6342 |
| 173 | Ga0105241_10056465 | 3300009174 | Bacteria | 3010 |
| 174 | Ga0105242_10002298 | 3300009176 | Bacteria | 15099 |
| 175 | Ga0105242_10051506 | 3300009176 | Bacteria | 3355 |
| 176 | Ga0105248_10409986 | 3300009177 | Bacteria | 1526 |
| 177 | Ga0105237_10121150 | 3300009545 | Bacteria | 2611 |
| 178 | Ga0105238_10235490 | 3300009551 | Bacteria | 1808 |
| 179 | Ga0105239_10146308 | 3300010375 | Bacteria | 2635 |
| 180 | Ga0105239_10499729 | 3300010375 | Bacteria | 1382 |
| 181 | Ga0105246_10086033 | 3300011119 | Bacteria | 2253 |
| 182 | Ga0105246_10170122 | 3300011119 | Bacteria | 1668 |
| 183 | Ga0105246_10194393 | 3300011119 | Bacteria | 1573 |
| 184 | Ga0105246_10209400 | 3300011119 | Bacteria | 1521 |
| 185 | Ga0157326_1001779 | 3300012513 | Bacteria | 2350 |
| 186 | Ga0157373_10055234 | 3300013100 | Bacteria | 2821 |
| 187 | Ga0157373_10081013 | 3300013100 | Bacteria | 2289 |
| 188 | Ga0157371_10141288 | 3300013102 | Bacteria | 1715 |
| 189 | Ga0157370_10003589 | 3300013104 | Bacteria | 18150 |
| 190 | Ga0157369_10037069 | 3300013105 | Bacteria | 5340 |
| 191 | Ga0157374_10103917 | 3300013296 | Bacteria | 2727 |
| 192 | Ga0163162_10186099 | 3300013306 | Bacteria | 2204 |
| 193 | Ga0163162_10542396 | 3300013306 | Bacteria | 1292 |
| 194 | Ga0157372_10043961 | 3300013307 | Bacteria | 4948 |
| 195 | Ga0157375_10317222 | 3300013308 | Bacteria | 1723 |
| 196 | Ga0157375_10656933 | 3300013308 | Bacteria | 1204 |
| 197 | Ga0182008_10002011 | 3300014497 | Bacteria | 13053 |
| 198 | Ga0182008_10003005 | 3300014497 | Bacteria | 10376 |
| 199 | Ga0182008_10010313 | 3300014497 | Bacteria | 5003 |
| 200 | Ga0182008_10049350 | 3300014497 | Bacteria | 2089 |
| 201 | Ga0157376_10002202 | 3300014969 | Bacteria | 13148 |
| 202 | Ga0182006_1028312 | 3300015261 | Bacteria | 2279 |
| 203 | Ga0182006_1085716 | 3300015261 | Bacteria | 1142 |
| 204 | Ga0182006_1109726 | 3300015261 | Bacteria | 970 |
| 205 | Ga0182007_10000674 | 3300015262 | Bacteria | 19632 |
| 206 | Ga0182007_10008930 | 3300015262 | Bacteria | 4082 |
| 207 | Ga0182005_1067553 | 3300015265 | Bacteria | 980 |
| 208 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 209 | Ga0163161_10000114 | 3300017792 | Bacteria | 76397 |
| 210 | Ga0163161_10101536 | 3300017792 | Bacteria | 2141 |
| 211 | Ga0163161_10122410 | 3300017792 | Bacteria | 1956 |
| 212 | Ga0163161_10129392 | 3300017792 | Bacteria | 1903 |
| 213 | Ga0163161_10268375 | 3300017792 | Bacteria | 1335 |
| 214 | Ga0163161_10454163 | 3300017792 | Bacteria | 1036 |
| 215 | Ga0213872_10004249 | 3300021361 | Bacteria | 7679 |
| 216 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 217 | Ga0209436_106469 | 3300025208 | Bacteria | 2562 |
| 218 | Ga0209436_109896 | 3300025208 | Bacteria | 1780 |
| 219 | Ga0209672_104078 | 3300025228 | Bacteria | 2812 |
| 220 | Ga0209147_105455 | 3300025229 | Bacteria | 1899 |
| 221 | Ga0209258_100568 | 3300025242 | Bacteria | 31666 |
| 222 | Ga0207425_1001221 | 3300025245 | Bacteria | 11309 |
| 223 | Ga0207425_1002159 | 3300025245 | Bacteria | 7193 |
| 224 | Ga0207425_1011740 | 3300025245 | Bacteria | 2075 |
| 225 | Ga0207425_1012211 | 3300025245 | Bacteria | 2022 |
| 226 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 227 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 228 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 229 | Ga0209759_1000019 | 3300025256 | Bacteria | 357908 |
| 230 | Ga0209129_1000227 | 3300025258 | Bacteria | 63512 |
| 231 | Ga0209129_1000294 | 3300025258 | Bacteria | 47351 |
| 232 | Ga0209129_1006379 | 3300025258 | Bacteria | 3832 |
| 233 | Ga0209129_1010140 | 3300025258 | Bacteria | 2387 |
| 234 | Ga0209129_1011664 | 3300025258 | Bacteria | 2082 |
| 235 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 236 | Ga0209565_1000116 | 3300025263 | Bacteria | 114340 |
| 237 | Ga0209565_1000171 | 3300025263 | Bacteria | 84566 |
| 238 | Ga0209565_1005961 | 3300025263 | Bacteria | 3486 |
| 239 | Ga0209565_1009957 | 3300025263 | Bacteria | 2379 |
| 240 | Ga0209673_1000295 | 3300025273 | Bacteria | 92499 |
| 241 | Ga0209673_1001210 | 3300025273 | Bacteria | 27444 |
| 242 | Ga0209673_1001360 | 3300025273 | Bacteria | 24264 |
| 243 | Ga0209673_1001942 | 3300025273 | Bacteria | 16305 |
| 244 | Ga0209673_1020479 | 3300025273 | Bacteria | 2340 |
| 245 | Ga0209673_1029925 | 3300025273 | Bacteria | 1725 |
| 246 | Ga0209673_1032115 | 3300025273 | Bacteria | 1622 |
| 247 | Ga0209130_1000095 | 3300025284 | Bacteria | 145126 |
| 248 | Ga0209130_1000134 | 3300025284 | Bacteria | 119102 |
| 249 | Ga0209130_1000193 | 3300025284 | Bacteria | 84550 |
| 250 | Ga0209130_1000560 | 3300025284 | Bacteria | 36900 |
| 251 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 252 | Ga0209675_1001804 | 3300025291 | Bacteria | 11691 |
| 253 | Ga0209675_1003215 | 3300025291 | Bacteria | 7913 |
| 254 | Ga0209675_1008491 | 3300025291 | Bacteria | 3765 |
| 255 | Ga0209675_1012282 | 3300025291 | Bacteria | 2771 |
| 256 | Ga0209675_1017248 | 3300025291 | Bacteria | 2068 |
| 257 | Ga0209675_1026281 | 3300025291 | Bacteria | 1451 |
| 258 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 259 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 260 | Ga0209676_1000124 | 3300025292 | Bacteria | 194206 |
| 261 | Ga0209676_1000145 | 3300025292 | Bacteria | 174391 |
| 262 | Ga0209676_1016118 | 3300025292 | Bacteria | 2716 |
| 263 | Ga0209676_1022886 | 3300025292 | Bacteria | 2058 |
| 264 | Ga0209676_1027050 | 3300025292 | Bacteria | 1810 |
| 265 | Ga0209025_1000204 | 3300025294 | Bacteria | 142193 |
| 266 | Ga0209025_1000264 | 3300025294 | Bacteria | 123411 |
| 267 | Ga0209025_1000348 | 3300025294 | Bacteria | 100228 |
| 268 | Ga0209025_1003744 | 3300025294 | Bacteria | 13938 |
| 269 | Ga0209025_1005205 | 3300025294 | Bacteria | 10733 |
| 270 | Ga0209025_1009410 | 3300025294 | Bacteria | 6812 |
| 271 | Ga0209025_1017213 | 3300025294 | Bacteria | 4193 |
| 272 | Ga0209025_1019826 | 3300025294 | Bacteria | 3716 |
| 273 | Ga0209025_1024711 | 3300025294 | Bacteria | 3090 |
| 274 | Ga0209025_1068041 | 3300025294 | Bacteria | 1282 |
| 275 | Ga0209564_1000231 | 3300025295 | Bacteria | 123417 |
| 276 | Ga0209564_1000300 | 3300025295 | Bacteria | 98386 |
| 277 | Ga0209564_1000728 | 3300025295 | Bacteria | 46991 |
| 278 | Ga0209564_1001669 | 3300025295 | Bacteria | 21246 |
| 279 | Ga0209564_1006632 | 3300025295 | Bacteria | 6186 |
| 280 | Ga0209758_1000222 | 3300025297 | Bacteria | 123411 |
| 281 | Ga0209758_1000453 | 3300025297 | Bacteria | 68482 |
| 282 | Ga0209758_1000605 | 3300025297 | Bacteria | 55552 |
| 283 | Ga0209758_1015212 | 3300025297 | Bacteria | 4008 |
| 284 | Ga0209758_1025105 | 3300025297 | Bacteria | 2626 |
| 285 | Ga0209758_1047085 | 3300025297 | Bacteria | 1548 |
| 286 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 287 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 288 | Ga0209050_1000252 | 3300025298 | Bacteria | 115215 |
| 289 | Ga0209050_1003801 | 3300025298 | Bacteria | 10778 |
| 290 | Ga0209050_1003829 | 3300025298 | Bacteria | 10730 |
| 291 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 292 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 293 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 294 | Ga0209256_1000749 | 3300025299 | Bacteria | 42336 |
| 295 | Ga0209256_1024835 | 3300025299 | Bacteria | 1757 |
| 296 | Ga0209256_1040713 | 3300025299 | Bacteria | 1185 |
| 297 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 298 | Ga0207426_1000349 | 3300025302 | Bacteria | 84546 |
| 299 | Ga0207426_1000397 | 3300025302 | Bacteria | 73966 |
| 300 | Ga0207426_1001961 | 3300025302 | Bacteria | 14639 |
| 301 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 302 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 303 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 304 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 305 | Ga0209051_1000247 | 3300025303 | Bacteria | 91122 |
| 306 | Ga0209051_1000456 | 3300025303 | Bacteria | 54000 |
| 307 | Ga0209051_1000579 | 3300025303 | Bacteria | 43794 |
| 308 | Ga0209051_1067993 | 3300025303 | Bacteria | 1086 |
| 309 | Ga0209051_1086562 | 3300025303 | Bacteria | 886 |
| 310 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 311 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 312 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 313 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 314 | Ga0209257_1000258 | 3300025304 | Bacteria | 122220 |
| 315 | Ga0209257_1006531 | 3300025304 | Bacteria | 7455 |
| 316 | Ga0209257_1021034 | 3300025304 | Bacteria | 2385 |
| 317 | Ga0207656_10136058 | 3300025321 | Bacteria | 1155 |
| 318 | Ga0207696_1002314 | 3300025711 | Bacteria | 9448 |
| 319 | Ga0207655_1008069 | 3300025728 | Bacteria | 6743 |
| 320 | Ga0207682_10081227 | 3300025893 | Bacteria | 1390 |
| 321 | Ga0207645_10030133 | 3300025907 | Bacteria | 3496 |
| 322 | Ga0207657_10333452 | 3300025919 | Bacteria | 1198 |
| 323 | Ga0207649_10000335 | 3300025920 | Bacteria | 35710 |
| 324 | Ga0207681_10011235 | 3300025923 | Bacteria | 5500 |
| 325 | Ga0207681_10263225 | 3300025923 | Bacteria | 1351 |
| 326 | Ga0207694_10664360 | 3300025924 | Bacteria | 878 |
| 327 | Ga0207650_10291841 | 3300025925 | Bacteria | 1330 |
| 328 | Ga0207690_10000176 | 3300025932 | Bacteria | 49560 |
| 329 | Ga0207706_10005101 | 3300025933 | Bacteria | 12262 |
| 330 | Ga0207706_10474020 | 3300025933 | Bacteria | 1082 |
| 331 | Ga0207686_10011578 | 3300025934 | Bacteria | 4833 |
| 332 | Ga0207686_10470623 | 3300025934 | Bacteria | 970 |
| 333 | Ga0207709_10000331 | 3300025935 | Bacteria | 50983 |
| 334 | Ga0207709_10000728 | 3300025935 | Bacteria | 26361 |
| 335 | Ga0207709_10007073 | 3300025935 | Bacteria | 6272 |
| 336 | Ga0207669_10317294 | 3300025937 | Bacteria | 1191 |
| 337 | Ga0207669_10587753 | 3300025937 | Bacteria | 903 |
| 338 | Ga0207691_10050413 | 3300025940 | Bacteria | 3811 |
| 339 | Ga0207691_10225673 | 3300025940 | Bacteria | 1623 |
| 340 | Ga0207689_10317804 | 3300025942 | Bacteria | 1292 |
| 341 | Ga0207679_10000168 | 3300025945 | Bacteria | 54187 |
| 342 | Ga0207679_10698259 | 3300025945 | Bacteria | 920 |
| 343 | Ga0207667_10210076 | 3300025949 | Bacteria | 1995 |
| 344 | Ga0207667_10474508 | 3300025949 | Bacteria | 1270 |
| 345 | Ga0207651_10144391 | 3300025960 | Bacteria | 1843 |
| 346 | Ga0207651_10160010 | 3300025960 | Bacteria | 1764 |
| 347 | Ga0207651_10332355 | 3300025960 | Bacteria | 1274 |
| 348 | Ga0207668_10302357 | 3300025972 | Bacteria | 1321 |
| 349 | Ga0207658_10054381 | 3300025986 | Bacteria | 2962 |
| 350 | Ga0207677_10112838 | 3300026023 | Bacteria | 2028 |
| 351 | Ga0207677_10445882 | 3300026023 | Bacteria | 1108 |
| 352 | Ga0207639_10114287 | 3300026041 | Bacteria | 2206 |
| 353 | Ga0207639_10141709 | 3300026041 | Bacteria | 2003 |
| 354 | Ga0207639_10164284 | 3300026041 | Bacteria | 1874 |
| 355 | Ga0207648_10065975 | 3300026089 | Bacteria | 3156 |
| 356 | Ga0207676_11259737 | 3300026095 | Bacteria | 734 |
| 357 | Ga0207674_10133308 | 3300026116 | Bacteria | 2447 |
| 358 | Ga0207683_10061823 | 3300026121 | Bacteria | 3297 |
| 359 | Ga0207683_10111598 | 3300026121 | Bacteria | 2448 |
| 360 | Ga0207683_10372091 | 3300026121 | Bacteria | 1313 |
| 361 | Ga0207698_10029695 | 3300026142 | Bacteria | 3919 |
| 362 | Ga0207698_10173197 | 3300026142 | Bacteria | 1903 |
| 363 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 364 | Ga0209281_1001190 | 3300027111 | Bacteria | 17791 |
| 365 | Ga0209970_1000068 | 3300027614 | Bacteria | 14109 |
| 366 | Ga0209282_1000501 | 3300027666 | Bacteria | 19021 |
| 367 | Ga0209971_1002743 | 3300027682 | Bacteria | 4207 |
| 368 | Ga0209998_10012096 | 3300027717 | Bacteria | 1791 |
| 369 | Ga0209974_10025576 | 3300027876 | Bacteria | 1954 |
| 370 | Ga0207428_10472031 | 3300027907 | Bacteria | 913 |
| 371 | Ga0268266_10017420 | 3300028379 | Bacteria | 6127 |
| 372 | Ga0268265_10024287 | 3300028380 | Bacteria | 4287 |
| 373 | Ga0268265_10045754 | 3300028380 | Bacteria | 3268 |
| 374 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 375 | Ga0307515_10000257 | 3300028794 | Bacteria | 131732 |
| 376 | Ga0307515_10235199 | 3300028794 | Bacteria | 1615 |
| 377 | Ga0307512_10122949 | 3300030522 | Bacteria | 1659 |
| 378 | Ga0316176_1014050 | 3300030732 | Bacteria | 1792 |
| 379 | Ga0314311_1003705 | 3300030733 | Bacteria | 9220 |
| 380 | Ga0316178_1010462 | 3300030735 | Bacteria | 4027 |
| 381 | Ga0316183_1067419 | 3300030742 | Bacteria | 8873 |
| 382 | Ga0316181_1007566 | 3300030744 | Bacteria | 1026 |
| 383 | Ga0316182_1188730 | 3300030745 | Bacteria | 1381 |
| 384 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 385 | Ga0265332_10000005 | 3300031238 | Bacteria | 377525 |
| 386 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 387 | Ga0265320_10079453 | 3300031240 | Bacteria | 1533 |
| 388 | Ga0265325_10001397 | 3300031241 | Bacteria | 17039 |
| 389 | Ga0265340_10037610 | 3300031247 | Bacteria | 2397 |
| 390 | Ga0265327_10000235 | 3300031251 | Bacteria | 111362 |
| 391 | Ga0265327_10001208 | 3300031251 | Bacteria | 34808 |
| 392 | Ga0265327_10037618 | 3300031251 | Bacteria | 2647 |
| 393 | Ga0265316_10000332 | 3300031344 | Bacteria | 52832 |
| 394 | Ga0307513_10000113 | 3300031456 | Bacteria | 114576 |
| 395 | Ga0307513_10004582 | 3300031456 | Bacteria | 18428 |
| 396 | Ga0307513_10011506 | 3300031456 | Bacteria | 10991 |
| 397 | Ga0307513_10361629 | 3300031456 | Bacteria | 1196 |
| 398 | Ga0307408_100000101 | 3300031548 | Bacteria | 94089 |
| 399 | Ga0307408_100013522 | 3300031548 | Bacteria | 5417 |
| 400 | Ga0307408_100102668 | 3300031548 | Bacteria | 2181 |
| 401 | Ga0307408_100167065 | 3300031548 | Bacteria | 1753 |
| 402 | Ga0307408_100650033 | 3300031548 | Bacteria | 943 |
| 403 | Ga0307514_10000928 | 3300031649 | Bacteria | 44600 |
| 404 | Ga0307514_10133587 | 3300031649 | Bacteria | 1703 |
| 405 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 406 | Ga0307516_10058267 | 3300031730 | Bacteria | 3760 |
| 407 | Ga0307516_10063255 | 3300031730 | Bacteria | 3583 |
| 408 | Ga0307405_10008898 | 3300031731 | Bacteria | 5119 |
| 409 | Ga0307405_10080257 | 3300031731 | Bacteria | 2129 |
| 410 | Ga0307413_10287365 | 3300031824 | Bacteria | 1240 |
| 411 | Ga0307410_10185345 | 3300031852 | Bacteria | 1579 |
| 412 | Ga0307406_10000497 | 3300031901 | Bacteria | 22565 |
| 413 | Ga0307406_10031294 | 3300031901 | Bacteria | 3238 |
| 414 | Ga0307407_10210180 | 3300031903 | Bacteria | 1309 |
| 415 | Ga0307412_10008057 | 3300031911 | Bacteria | 6003 |
| 416 | Ga0307412_10052422 | 3300031911 | Bacteria | 2701 |
| 417 | Ga0307412_10237912 | 3300031911 | Bacteria | 1406 |
| 418 | Ga0307412_10260067 | 3300031911 | Bacteria | 1352 |
| 419 | Ga0307412_10293715 | 3300031911 | Bacteria | 1281 |
| 420 | Ga0307412_10465026 | 3300031911 | Bacteria | 1045 |
| 421 | Ga0307412_10640307 | 3300031911 | Bacteria | 905 |
| 422 | Ga0307409_100738712 | 3300031995 | Bacteria | 987 |
| 423 | Ga0307416_100106996 | 3300032002 | Bacteria | 2453 |
| 424 | Ga0307416_100126451 | 3300032002 | Bacteria | 2290 |
| 425 | Ga0307416_100216767 | 3300032002 | Bacteria | 1831 |
| 426 | Ga0307416_100334462 | 3300032002 | Bacteria | 1524 |
| 427 | Ga0307414_10290726 | 3300032004 | Bacteria | 1377 |
| 428 | Ga0307411_10053721 | 3300032005 | Bacteria | 2641 |
| 429 | Ga0307411_10062461 | 3300032005 | Bacteria | 2485 |
| 430 | Ga0307411_11033111 | 3300032005 | Bacteria | 737 |
| 431 | Ga0307415_100239472 | 3300032126 | Bacteria | 1467 |
| 432 | Ga0395899_0006932 | 3300037312 | Bacteria | 8777 |
| 433 | Ga0395900_0032376 | 3300037418 | Bacteria | 5377 |
| 434 | Ga0395900_0036214 | 3300037418 | Bacteria | 5086 |
| 435 | Ga0395898_0023156 | 3300037466 | Bacteria | 6278 |
| 436 | Ga0395898_0035122 | 3300037466 | Bacteria | 4989 |
| 437 | Ga0395905_0000212 | 3300037471 | Bacteria | 89838 |
| 438 | Ga0395905_0000607 | 3300037471 | Bacteria | 47962 |
| 439 | Ga0395905_0004023 | 3300037471 | Bacteria | 15426 |
| 440 | Ga0395905_0099475 | 3300037471 | Bacteria | 2731 |
| 441 | Ga0395905_0134600 | 3300037471 | Bacteria | 2324 |
| 442 | Ga0395905_0392916 | 3300037471 | Bacteria | 1281 |
| 443 | Ga0395905_0493229 | 3300037471 | Bacteria | 1125 |
| 444 | Ga0395905_0665289 | 3300037471 | Bacteria | 943 |
| 445 | Ga0395901_0133122 | 3300038443 | Bacteria | 2612 |
| 446 | Ga0395901_0141343 | 3300038443 | Bacteria | 2530 |
| 447 | Ga0395901_0161929 | 3300038443 | Bacteria | 2350 |
| 448 | Ga0436361_0247854 | 3300039447 | Bacteria | 31958 |
| 449 | Ga0439436_0000562 | 3300041404 | Bacteria | 9794 |
| 450 | Ga0439436_0002238 | 3300041404 | Bacteria | 5788 |
| 451 | Ga0439436_0022773 | 3300041404 | Bacteria | 1855 |
| 452 | Ga0439438_022578 | 3300041405 | Bacteria | 1744 |
| 453 | Ga0439439_0008098 | 3300041406 | Bacteria | 2472 |
| 454 | Ga0439439_0019130 | 3300041406 | Bacteria | 1697 |
| 455 | Ga0439466_0010304 | 3300041411 | Bacteria | 3475 |
| 456 | Ga0439466_0014211 | 3300041411 | Bacteria | 2902 |
| 457 | Ga0439466_0022944 | 3300041411 | Bacteria | 2198 |
| 458 | Ga0439465_0000277 | 3300041413 | Bacteria | 14344 |
| 459 | Ga0439465_0122542 | 3300041413 | Bacteria | 912 |
| 460 | Ga0451791_1838390 | 3300041451 | Bacteria | 3287 |
| 461 | Ga0451793_1782101 | 3300041452 | Bacteria | 1192 |
| 462 | Ga0451795_0347533 | 3300041456 | Bacteria | 996 |
| 463 | Ga0451795_0584715 | 3300041456 | Bacteria | 2323 |
| 464 | Ga0451802_0579892 | 3300041460 | Bacteria | 913 |
| 465 | Ga0451807_0649746 | 3300041486 | Bacteria | 1023 |
| 466 | Ga0451807_0729911 | 3300041486 | Bacteria | 1160 |
| 467 | Ga0451807_2730351 | 3300041486 | Bacteria | 1305 |
| 468 | Ga0451853_1882879 | 3300041512 | Bacteria | 759 |
| 469 | Ga0439433_0001048 | 3300041999 | Bacteria | 5613 |
| 470 | Ga0439437_008399 | 3300042000 | Bacteria | 1161 |
| 471 | Ga0439437_011307 | 3300042000 | Bacteria | 1022 |
| 472 | Ga0439441_039044 | 3300042001 | Bacteria | 946 |
| 473 | Ga0439442_007320 | 3300042002 | Bacteria | 2219 |
| 474 | Ga0439445_0000763 | 3300042004 | Bacteria | 6751 |
| 475 | Ga0439445_0020134 | 3300042004 | Bacteria | 1668 |
| 476 | Ga0439445_0109876 | 3300042004 | Bacteria | 786 |
| 477 | Ga0439432_001936 | 3300042006 | Bacteria | 7821 |
| 478 | Ga0439432_003064 | 3300042006 | Bacteria | 6225 |
| 479 | Ga0439432_039445 | 3300042006 | Bacteria | 1501 |
| 480 | Ga0439449_0000120 | 3300042007 | Bacteria | 25953 |
| 481 | Ga0439449_0000453 | 3300042007 | Bacteria | 15268 |
| 482 | Ga0439449_0002248 | 3300042007 | Bacteria | 7592 |
| 483 | Ga0439449_0080899 | 3300042007 | Bacteria | 1198 |
| 484 | Ga0439452_002310 | 3300042010 | Bacteria | 7105 |
| 485 | Ga0439452_011741 | 3300042010 | Bacteria | 2509 |
| 486 | Ga0439462_0004564 | 3300042015 | Bacteria | 3387 |
| 487 | Ga0439462_0008753 | 3300042015 | Bacteria | 2558 |
| 488 | Ga0439462_0010910 | 3300042015 | Bacteria | 2307 |
| 489 | Ga0439462_0079854 | 3300042015 | Bacteria | 893 |
| 490 | Ga0439462_0092446 | 3300042015 | Bacteria | 831 |
| 491 | Ga0439463_097418 | 3300042016 | Bacteria | 758 |
| 492 | Ga0450911_000351 | 3300042115 | Bacteria | 15672 |
| 493 | Ga0450919_001118 | 3300042121 | Bacteria | 3472 |
| 494 | Ga0450923_007069 | 3300042125 | Bacteria | 1884 |
| 495 | Ga0450923_025754 | 3300042125 | Bacteria | 1174 |
| 496 | Ga0450888_006212 | 3300042126 | Bacteria | 1294 |
| 497 | Ga0450890_006779 | 3300042127 | Bacteria | 1462 |
| 498 | Ga0450890_009757 | 3300042127 | Bacteria | 1233 |
| 499 | Ga0450894_010502 | 3300042131 | Bacteria | 1201 |
| 500 | Ga0450896_002703 | 3300042133 | Bacteria | 2309 |
| 501 | Ga0450898_004060 | 3300042134 | Bacteria | 2140 |
| 502 | Ga0450898_004975 | 3300042134 | Bacteria | 1989 |
| 503 | Ga0450898_008896 | 3300042134 | Bacteria | 1597 |
| 504 | Ga0450899_009056 | 3300042135 | Bacteria | 1094 |
| 505 | Ga0450906_000192 | 3300042145 | Bacteria | 11600 |
| 506 | Ga0450906_016518 | 3300042145 | Bacteria | 1335 |
| 507 | Ga0450910_001673 | 3300042147 | Bacteria | 2843 |
| 508 | Ga0450908_000821 | 3300042184 | Bacteria | 5979 |
| 509 | Ga0450908_002821 | 3300042184 | Bacteria | 3377 |
| 510 | Ga0439434_0000289 | 3300042435 | Bacteria | 14374 |
| 511 | Ga0439434_0028083 | 3300042435 | Bacteria | 1703 |
| 512 | Ga0439434_0120115 | 3300042435 | Bacteria | 856 |
| 513 | Ga0439464_0054046 | 3300042439 | Bacteria | 1166 |
| 514 | Ga0450918_000077 | 3300042531 | Bacteria | 20527 |
| 515 | Ga0450918_000437 | 3300042531 | Bacteria | 8985 |
| 516 | Ga0451577_0029663 | 3300042876 | Bacteria | 4944 |
| 517 | Ga0451577_0679486 | 3300042876 | Bacteria | 933 |
| 518 | Ga0466969_0017993 | 3300044656 | Bacteria | 3686 |
| 519 | Ga0466969_0049594 | 3300044656 | Bacteria | 2071 |
| 520 | Ga0466972_0059783 | 3300044658 | Bacteria | 1829 |
| 521 | Ga0453683_0001887 | 3300044673 | Bacteria | 17174 |
| 522 | Ga0453683_0003653 | 3300044673 | Bacteria | 11274 |
| 523 | Ga0466965_0007028 | 3300044683 | Bacteria | 5151 |
| 524 | Ga0466966_0018603 | 3300044684 | Bacteria | 4578 |
| 525 | Ga0466961_0014170 | 3300044693 | Bacteria | 5116 |
| 526 | Ga0466961_0076262 | 3300044693 | Bacteria | 2125 |
| 527 | Ga0453684_0018472 | 3300044712 | Bacteria | 10699 |
| 528 | Ga0453684_0713528 | 3300044712 | Bacteria | 1089 |
| 529 | Ga0466971_0346123 | 3300044719 | Bacteria | 719 |
| 530 | Ga0466970_0201719 | 3300044765 | Bacteria | 1107 |
| 531 | Ga0466957_0151992 | 3300044842 | Bacteria | 1498 |
| 532 | Ga0466957_0257573 | 3300044842 | Bacteria | 1162 |
| 533 | Ga0466957_0262072 | 3300044842 | Bacteria | 1152 |
| 534 | Ga0466960_0469123 | 3300044901 | Bacteria | 734 |
| 535 | Ga0466959_0088349 | 3300045049 | Bacteria | 2228 |
| 536 | Ga0451576_0026738 | 3300045051 | Bacteria | 6203 |
| 537 | Ga0451576_0120857 | 3300045051 | Bacteria | 2727 |
| 538 | Ga0466967_0495772 | 3300045976 | Bacteria | 1198 |
| 539 | Ga0495627_016376 | 3300046453 | Bacteria | 2538 |
| 540 | Ga0495627_017833 | 3300046453 | Bacteria | 2404 |
| 541 | Ga0495629_0146988 | 3300046459 | Bacteria | 1639 |
| 542 | Ga0495638_0075820 | 3300046460 | Bacteria | 2049 |
| 543 | Ga0495639_0016063 | 3300046475 | Bacteria | 3247 |
| 544 | Ga0495616_0023910 | 3300046513 | Bacteria | 3283 |
| 545 | Ga0495620_0019241 | 3300046515 | Bacteria | 3363 |
| 546 | Ga0495631_0000927 | 3300046518 | Bacteria | 18232 |
| 547 | Ga0495632_0005292 | 3300046519 | Bacteria | 8572 |
| 548 | Ga0495637_0001152 | 3300046520 | Bacteria | 16212 |
| 549 | Ga0495637_0061649 | 3300046520 | Bacteria | 1537 |
| 550 | Ga0495643_0145643 | 3300046522 | Bacteria | 1177 |
| 551 | Ga0495642_0002659 | 3300046528 | Bacteria | 7190 |
| 552 | Ga0495642_0260407 | 3300046528 | Bacteria | 758 |
| 553 | Ga0495654_0001504 | 3300046530 | Bacteria | 15939 |
| 554 | Ga0495654_0044568 | 3300046530 | Bacteria | 2194 |
| 555 | Ga0495654_0096826 | 3300046530 | Bacteria | 1363 |
| 556 | Ga0495621_0031312 | 3300046539 | Bacteria | 1824 |
| 557 | Ga0495622_0033391 | 3300046557 | Bacteria | 2402 |
| 558 | Ga0495633_0001809 | 3300046558 | Bacteria | 15760 |
| 559 | Ga0495633_0156063 | 3300046558 | Bacteria | 1053 |
| 560 | Ga0495656_0002859 | 3300046615 | Bacteria | 5785 |
| 561 | Ga0495625_0000045 | 3300046660 | Bacteria | 202475 |
| 562 | Ga0495625_0041165 | 3300046660 | Bacteria | 3364 |
| 563 | Ga0495635_0132374 | 3300046663 | Bacteria | 1700 |
| 564 | Ga0495661_0087152 | 3300046665 | Bacteria | 1786 |
| 565 | Ga0495588_0009189 | 3300046674 | Bacteria | 4563 |
| 566 | Ga0495658_0012053 | 3300046683 | Bacteria | 4366 |
| 567 | Ga0495669_0111828 | 3300046684 | Bacteria | 1276 |
| 568 | Ga0495670_0048023 | 3300046691 | Bacteria | 2135 |
| 569 | Ga0495671_0010658 | 3300046692 | Bacteria | 5085 |
| 570 | Ga0495660_0326335 | 3300046810 | Bacteria | 688 |
| 571 | Ga0495674_0086548 | 3300047319 | Bacteria | 2683 |
| 572 | Ga0495676_0013815 | 3300047321 | Bacteria | 7239 |
| 573 | Ga0495677_0057140 | 3300047445 | Bacteria | 1442 |
| 574 | Ga0495677_0065683 | 3300047445 | Bacteria | 1349 |
| 575 | Ga0495685_031458 | 3300047447 | Bacteria | 1824 |
| 576 | Ga0495685_116524 | 3300047447 | Bacteria | 878 |
| 577 | Ga0495593_0012980 | 3300047673 | Bacteria | 4758 |
| 578 | Ga0495614_0049081 | 3300048089 | Bacteria | 1809 |
| 579 | Ga0495615_0007612 | 3300048090 | Bacteria | 2062 |
| 580 | Ga0495615_0018928 | 3300048090 | Bacteria | 1523 |
| 581 | Ga0495615_0086480 | 3300048090 | Bacteria | 867 |
| 582 | Ga0496100_0038094 | 3300048903 | Bacteria | 3044 |
| 583 | Ga0496101_0024578 | 3300048904 | Bacteria | 4170 |
| 584 | Ga0496102_0048128 | 3300048905 | Bacteria | 3876 |
| 585 | Ga0496103_0039550 | 3300048906 | Bacteria | 2898 |
| 586 | Ga0496104_0100676 | 3300048907 | Bacteria | 2766 |
| 587 | Ga0496105_0047749 | 3300048908 | Bacteria | 3533 |
| 588 | Ga0496106_0049724 | 3300048909 | Bacteria | 3159 |
| 589 | Ga0496106_0248819 | 3300048909 | Bacteria | 1421 |
| 590 | Ga0496107_0012575 | 3300048910 | Bacteria | 5911 |
| 591 | Ga0496110_0132482 | 3300048913 | Bacteria | 2251 |
| 592 | Ga0496110_0451658 | 3300048913 | Bacteria | 1171 |
| 593 | Ga0496111_0046348 | 3300048914 | Bacteria | 3130 |
| 594 | Ga0496114_0046024 | 3300048917 | Bacteria | 3625 |
| 595 | Ga0496116_0043465 | 3300048919 | Bacteria | 3061 |
| 596 | Ga0496116_0101509 | 3300048919 | Bacteria | 1717 |
| 597 | Ga0496117_0014880 | 3300048920 | Bacteria | 6673 |
| 598 | Ga0496117_0093107 | 3300048920 | Bacteria | 1934 |
| 599 | Ga0496117_0100631 | 3300048920 | Bacteria | 1830 |
| 600 | Ga0496117_0130005 | 3300048920 | Bacteria | 1528 |
| 601 | Ga0496118_0015707 | 3300048921 | Bacteria | 6991 |
| 602 | Ga0496118_0019070 | 3300048921 | Bacteria | 6148 |
| 603 | Ga0496118_0409245 | 3300048921 | Bacteria | 702 |
| 604 | Ga0496121_0049634 | 3300048924 | Bacteria | 3555 |
| 605 | Ga0496121_0056714 | 3300048924 | Bacteria | 3251 |
| 606 | Ga0496121_0143935 | 3300048924 | Bacteria | 1764 |
| 607 | Ga0496122_0000331 | 3300048925 | Bacteria | 102617 |
| 608 | Ga0496122_0088660 | 3300048925 | Bacteria | 2119 |
| 609 | Ga0496122_0093309 | 3300048925 | Bacteria | 2042 |
| 610 | Ga0496122_0162766 | 3300048925 | Bacteria | 1358 |
| 611 | Ga0496122_0355111 | 3300048925 | Bacteria | 763 |
| 612 | Ga0496123_0001132 | 3300048926 | Bacteria | 39831 |
| 613 | Ga0496123_0036698 | 3300048926 | Bacteria | 3471 |
| 614 | Ga0496123_0132987 | 3300048926 | Bacteria | 1374 |
| 615 | Ga0496123_0137343 | 3300048926 | Bacteria | 1343 |
| 616 | Ga0496124_0053987 | 3300048927 | Bacteria | 3403 |
| 617 | Ga0496124_0089765 | 3300048927 | Bacteria | 2508 |
| 618 | Ga0496124_0315773 | 3300048927 | Bacteria | 1121 |
| 619 | Ga0496124_0323394 | 3300048927 | Bacteria | 1103 |
| 620 | Ga0496124_0458238 | 3300048927 | Bacteria | 867 |
| 621 | Ga0496125_0001189 | 3300048928 | Bacteria | 39370 |
| 622 | Ga0496125_0024091 | 3300048928 | Bacteria | 5604 |
| 623 | Ga0496125_0046129 | 3300048928 | Bacteria | 3659 |
| 624 | Ga0496125_0085887 | 3300048928 | Bacteria | 2382 |
| 625 | Ga0496125_0214612 | 3300048928 | Bacteria | 1246 |
| 626 | Ga0496125_0292292 | 3300048928 | Bacteria | 1003 |
| 627 | Ga0496126_0001477 | 3300048929 | Bacteria | 36534 |
| 628 | Ga0496126_0057238 | 3300048929 | Bacteria | 3521 |
| 629 | Ga0496126_0443543 | 3300048929 | Bacteria | 1046 |
| 630 | Ga0496126_0940626 | 3300048929 | Bacteria | 652 |
| 631 | Ga0501034_0622574 | 3300049571 | Bacteria | 983 |
| 632 | Ga0501036_0218417 | 3300049572 | Bacteria | 1601 |
| 633 | Ga0501047_0057504 | 3300049581 | Bacteria | 3761 |
| 634 | Ga0501249_002182 | 3300049679 | Bacteria | 3988 |
| 635 | Ga0501225_0092914 | 3300049705 | Bacteria | 875 |
| 636 | Ga0501262_000434 | 3300049759 | Bacteria | 5015 |
| 637 | Ga0501266_034053 | 3300049763 | Bacteria | 737 |
| 638 | nmdc:mga03683_103713_c1 | 3300050489 | Bacteria | 1252 |
| 639 | nmdc:mga03683_151260_c1 | 3300050489 | Bacteria | 1047 |
| 640 | nmdc:mga03683_15696_c1 | 3300050489 | Bacteria | 2831 |
| 641 | nmdc:mga03683_183083_c1 | 3300050489 | Bacteria | 956 |
| 642 | nmdc:mga03683_235671_c1 | 3300050489 | Bacteria | 847 |
| 643 | nmdc:mga03683_52700_c1 | 3300050489 | Bacteria | 1701 |
| 644 | nmdc:mga03683_7472_c1 | 3300050489 | Bacteria | 3794 |
| 645 | nmdc:mga03n38_19715_c1 | 3300050490 | Bacteria | 2684 |
| 646 | nmdc:mga03n38_20085_c1 | 3300050490 | Bacteria | 2667 |
| 647 | nmdc:mga03n38_98848_c1 | 3300050490 | Bacteria | 1404 |
| 648 | nmdc:mga00v17_31009_c1 | 3300050491 | Bacteria | 3150 |
| 649 | nmdc:mga00v17_51844_c1 | 3300050491 | Bacteria | 2495 |
| 650 | nmdc:mga0yw44_38982_c1 | 3300050492 | Bacteria | 2814 |
| 651 | nmdc:mga0yw44_43614_c1 | 3300050492 | Bacteria | 2679 |
| 652 | nmdc:mga0k408_17127_c1 | 3300050493 | Bacteria | 4032 |
| 653 | nmdc:mga0k408_197950_c1 | 3300050493 | Bacteria | 1199 |
| 654 | nmdc:mga0k408_203247_c1 | 3300050493 | Bacteria | 1183 |
| 655 | nmdc:mga0k408_40803_c1 | 3300050493 | Bacteria | 2672 |
| 656 | nmdc:mga0k408_43251_c2 | 3300050493 | Bacteria | 703 |
| 657 | nmdc:mga0k408_506192_c1 | 3300050493 | Bacteria | 715 |
| 658 | nmdc:mga0k408_52414_c1 | 3300050493 | Bacteria | 2365 |
| 659 | nmdc:mga0k408_59892_c1 | 3300050493 | Bacteria | 2212 |
| 660 | nmdc:mga07m45_158071_c1 | 3300050496 | Bacteria | 1315 |
| 661 | nmdc:mga07m45_161406_c1 | 3300050496 | Bacteria | 1301 |
| 662 | nmdc:mga07m45_21021_c1 | 3300050496 | Bacteria | 3063 |
| 663 | nmdc:mga07m45_30257_c1 | 3300050496 | Bacteria | 2998 |
| 664 | nmdc:mga07m45_53694_c1 | 3300050496 | Bacteria | 2277 |
| 665 | nmdc:mga07m45_59868_c1 | 3300050496 | Bacteria | 2155 |
| 666 | nmdc:mga09592_20553_c1 | 3300050508 | Bacteria | 5431 |
| 667 | nmdc:mga0qj67_153805_c1 | 3300050509 | Bacteria | 1866 |
| 668 | nmdc:mga0sz30_39319_c1 | 3300050516 | Bacteria | 1984 |
| 669 | Ga0500610_0001980 | 3300053079 | Bacteria | 7301 |
| 670 | Ga0500610_0006936 | 3300053079 | Bacteria | 4802 |
| 671 | Ga0500578_0000025 | 3300053086 | Bacteria | 151485 |
| 672 | Ga0500646_0019599 | 3300053090 | Bacteria | 1790 |
| 673 | Ga0500651_0000112 | 3300053093 | Bacteria | 49988 |
| 674 | Ga0500651_0013143 | 3300053093 | Bacteria | 5034 |
| 675 | Ga0500651_0062947 | 3300053093 | Bacteria | 2316 |
| 676 | Ga0500566_0186619 | 3300053094 | Bacteria | 1059 |
| 677 | Ga0500641_0087128 | 3300053096 | Bacteria | 1330 |
| 678 | Ga0500569_071464 | 3300053109 | Bacteria | 1093 |
| 679 | Ga0500571_027167 | 3300053110 | Bacteria | 3165 |
| 680 | Ga0500572_098750 | 3300053111 | Bacteria | 932 |
| 681 | Ga0500593_003265 | 3300053117 | Bacteria | 6104 |
| 682 | Ga0500593_006316 | 3300053117 | Bacteria | 4735 |
| 683 | Ga0500626_063714 | 3300053128 | Bacteria | 1647 |
| 684 | Ga0500628_061466 | 3300053129 | Bacteria | 918 |
| 685 | Ga0500628_125924 | 3300053129 | Bacteria | 699 |
| 686 | Ga0500652_000177 | 3300053131 | Bacteria | 24784 |
| 687 | Ga0500655_000471 | 3300053133 | Bacteria | 8190 |
| 688 | Ga0500658_0001561 | 3300053134 | Bacteria | 9140 |
| 689 | Ga0500658_0001686 | 3300053134 | Bacteria | 8759 |
| 690 | Ga0500559_0012676 | 3300053136 | Bacteria | 3578 |
| 691 | Ga0500559_0105712 | 3300053136 | Bacteria | 1301 |
| 692 | Ga0500568_0002695 | 3300053139 | Bacteria | 10296 |
| 693 | Ga0500568_0153622 | 3300053139 | Bacteria | 851 |
| 694 | Ga0500622_0000087 | 3300053156 | Bacteria | 98385 |
| 695 | Ga0500622_0067097 | 3300053156 | Bacteria | 1820 |
| 696 | Ga0500634_0055091 | 3300053161 | Bacteria | 2129 |
| 697 | Ga0500638_000683 | 3300053162 | Bacteria | 8972 |
| 698 | Ga0500625_081534 | 3300053729 | Bacteria | 1411 |
| 699 | Ga0500645_000661 | 3300053730 | Bacteria | 21613 |
| 700 | Ga0500645_031433 | 3300053730 | Bacteria | 1595 |
| 701 | Ga0500661_001056 | 3300055283 | Bacteria | 5200 |
| 702 | Ga0590075_014569 | 3300059424 | Bacteria | 1923 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005437 | Ga0070710_10191055 | Ga0070710_101910552 | 186 |
| 2 | 3300047319 | Ga0495674_0086548 | Ga0495674_0086548_544_1149 | 186 |
| 3 | 3300005364 | Ga0070673_100368749 | Ga0070673_1003687492 | 188 |
| 4 | 3300005543 | Ga0070672_100105050 | Ga0070672_1001050503 | 188 |
| 5 | 3300025893 | Ga0207682_10081227 | Ga0207682_100812272 | 188 |
| 6 | 3300025923 | Ga0207681_10263225 | Ga0207681_102632251 | 188 |
| 7 | 3300025940 | Ga0207691_10225673 | Ga0207691_102256732 | 188 |
| 8 | 3300025972 | Ga0207668_10302357 | Ga0207668_103023572 | 188 |
| 9 | 3300041512 | Ga0451853_1882879 | Ga0451853_1882879_40_705 | 188 |
| 10 | 3300005262 | Ga0065165_1001775 | Ga0065165_100177522 | 189 |
| 11 | 3300048910 | Ga0496107_0012575 | Ga0496107_0012575_202_780 | 189 |
| 12 | iso_pu_bacteria | 2547132374 | 2548498969 | 189 |
| 13 | iso_pu_bacteria | 2585428057 | 2587725541 | 189 |
| 14 | iso_pu_bacteria | 2643221570 | 2643867813 | 189 |
| 15 | iso_pu_bacteria | 2643221592 | 2643970056 | 189 |
| 16 | iso_pu_bacteria | 2643221596 | 2643991677 | 189 |
| 17 | iso_pu_bacteria | 2643221625 | 2644142970 | 189 |
| 18 | iso_pu_bacteria | 2643221648 | 2644271970 | 189 |
| 19 | iso_pu_bacteria | 2643221717 | 2644648428 | 189 |
| 20 | iso_pu_bacteria | 2721755523 | 2722882029 | 189 |
| 21 | iso_pu_bacteria | 2839138175 | 2839142538 | 189 |
| 22 | iso_pu_bacteria | 2932422444 | 2932426391 | 189 |
| 23 | iso_pu_bacteria | 2990710928 | 2990713877 | 189 |
| 24 | 3300006048 | Ga0075363_100086618 | Ga0075363_1000866183 | 190 |
| 25 | 3300006177 | Ga0075362_10048721 | Ga0075362_100487212 | 190 |
| 26 | 3300002773 | JGI25152J39213_1000516 | JGI25152J39213_100051620 | 191 |
| 27 | 3300002774 | JGI25150J39212_1009352 | JGI25150J39212_10093522 | 191 |
| 28 | 3300003215 | JGI25153J46596_10003174 | JGI25153J46596_100031743 | 191 |
| 29 | 3300003771 | Ga0055526_1002127 | Ga0055526_100212711 | 191 |
| 30 | 3300005344 | Ga0070661_100162841 | Ga0070661_1001628412 | 191 |
| 31 | 3300025245 | Ga0207425_1001221 | Ga0207425_10012214 | 191 |
| 32 | 3300025258 | Ga0209129_1000294 | Ga0209129_100029445 | 191 |
| 33 | 3300025273 | Ga0209673_1032115 | Ga0209673_10321152 | 191 |
| 34 | 3300025295 | Ga0209564_1000300 | Ga0209564_100030063 | 191 |
| 35 | 3300025297 | Ga0209758_1000605 | Ga0209758_100060544 | 191 |
| 36 | 3300031548 | Ga0307408_100000101 | Ga0307408_10000010146 | 191 |
| 37 | 3300031901 | Ga0307406_10000497 | Ga0307406_1000049721 | 191 |
| 38 | 3300032005 | Ga0307411_10062461 | Ga0307411_100624613 | 191 |
| 39 | 3300046528 | Ga0495642_0002659 | Ga0495642_0002659_4938_5546 | 191 |
| 40 | 3300046558 | Ga0495633_0156063 | Ga0495633_0156063_265_873 | 191 |
| 41 | 3300046665 | Ga0495661_0087152 | Ga0495661_0087152_250_858 | 191 |
| 42 | 3300047445 | Ga0495677_0057140 | Ga0495677_0057140_404_1012 | 191 |
| 43 | 3300047447 | Ga0495685_031458 | Ga0495685_031458_1199_1807 | 191 |
| 44 | 3300048909 | Ga0496106_0248819 | Ga0496106_0248819_397_1005 | 191 |
| 45 | 3300050489 | nmdc:mga03683_183083_c1 | nmdc:mga03683_183083_c1_52_672 | 191 |
| 46 | 3300003791 | Ga0055530_10003781 | Ga0055530_100037815 | 192 |
| 47 | 3300003792 | Ga0055540_1000260 | Ga0055540_100026025 | 192 |
| 48 | 3300003792 | Ga0055540_1006805 | Ga0055540_10068053 | 192 |
| 49 | 3300003794 | Ga0055531_10001090 | Ga0055531_1000109020 | 192 |
| 50 | 3300003794 | Ga0055531_10006230 | Ga0055531_100062307 | 192 |
| 51 | 3300006195 | Ga0075366_10140381 | Ga0075366_101403812 | 192 |
| 52 | 3300006353 | Ga0075370_10000282 | Ga0075370_1000028214 | 192 |
| 53 | 3300021361 | Ga0213872_10004249 | Ga0213872_100042497 | 192 |
| 54 | 3300025273 | Ga0209673_1020479 | Ga0209673_10204792 | 192 |
| 55 | 3300025298 | Ga0209050_1003829 | Ga0209050_100382913 | 192 |
| 56 | 3300025303 | Ga0209051_1000247 | Ga0209051_100024725 | 192 |
| 57 | 3300025303 | Ga0209051_1000456 | Ga0209051_10004563 | 192 |
| 58 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015837 | 192 |
| 59 | 3300025304 | Ga0209257_1000141 | Ga0209257_100014125 | 192 |
| 60 | 3300027717 | Ga0209998_10012096 | Ga0209998_100120962 | 192 |
| 61 | 3300028794 | Ga0307515_10000257 | Ga0307515_1000025743 | 192 |
| 62 | 3300031456 | Ga0307513_10004582 | Ga0307513_1000458211 | 192 |
| 63 | 3300031649 | Ga0307514_10000928 | Ga0307514_1000092811 | 192 |
| 64 | 3300031730 | Ga0307516_10063255 | Ga0307516_100632554 | 192 |
| 65 | 3300039447 | Ga0436361_0247854 | Ga0436361_0247854_18129_18773 | 192 |
| 66 | 3300044656 | Ga0466969_0049594 | Ga0466969_0049594_358_972 | 192 |
| 67 | 3300044693 | Ga0466961_0076262 | Ga0466961_0076262_357_971 | 192 |
| 68 | 3300044842 | Ga0466957_0151992 | Ga0466957_0151992_270_887 | 192 |
| 69 | 3300048929 | Ga0496126_0940626 | Ga0496126_0940626_28_636 | 192 |
| 70 | 3300050493 | nmdc:mga0k408_506192_c1 | nmdc:mga0k408_506192_c1_17_625 | 192 |
| 71 | 3300003775 | Ga0055524_1000247 | Ga0055524_100024729 | 193 |
| 72 | 3300005327 | Ga0070658_10629042 | Ga0070658_106290421 | 193 |
| 73 | 3300005338 | Ga0068868_100338173 | Ga0068868_1003381732 | 193 |
| 74 | 3300005338 | Ga0068868_100974123 | Ga0068868_1009741231 | 193 |
| 75 | 3300005344 | Ga0070661_100000361 | Ga0070661_1000003614 | 193 |
| 76 | 3300005366 | Ga0070659_100002940 | Ga0070659_1000029408 | 193 |
| 77 | 3300005563 | Ga0068855_100610875 | Ga0068855_1006108752 | 193 |
| 78 | 3300005564 | Ga0070664_100012768 | Ga0070664_1000127688 | 193 |
| 79 | 3300005578 | Ga0068854_101000924 | Ga0068854_1010009241 | 193 |
| 80 | 3300006195 | Ga0075366_10009278 | Ga0075366_100092785 | 193 |
| 81 | 3300006195 | Ga0075366_10017692 | Ga0075366_100176922 | 193 |
| 82 | 3300006880 | Ga0075429_100488514 | Ga0075429_1004885142 | 193 |
| 83 | 3300006946 | Ga0079104_1000055 | Ga0079104_100005585 | 193 |
| 84 | 3300006946 | Ga0079104_1000714 | Ga0079104_10007143 | 193 |
| 85 | 3300009092 | Ga0105250_10000934 | Ga0105250_100009345 | 193 |
| 86 | 3300009093 | Ga0105240_10651654 | Ga0105240_106516542 | 193 |
| 87 | 3300009098 | Ga0105245_10197255 | Ga0105245_101972552 | 193 |
| 88 | 3300009148 | Ga0105243_10003653 | Ga0105243_100036538 | 193 |
| 89 | 3300009174 | Ga0105241_10056465 | Ga0105241_100564653 | 193 |
| 90 | 3300013296 | Ga0157374_10103917 | Ga0157374_101039173 | 193 |
| 91 | 3300014969 | Ga0157376_10002202 | Ga0157376_100022023 | 193 |
| 92 | 3300025299 | Ga0209256_1000049 | Ga0209256_100004945 | 193 |
| 93 | 3300025711 | Ga0207696_1002314 | Ga0207696_10023149 | 193 |
| 94 | 3300025920 | Ga0207649_10000335 | Ga0207649_1000033529 | 193 |
| 95 | 3300025932 | Ga0207690_10000176 | Ga0207690_1000017638 | 193 |
| 96 | 3300025935 | Ga0207709_10000728 | Ga0207709_1000072813 | 193 |
| 97 | 3300025945 | Ga0207679_10000168 | Ga0207679_1000016824 | 193 |
| 98 | 3300025949 | Ga0207667_10210076 | Ga0207667_102100764 | 193 |
| 99 | 3300025949 | Ga0207667_10474508 | Ga0207667_104745082 | 193 |
| 100 | 3300026023 | Ga0207677_10112838 | Ga0207677_101128383 | 193 |
| 101 | 3300026023 | Ga0207677_10445882 | Ga0207677_104458822 | 193 |
| 102 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007744 | 193 |
| 103 | 3300027111 | Ga0209281_1001190 | Ga0209281_10011902 | 193 |
| 104 | 3300027614 | Ga0209970_1000068 | Ga0209970_100006812 | 193 |
| 105 | 3300027682 | Ga0209971_1002743 | Ga0209971_10027433 | 193 |
| 106 | 3300027876 | Ga0209974_10025576 | Ga0209974_100255763 | 193 |
| 107 | 3300031235 | Ga0265330_10000046 | Ga0265330_1000004650 | 193 |
| 108 | 3300031238 | Ga0265332_10000028 | Ga0265332_1000002862 | 193 |
| 109 | 3300031240 | Ga0265320_10079453 | Ga0265320_100794531 | 193 |
| 110 | 3300031241 | Ga0265325_10001397 | Ga0265325_1000139713 | 193 |
| 111 | 3300031247 | Ga0265340_10037610 | Ga0265340_100376102 | 193 |
| 112 | 3300031548 | Ga0307408_100650033 | Ga0307408_1006500331 | 193 |
| 113 | 3300031711 | Ga0265314_10000054 | Ga0265314_1000005462 | 193 |
| 114 | 3300031911 | Ga0307412_10293715 | Ga0307412_102937152 | 193 |
| 115 | 3300032002 | Ga0307416_100216767 | Ga0307416_1002167672 | 193 |
| 116 | 3300037466 | Ga0395898_0023156 | Ga0395898_0023156_4048_4671 | 193 |
| 117 | 3300037471 | Ga0395905_0004023 | Ga0395905_0004023_2178_2810 | 193 |
| 118 | 3300037471 | Ga0395905_0099475 | Ga0395905_0099475_564_1172 | 193 |
| 119 | 3300037471 | Ga0395905_0134600 | Ga0395905_0134600_599_1222 | 193 |
| 120 | 3300038443 | Ga0395901_0141343 | Ga0395901_0141343_1265_1891 | 193 |
| 121 | 3300038443 | Ga0395901_0161929 | Ga0395901_0161929_144_752 | 193 |
| 122 | 3300041486 | Ga0451807_0729911 | Ga0451807_0729911_180_788 | 193 |
| 123 | 3300042000 | Ga0439437_008399 | Ga0439437_008399_245_853 | 193 |
| 124 | 3300042000 | Ga0439437_011307 | Ga0439437_011307_26_634 | 193 |
| 125 | 3300042004 | Ga0439445_0020134 | Ga0439445_0020134_540_1175 | 193 |
| 126 | 3300042015 | Ga0439462_0004564 | Ga0439462_0004564_2441_3058 | 193 |
| 127 | 3300042016 | Ga0439463_097418 | Ga0439463_097418_61_693 | 193 |
| 128 | 3300042115 | Ga0450911_000351 | Ga0450911_000351_11017_11652 | 193 |
| 129 | 3300042125 | Ga0450923_007069 | Ga0450923_007069_162_779 | 193 |
| 130 | 3300042125 | Ga0450923_025754 | Ga0450923_025754_272_880 | 193 |
| 131 | 3300042126 | Ga0450888_006212 | Ga0450888_006212_125_733 | 193 |
| 132 | 3300042127 | Ga0450890_006779 | Ga0450890_006779_189_797 | 193 |
| 133 | 3300042134 | Ga0450898_004060 | Ga0450898_004060_196_804 | 193 |
| 134 | 3300042134 | Ga0450898_004975 | Ga0450898_004975_272_919 | 193 |
| 135 | 3300042435 | Ga0439434_0120115 | Ga0439434_0120115_65_682 | 193 |
| 136 | 3300042439 | Ga0439464_0054046 | Ga0439464_0054046_293_901 | 193 |
| 137 | 3300042531 | Ga0450918_000077 | Ga0450918_000077_19783_20400 | 193 |
| 138 | 3300044673 | Ga0453683_0001887 | Ga0453683_0001887_3294_3902 | 193 |
| 139 | 3300044712 | Ga0453684_0713528 | Ga0453684_0713528_394_1002 | 193 |
| 140 | 3300044842 | Ga0466957_0262072 | Ga0466957_0262072_395_1003 | 193 |
| 141 | 3300046519 | Ga0495632_0005292 | Ga0495632_0005292_7872_8510 | 193 |
| 142 | 3300046530 | Ga0495654_0001504 | Ga0495654_0001504_933_1604 | 193 |
| 143 | 3300046558 | Ga0495633_0001809 | Ga0495633_0001809_13914_14522 | 193 |
| 144 | 3300048090 | Ga0495615_0007612 | Ga0495615_0007612_492_1100 | 193 |
| 145 | 3300048917 | Ga0496114_0046024 | Ga0496114_0046024_753_1397 | 193 |
| 146 | 3300048924 | Ga0496121_0056714 | Ga0496121_0056714_120_749 | 193 |
| 147 | 3300048926 | Ga0496123_0137343 | Ga0496123_0137343_415_1023 | 193 |
| 148 | 3300048927 | Ga0496124_0053987 | Ga0496124_0053987_1203_1838 | 193 |
| 149 | 3300048928 | Ga0496125_0024091 | Ga0496125_0024091_2123_2752 | 193 |
| 150 | 3300048929 | Ga0496126_0057238 | Ga0496126_0057238_1174_1836 | 193 |
| 151 | 3300049572 | Ga0501036_0218417 | Ga0501036_0218417_762_1379 | 193 |
| 152 | 3300050489 | nmdc:mga03683_151260_c1 | nmdc:mga03683_151260_c1_363_971 | 193 |
| 153 | 3300050492 | nmdc:mga0yw44_38982_c1 | nmdc:mga0yw44_38982_c1_606_1214 | 193 |
| 154 | 3300050493 | nmdc:mga0k408_17127_c1 | nmdc:mga0k408_17127_c1_1309_1956 | 193 |
| 155 | 3300050493 | nmdc:mga0k408_59892_c1 | nmdc:mga0k408_59892_c1_948_1556 | 193 |
| 156 | 3300050496 | nmdc:mga07m45_158071_c1 | nmdc:mga07m45_158071_c1_582_1190 | 193 |
| 157 | 3300053086 | Ga0500578_0000025 | Ga0500578_0000025_50946_51575 | 193 |
| 158 | 3300053117 | Ga0500593_006316 | Ga0500593_006316_79_681 | 193 |
| 159 | 3300053161 | Ga0500634_0055091 | Ga0500634_0055091_343_951 | 193 |
| 160 | 3300059424 | Ga0590075_014569 | Ga0590075_014569_770_1387 | 193 |
| 161 | iso_pu_bacteria | 2511231002 | 2511242748 | 193 |
| 162 | iso_pu_bacteria | 2513020051 | 2513229625 | 193 |
| 163 | iso_pu_bacteria | 2599185214 | 2599627984 | 193 |
| 164 | iso_pu_bacteria | 2599185226 | 2599677795 | 193 |
| 165 | iso_pu_bacteria | 2599185227 | 2599685613 | 193 |
| 166 | iso_pu_bacteria | 2599185229 | 2599697466 | 193 |
| 167 | iso_pu_bacteria | 2643221611 | 2644071330 | 193 |
| 168 | iso_pu_bacteria | 2643221658 | 2644325770 | 193 |
| 169 | iso_pu_bacteria | 2643221660 | 2644338569 | 193 |
| 170 | iso_pu_bacteria | 2643221672 | 2644399692 | 193 |
| 171 | iso_pu_bacteria | 2643221683 | 2644465196 | 193 |
| 172 | iso_pu_bacteria | 2738541277 | 2738723983 | 193 |
| 173 | iso_pu_bacteria | 2738541307 | 2738880601 | 193 |
| 174 | iso_pu_bacteria | 2738543012 | 2739246482 | 193 |
| 175 | iso_pu_bacteria | 2738543013 | 2739247884 | 193 |
| 176 | iso_pu_bacteria | 2738543019 | 2739284668 | 193 |
| 177 | iso_pu_bacteria | 2816332133 | 2816476336 | 193 |
| 178 | iso_pu_bacteria | 2818991446 | 2819602816 | 193 |
| 179 | iso_pu_bacteria | 2831265667 | 2831268109 | 193 |
| 180 | iso_pu_bacteria | 2838054893 | 2838059151 | 193 |
| 181 | iso_pu_bacteria | 2842677519 | 2842679734 | 193 |
| 182 | iso_pu_bacteria | 2842718218 | 2842718774 | 193 |
| 183 | iso_pu_bacteria | 2842747753 | 2842752553 | 193 |
| 184 | iso_pu_bacteria | 2881101125 | 2881102648 | 193 |
| 185 | iso_pu_bacteria | 2885192300 | 2885193036 | 193 |
| 186 | iso_pu_bacteria | 2885198086 | 2885203114 | 193 |
| 187 | iso_pu_bacteria | 2885211737 | 2885216489 | 193 |
| 188 | iso_pu_bacteria | 2899924645 | 2899928048 | 193 |
| 189 | iso_pu_bacteria | 2904449895 | 2904452536 | 193 |
| 190 | iso_pu_bacteria | 2904456579 | 2904460865 | 193 |
| 191 | iso_pu_bacteria | 2904541872 | 2904545250 | 193 |
| 192 | iso_pu_bacteria | 2919462493 | 2919463834 | 193 |
| 193 | iso_pu_bacteria | 2928037797 | 2928041052 | 193 |
| 194 | iso_pu_bacteria | 2928044640 | 2928047894 | 193 |
| 195 | iso_pu_bacteria | 2928051484 | 2928055789 | 193 |
| 196 | iso_pu_bacteria | 2928064002 | 2928066737 | 193 |
| 197 | iso_pu_bacteria | 2928070936 | 2928075253 | 193 |
| 198 | iso_pu_bacteria | 2928084124 | 2928088586 | 193 |
| 199 | iso_pu_bacteria | 2928115317 | 2928117299 | 193 |
| 200 | iso_pu_bacteria | 2929160207 | 2929165442 | 193 |
| 201 | iso_pu_bacteria | 2929520902 | 2929522831 | 193 |
| 202 | iso_pu_bacteria | 2939631187 | 2939632132 | 193 |
| 203 | iso_pu_bacteria | 2954767861 | 2954768981 | 193 |
| 204 | iso_pu_bacteria | 2974320154 | 2974320342 | 193 |
| 205 | 3300002987 | JGI25159J45721_1000345 | JGI25159J45721_100034515 | 194 |
| 206 | 3300003354 | JGI25160J50197_1000129 | JGI25160J50197_100012941 | 194 |
| 207 | 3300003374 | JGI25161J50226_1000080 | JGI25161J50226_100008060 | 194 |
| 208 | 3300004625 | Ga0055543_1000202 | Ga0055543_100020260 | 194 |
| 209 | 3300005262 | Ga0065165_1050712 | Ga0065165_10507122 | 194 |
| 210 | 3300025284 | Ga0209130_1000095 | Ga0209130_100009596 | 194 |
| 211 | 3300025297 | Ga0209758_1047085 | Ga0209758_10470853 | 194 |
| 212 | 3300025298 | Ga0209050_1003801 | Ga0209050_100380111 | 194 |
| 213 | 3300025302 | Ga0207426_1000397 | Ga0207426_100039762 | 194 |
| 214 | 3300031238 | Ga0265332_10000005 | Ga0265332_10000005211 | 194 |
| 215 | 3300037312 | Ga0395899_0006932 | Ga0395899_0006932_8063_8701 | 194 |
| 216 | 3300037418 | Ga0395900_0032376 | Ga0395900_0032376_4396_5034 | 194 |
| 217 | 3300037466 | Ga0395898_0035122 | Ga0395898_0035122_4168_4806 | 194 |
| 218 | 3300037471 | Ga0395905_0000212 | Ga0395905_0000212_55131_55754 | 194 |
| 219 | 3300037471 | Ga0395905_0665289 | Ga0395905_0665289_121_759 | 194 |
| 220 | 3300038443 | Ga0395901_0133122 | Ga0395901_0133122_472_1110 | 194 |
| 221 | 3300041460 | Ga0451802_0579892 | Ga0451802_0579892_164_793 | 194 |
| 222 | 3300042001 | Ga0439441_039044 | Ga0439441_039044_246_884 | 194 |
| 223 | 3300042007 | Ga0439449_0080899 | Ga0439449_0080899_15_650 | 194 |
| 224 | 3300042015 | Ga0439462_0079854 | Ga0439462_0079854_173_808 | 194 |
| 225 | 3300042015 | Ga0439462_0092446 | Ga0439462_0092446_15_662 | 194 |
| 226 | 3300044656 | Ga0466969_0017993 | Ga0466969_0017993_130_765 | 194 |
| 227 | 3300044684 | Ga0466966_0018603 | Ga0466966_0018603_3763_4398 | 194 |
| 228 | 3300044693 | Ga0466961_0014170 | Ga0466961_0014170_1717_2352 | 194 |
| 229 | 3300044765 | Ga0466970_0201719 | Ga0466970_0201719_303_941 | 194 |
| 230 | 3300044842 | Ga0466957_0257573 | Ga0466957_0257573_21_632 | 194 |
| 231 | 3300045049 | Ga0466959_0088349 | Ga0466959_0088349_227_862 | 194 |
| 232 | 3300048913 | Ga0496110_0451658 | Ga0496110_0451658_190_840 | 194 |
| 233 | 3300049763 | Ga0501266_034053 | Ga0501266_034053_78_686 | 194 |
| 234 | 3300050490 | nmdc:mga03n38_98848_c1 | nmdc:mga03n38_98848_c1_451_1089 | 194 |
| 235 | 3300053136 | Ga0500559_0105712 | Ga0500559_0105712_174_812 | 194 |
| 236 | 3300003215 | JGI25153J46596_10002374 | JGI25153J46596_100023743 | 195 |
| 237 | 3300005353 | Ga0070669_100032646 | Ga0070669_1000326465 | 195 |
| 238 | 3300005364 | Ga0070673_100397158 | Ga0070673_1003971582 | 195 |
| 239 | 3300005456 | Ga0070678_100602417 | Ga0070678_1006024172 | 195 |
| 240 | 3300005457 | Ga0070662_100001973 | Ga0070662_10000197311 | 195 |
| 241 | 3300005616 | Ga0068852_100229803 | Ga0068852_1002298034 | 195 |
| 242 | 3300005844 | Ga0068862_100011728 | Ga0068862_1000117282 | 195 |
| 243 | 3300006353 | Ga0075370_10028661 | Ga0075370_100286614 | 195 |
| 244 | 3300009176 | Ga0105242_10002298 | Ga0105242_100022984 | 195 |
| 245 | 3300013104 | Ga0157370_10003589 | Ga0157370_100035892 | 195 |
| 246 | 3300014497 | Ga0182008_10049350 | Ga0182008_100493503 | 195 |
| 247 | 3300017792 | Ga0163161_10101536 | Ga0163161_101015361 | 195 |
| 248 | 3300025297 | Ga0209758_1000453 | Ga0209758_100045358 | 195 |
| 249 | 3300025923 | Ga0207681_10011235 | Ga0207681_100112353 | 195 |
| 250 | 3300025933 | Ga0207706_10005101 | Ga0207706_100051019 | 195 |
| 251 | 3300025934 | Ga0207686_10011578 | Ga0207686_100115784 | 195 |
| 252 | 3300026121 | Ga0207683_10372091 | Ga0207683_103720912 | 195 |
| 253 | 3300026142 | Ga0207698_10173197 | Ga0207698_101731972 | 195 |
| 254 | 3300027907 | Ga0207428_10472031 | Ga0207428_104720312 | 195 |
| 255 | 3300028380 | Ga0268265_10045754 | Ga0268265_100457542 | 195 |
| 256 | 3300037471 | Ga0395905_0000607 | Ga0395905_0000607_46604_47275 | 195 |
| 257 | 3300037471 | Ga0395905_0392916 | Ga0395905_0392916_555_1199 | 195 |
| 258 | 3300041405 | Ga0439438_022578 | Ga0439438_022578_222_854 | 195 |
| 259 | 3300044658 | Ga0466972_0059783 | Ga0466972_0059783_726_1373 | 195 |
| 260 | 3300044683 | Ga0466965_0007028 | Ga0466965_0007028_4326_4973 | 195 |
| 261 | 3300044719 | Ga0466971_0346123 | Ga0466971_0346123_36_683 | 195 |
| 262 | 3300046530 | Ga0495654_0096826 | Ga0495654_0096826_248_886 | 195 |
| 263 | 3300048919 | Ga0496116_0043465 | Ga0496116_0043465_144_779 | 195 |
| 264 | 3300048925 | Ga0496122_0000331 | Ga0496122_0000331_67939_68577 | 195 |
| 265 | 3300048926 | Ga0496123_0001132 | Ga0496123_0001132_34942_35580 | 195 |
| 266 | 3300048929 | Ga0496126_0443543 | Ga0496126_0443543_141_776 | 195 |
| 267 | 3300050493 | nmdc:mga0k408_203247_c1 | nmdc:mga0k408_203247_c1_496_1095 | 195 |
| 268 | 3300050496 | nmdc:mga07m45_161406_c1 | nmdc:mga07m45_161406_c1_91_723 | 195 |
| 269 | 3300050496 | nmdc:mga07m45_21021_c1 | nmdc:mga07m45_21021_c1_2205_2861 | 195 |
| 270 | 3300053156 | Ga0500622_0067097 | Ga0500622_0067097_1005_1652 | 195 |
| 271 | 3300006177 | Ga0075362_10209693 | Ga0075362_102096932 | 196 |
| 272 | 3300014497 | Ga0182008_10003005 | Ga0182008_1000300511 | 196 |
| 273 | 3300025303 | Ga0209051_1086562 | Ga0209051_10865622 | 196 |
| 274 | 3300031852 | Ga0307410_10185345 | Ga0307410_101853453 | 196 |
| 275 | 3300031911 | Ga0307412_10260067 | Ga0307412_102600672 | 196 |
| 276 | 3300031911 | Ga0307412_10465026 | Ga0307412_104650262 | 196 |
| 277 | 3300032005 | Ga0307411_11033111 | Ga0307411_110331111 | 196 |
| 278 | 3300037418 | Ga0395900_0036214 | Ga0395900_0036214_477_1109 | 196 |
| 279 | 3300037471 | Ga0395905_0493229 | Ga0395905_0493229_370_987 | 196 |
| 280 | 3300041406 | Ga0439439_0008098 | Ga0439439_0008098_675_1307 | 196 |
| 281 | 3300041456 | Ga0451795_0584715 | Ga0451795_0584715_1035_1673 | 196 |
| 282 | 3300042007 | Ga0439449_0002248 | Ga0439449_0002248_3199_3831 | 196 |
| 283 | 3300042131 | Ga0450894_010502 | Ga0450894_010502_469_1101 | 196 |
| 284 | 3300045976 | Ga0466967_0495772 | Ga0466967_0495772_521_1153 | 196 |
| 285 | 3300046460 | Ga0495638_0075820 | Ga0495638_0075820_1336_1974 | 196 |
| 286 | 3300049571 | Ga0501034_0622574 | Ga0501034_0622574_312_950 | 196 |
| 287 | 3300049581 | Ga0501047_0057504 | Ga0501047_0057504_1335_1970 | 196 |
| 288 | 3300050489 | nmdc:mga03683_235671_c1 | nmdc:mga03683_235671_c1_91_765 | 196 |
| 289 | 3300053090 | Ga0500646_0019599 | Ga0500646_0019599_1099_1737 | 196 |
| 290 | 3300053093 | Ga0500651_0013143 | Ga0500651_0013143_3707_4345 | 196 |
| 291 | 3300053093 | Ga0500651_0062947 | Ga0500651_0062947_1297_1914 | 196 |
| 292 | 3300053109 | Ga0500569_071464 | Ga0500569_071464_87_725 | 196 |
| 293 | 3300053129 | Ga0500628_125924 | Ga0500628_125924_13_651 | 196 |
| 294 | 3300053131 | Ga0500652_000177 | Ga0500652_000177_4377_5015 | 196 |
| 295 | 3300053156 | Ga0500622_0000087 | Ga0500622_0000087_93452_94090 | 196 |
| 296 | 3300001979 | JGI24740J21852_10009214 | JGI24740J21852_100092144 | 197 |
| 297 | 3300001979 | JGI24740J21852_10009701 | JGI24740J21852_100097015 | 197 |
| 298 | 3300002704 | JGI25155J39150_1000102 | JGI25155J39150_100010227 | 197 |
| 299 | 3300002705 | JGI25156J39149_1000010 | JGI25156J39149_1000010147 | 197 |
| 300 | 3300002738 | JGI25154J39366_1000027 | JGI25154J39366_1000027147 | 197 |
| 301 | 3300002739 | JGI25158J39367_1006527 | JGI25158J39367_10065273 | 197 |
| 302 | 3300002741 | JGI25157J39369_1000146 | JGI25157J39369_100014641 | 197 |
| 303 | 3300002773 | JGI25152J39213_1010222 | JGI25152J39213_10102222 | 197 |
| 304 | 3300002773 | JGI25152J39213_1011717 | JGI25152J39213_10117173 | 197 |
| 305 | 3300002774 | JGI25150J39212_1003244 | JGI25150J39212_10032442 | 197 |
| 306 | 3300002774 | JGI25150J39212_1007486 | JGI25150J39212_10074862 | 197 |
| 307 | 3300002774 | JGI25150J39212_1010392 | JGI25150J39212_10103923 | 197 |
| 308 | 3300002987 | JGI25159J45721_1001064 | JGI25159J45721_10010648 | 197 |
| 309 | 3300002987 | JGI25159J45721_1012661 | JGI25159J45721_10126613 | 197 |
| 310 | 3300002987 | JGI25159J45721_1013590 | JGI25159J45721_10135902 | 197 |
| 311 | 3300003187 | JGI25151J46595_10010095 | JGI25151J46595_100100955 | 197 |
| 312 | 3300003187 | JGI25151J46595_10019873 | JGI25151J46595_100198734 | 197 |
| 313 | 3300003187 | JGI25151J46595_10029663 | JGI25151J46595_100296634 | 197 |
| 314 | 3300003187 | JGI25151J46595_10033026 | JGI25151J46595_100330262 | 197 |
| 315 | 3300003187 | JGI25151J46595_10033391 | JGI25151J46595_100333913 | 197 |
| 316 | 3300003215 | JGI25153J46596_10027356 | JGI25153J46596_100273562 | 197 |
| 317 | 3300003354 | JGI25160J50197_1017895 | JGI25160J50197_10178952 | 197 |
| 318 | 3300003354 | JGI25160J50197_1020407 | JGI25160J50197_10204072 | 197 |
| 319 | 3300003354 | JGI25160J50197_1040051 | JGI25160J50197_10400512 | 197 |
| 320 | 3300003374 | JGI25161J50226_1006781 | JGI25161J50226_10067812 | 197 |
| 321 | 3300003578 | Ga0006562J51391_1041255 | Ga0006562J51391_10412552 | 197 |
| 322 | 3300003578 | Ga0006562J51391_1049985 | Ga0006562J51391_10499852 | 197 |
| 323 | 3300003578 | Ga0006562J51391_1049987 | Ga0006562J51391_10499871 | 197 |
| 324 | 3300003758 | Ga0055532_1010136 | Ga0055532_10101361 | 197 |
| 325 | 3300003761 | Ga0055535_1002183 | Ga0055535_10021834 | 197 |
| 326 | 3300003762 | Ga0055542_1000583 | Ga0055542_100058336 | 197 |
| 327 | 3300003771 | Ga0055526_1008955 | Ga0055526_10089552 | 197 |
| 328 | 3300003771 | Ga0055526_1024178 | Ga0055526_10241783 | 197 |
| 329 | 3300003771 | Ga0055526_1024290 | Ga0055526_10242903 | 197 |
| 330 | 3300003771 | Ga0055526_1027178 | Ga0055526_10271783 | 197 |
| 331 | 3300003771 | Ga0055526_1033320 | Ga0055526_10333202 | 197 |
| 332 | 3300003773 | Ga0055537_1000049 | Ga0055537_100004945 | 197 |
| 333 | 3300003773 | Ga0055537_1000779 | Ga0055537_100077911 | 197 |
| 334 | 3300003773 | Ga0055537_1007736 | Ga0055537_10077364 | 197 |
| 335 | 3300003773 | Ga0055537_1010200 | Ga0055537_10102003 | 197 |
| 336 | 3300003773 | Ga0055537_1010260 | Ga0055537_10102603 | 197 |
| 337 | 3300003775 | Ga0055524_1000120 | Ga0055524_100012029 | 197 |
| 338 | 3300003775 | Ga0055524_1023266 | Ga0055524_10232662 | 197 |
| 339 | 3300003781 | Ga0055536_1001351 | Ga0055536_10013513 | 197 |
| 340 | 3300003781 | Ga0055536_1002957 | Ga0055536_10029572 | 197 |
| 341 | 3300003781 | Ga0055536_1011940 | Ga0055536_10119404 | 197 |
| 342 | 3300003781 | Ga0055536_1015377 | Ga0055536_10153772 | 197 |
| 343 | 3300003781 | Ga0055536_1019458 | Ga0055536_10194583 | 197 |
| 344 | 3300003784 | Ga0055534_1000049 | Ga0055534_100004954 | 197 |
| 345 | 3300003784 | Ga0055534_1001408 | Ga0055534_10014081 | 197 |
| 346 | 3300003784 | Ga0055534_1010119 | Ga0055534_10101193 | 197 |
| 347 | 3300003790 | Ga0055528_1001145 | Ga0055528_10011455 | 197 |
| 348 | 3300003790 | Ga0055528_1002656 | Ga0055528_10026568 | 197 |
| 349 | 3300003790 | Ga0055528_1022011 | Ga0055528_10220112 | 197 |
| 350 | 3300003790 | Ga0055528_1022152 | Ga0055528_10221523 | 197 |
| 351 | 3300003790 | Ga0055528_1026378 | Ga0055528_10263783 | 197 |
| 352 | 3300003791 | Ga0055530_10001709 | Ga0055530_100017093 | 197 |
| 353 | 3300003791 | Ga0055530_10010625 | Ga0055530_100106252 | 197 |
| 354 | 3300003791 | Ga0055530_10013164 | Ga0055530_100131643 | 197 |
| 355 | 3300003792 | Ga0055540_1000067 | Ga0055540_100006759 | 197 |
| 356 | 3300003792 | Ga0055540_1007545 | Ga0055540_10075454 | 197 |
| 357 | 3300003792 | Ga0055540_1009661 | Ga0055540_10096612 | 197 |
| 358 | 3300003792 | Ga0055540_1012700 | Ga0055540_10127002 | 197 |
| 359 | 3300003792 | Ga0055540_1017793 | Ga0055540_10177933 | 197 |
| 360 | 3300003794 | Ga0055531_10001465 | Ga0055531_100014659 | 197 |
| 361 | 3300003794 | Ga0055531_10001523 | Ga0055531_1000152319 | 197 |
| 362 | 3300003794 | Ga0055531_10018314 | Ga0055531_100183143 | 197 |
| 363 | 3300003794 | Ga0055531_10019468 | Ga0055531_100194684 | 197 |
| 364 | 3300003794 | Ga0055531_10027088 | Ga0055531_100270884 | 197 |
| 365 | 3300004625 | Ga0055543_1009803 | Ga0055543_10098032 | 197 |
| 366 | 3300005262 | Ga0065165_1005815 | Ga0065165_10058152 | 197 |
| 367 | 3300005262 | Ga0065165_1014928 | Ga0065165_10149282 | 197 |
| 368 | 3300005262 | Ga0065165_1024230 | Ga0065165_10242302 | 197 |
| 369 | 3300005262 | Ga0065165_1061976 | Ga0065165_10619761 | 197 |
| 370 | 3300005288 | Ga0065714_10014213 | Ga0065714_100142133 | 197 |
| 371 | 3300005289 | Ga0065704_10076112 | Ga0065704_100761126 | 197 |
| 372 | 3300005334 | Ga0068869_100174378 | Ga0068869_1001743782 | 197 |
| 373 | 3300005339 | Ga0070660_100201923 | Ga0070660_1002019232 | 197 |
| 374 | 3300005344 | Ga0070661_100021114 | Ga0070661_1000211145 | 197 |
| 375 | 3300005347 | Ga0070668_100107656 | Ga0070668_1001076563 | 197 |
| 376 | 3300005354 | Ga0070675_100415574 | Ga0070675_1004155742 | 197 |
| 377 | 3300005356 | Ga0070674_100089594 | Ga0070674_1000895943 | 197 |
| 378 | 3300005364 | Ga0070673_100145557 | Ga0070673_1001455572 | 197 |
| 379 | 3300005364 | Ga0070673_100192083 | Ga0070673_1001920832 | 197 |
| 380 | 3300005456 | Ga0070678_100050277 | Ga0070678_1000502772 | 197 |
| 381 | 3300005456 | Ga0070678_100597495 | Ga0070678_1005974952 | 197 |
| 382 | 3300005539 | Ga0068853_100084615 | Ga0068853_1000846154 | 197 |
| 383 | 3300005539 | Ga0068853_100176055 | Ga0068853_1001760552 | 197 |
| 384 | 3300005539 | Ga0068853_100203649 | Ga0068853_1002036492 | 197 |
| 385 | 3300005564 | Ga0070664_100031855 | Ga0070664_1000318552 | 197 |
| 386 | 3300005577 | Ga0068857_100107264 | Ga0068857_1001072643 | 197 |
| 387 | 3300005577 | Ga0068857_100362586 | Ga0068857_1003625862 | 197 |
| 388 | 3300005578 | Ga0068854_100157576 | Ga0068854_1001575762 | 197 |
| 389 | 3300005578 | Ga0068854_101087652 | Ga0068854_1010876521 | 197 |
| 390 | 3300005616 | Ga0068852_100016390 | Ga0068852_1000163905 | 197 |
| 391 | 3300005834 | Ga0068851_10014139 | Ga0068851_100141393 | 197 |
| 392 | 3300005842 | Ga0068858_100804872 | Ga0068858_1008048721 | 197 |
| 393 | 3300006038 | Ga0075365_10024063 | Ga0075365_100240634 | 197 |
| 394 | 3300006051 | Ga0075364_10069982 | Ga0075364_100699822 | 197 |
| 395 | 3300006051 | Ga0075364_10075286 | Ga0075364_100752863 | 197 |
| 396 | 3300006051 | Ga0075364_10132379 | Ga0075364_101323792 | 197 |
| 397 | 3300006058 | Ga0075432_10007264 | Ga0075432_100072645 | 197 |
| 398 | 3300006058 | Ga0075432_10065093 | Ga0075432_100650933 | 197 |
| 399 | 3300006058 | Ga0075432_10107833 | Ga0075432_101078332 | 197 |
| 400 | 3300006177 | Ga0075362_10014486 | Ga0075362_100144864 | 197 |
| 401 | 3300006177 | Ga0075362_10028411 | Ga0075362_100284112 | 197 |
| 402 | 3300006177 | Ga0075362_10031463 | Ga0075362_100314634 | 197 |
| 403 | 3300006178 | Ga0075367_10092119 | Ga0075367_100921194 | 197 |
| 404 | 3300006178 | Ga0075367_10150449 | Ga0075367_101504492 | 197 |
| 405 | 3300006178 | Ga0075367_10437290 | Ga0075367_104372901 | 197 |
| 406 | 3300006186 | Ga0075369_10023885 | Ga0075369_100238854 | 197 |
| 407 | 3300006195 | Ga0075366_10056332 | Ga0075366_100563322 | 197 |
| 408 | 3300006237 | Ga0097621_100388322 | Ga0097621_1003883222 | 197 |
| 409 | 3300006237 | Ga0097621_100459103 | Ga0097621_1004591032 | 197 |
| 410 | 3300006353 | Ga0075370_10000918 | Ga0075370_100009188 | 197 |
| 411 | 3300006353 | Ga0075370_10018552 | Ga0075370_100185522 | 197 |
| 412 | 3300006353 | Ga0075370_10047822 | Ga0075370_100478222 | 197 |
| 413 | 3300006353 | Ga0075370_10132707 | Ga0075370_101327073 | 197 |
| 414 | 3300006881 | Ga0068865_100572676 | Ga0068865_1005726761 | 197 |
| 415 | 3300009036 | Ga0105244_10004556 | Ga0105244_100045569 | 197 |
| 416 | 3300009093 | Ga0105240_10281395 | Ga0105240_102813954 | 197 |
| 417 | 3300009148 | Ga0105243_10012778 | Ga0105243_100127787 | 197 |
| 418 | 3300009176 | Ga0105242_10051506 | Ga0105242_100515062 | 197 |
| 419 | 3300009177 | Ga0105248_10409986 | Ga0105248_104099862 | 197 |
| 420 | 3300009545 | Ga0105237_10121150 | Ga0105237_101211502 | 197 |
| 421 | 3300009551 | Ga0105238_10235490 | Ga0105238_102354903 | 197 |
| 422 | 3300010375 | Ga0105239_10146308 | Ga0105239_101463082 | 197 |
| 423 | 3300010375 | Ga0105239_10499729 | Ga0105239_104997292 | 197 |
| 424 | 3300011119 | Ga0105246_10086033 | Ga0105246_100860334 | 197 |
| 425 | 3300011119 | Ga0105246_10170122 | Ga0105246_101701222 | 197 |
| 426 | 3300011119 | Ga0105246_10194393 | Ga0105246_101943932 | 197 |
| 427 | 3300011119 | Ga0105246_10209400 | Ga0105246_102094002 | 197 |
| 428 | 3300012513 | Ga0157326_1001779 | Ga0157326_10017793 | 197 |
| 429 | 3300013100 | Ga0157373_10055234 | Ga0157373_100552343 | 197 |
| 430 | 3300013100 | Ga0157373_10081013 | Ga0157373_100810133 | 197 |
| 431 | 3300013102 | Ga0157371_10141288 | Ga0157371_101412882 | 197 |
| 432 | 3300013105 | Ga0157369_10037069 | Ga0157369_100370697 | 197 |
| 433 | 3300013306 | Ga0163162_10186099 | Ga0163162_101860993 | 197 |
| 434 | 3300013306 | Ga0163162_10542396 | Ga0163162_105423962 | 197 |
| 435 | 3300013307 | Ga0157372_10043961 | Ga0157372_100439612 | 197 |
| 436 | 3300013308 | Ga0157375_10317222 | Ga0157375_103172222 | 197 |
| 437 | 3300013308 | Ga0157375_10656933 | Ga0157375_106569332 | 197 |
| 438 | 3300014497 | Ga0182008_10002011 | Ga0182008_100020114 | 197 |
| 439 | 3300014497 | Ga0182008_10010313 | Ga0182008_100103133 | 197 |
| 440 | 3300015261 | Ga0182006_1028312 | Ga0182006_10283123 | 197 |
| 441 | 3300015261 | Ga0182006_1085716 | Ga0182006_10857161 | 197 |
| 442 | 3300015261 | Ga0182006_1109726 | Ga0182006_11097262 | 197 |
| 443 | 3300015262 | Ga0182007_10000674 | Ga0182007_1000067419 | 197 |
| 444 | 3300015262 | Ga0182007_10008930 | Ga0182007_100089302 | 197 |
| 445 | 3300015265 | Ga0182005_1067553 | Ga0182005_10675531 | 197 |
| 446 | 3300015683 | Ga0183362_10005 | Ga0183362_10005314 | 197 |
| 447 | 3300017792 | Ga0163161_10000114 | Ga0163161_1000011479 | 197 |
| 448 | 3300017792 | Ga0163161_10122410 | Ga0163161_101224103 | 197 |
| 449 | 3300017792 | Ga0163161_10129392 | Ga0163161_101293923 | 197 |
| 450 | 3300017792 | Ga0163161_10268375 | Ga0163161_102683752 | 197 |
| 451 | 3300017792 | Ga0163161_10454163 | Ga0163161_104541632 | 197 |
| 452 | 3300025206 | Ga0209435_100003 | Ga0209435_100003425 | 197 |
| 453 | 3300025208 | Ga0209436_106469 | Ga0209436_1064694 | 197 |
| 454 | 3300025208 | Ga0209436_109896 | Ga0209436_1098964 | 197 |
| 455 | 3300025228 | Ga0209672_104078 | Ga0209672_1040783 | 197 |
| 456 | 3300025229 | Ga0209147_105455 | Ga0209147_1054552 | 197 |
| 457 | 3300025242 | Ga0209258_100568 | Ga0209258_1005684 | 197 |
| 458 | 3300025245 | Ga0207425_1002159 | Ga0207425_10021592 | 197 |
| 459 | 3300025245 | Ga0207425_1011740 | Ga0207425_10117404 | 197 |
| 460 | 3300025245 | Ga0207425_1012211 | Ga0207425_10122114 | 197 |
| 461 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008425 | 197 |
| 462 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007425 | 197 |
| 463 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033126 | 197 |
| 464 | 3300025256 | Ga0209759_1000019 | Ga0209759_1000019146 | 197 |
| 465 | 3300025258 | Ga0209129_1000227 | Ga0209129_100022791 | 197 |
| 466 | 3300025258 | Ga0209129_1006379 | Ga0209129_10063795 | 197 |
| 467 | 3300025258 | Ga0209129_1010140 | Ga0209129_10101403 | 197 |
| 468 | 3300025258 | Ga0209129_1011664 | Ga0209129_10116644 | 197 |
| 469 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020360 | 197 |
| 470 | 3300025263 | Ga0209565_1000116 | Ga0209565_100011630 | 197 |
| 471 | 3300025263 | Ga0209565_1000171 | Ga0209565_1000171107 | 197 |
| 472 | 3300025263 | Ga0209565_1005961 | Ga0209565_10059614 | 197 |
| 473 | 3300025263 | Ga0209565_1009957 | Ga0209565_10099574 | 197 |
| 474 | 3300025273 | Ga0209673_1000295 | Ga0209673_100029554 | 197 |
| 475 | 3300025273 | Ga0209673_1001210 | Ga0209673_10012106 | 197 |
| 476 | 3300025273 | Ga0209673_1001360 | Ga0209673_100136030 | 197 |
| 477 | 3300025273 | Ga0209673_1001942 | Ga0209673_100194217 | 197 |
| 478 | 3300025273 | Ga0209673_1029925 | Ga0209673_10299252 | 197 |
| 479 | 3300025284 | Ga0209130_1000134 | Ga0209130_100013429 | 197 |
| 480 | 3300025284 | Ga0209130_1000193 | Ga0209130_10001934 | 197 |
| 481 | 3300025284 | Ga0209130_1000560 | Ga0209130_100056031 | 197 |
| 482 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014349 | 197 |
| 483 | 3300025291 | Ga0209675_1001804 | Ga0209675_10018044 | 197 |
| 484 | 3300025291 | Ga0209675_1003215 | Ga0209675_10032154 | 197 |
| 485 | 3300025291 | Ga0209675_1008491 | Ga0209675_10084914 | 197 |
| 486 | 3300025291 | Ga0209675_1012282 | Ga0209675_10122823 | 197 |
| 487 | 3300025291 | Ga0209675_1017248 | Ga0209675_10172484 | 197 |
| 488 | 3300025291 | Ga0209675_1026281 | Ga0209675_10262812 | 197 |
| 489 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048203 | 197 |
| 490 | 3300025292 | Ga0209676_1000098 | Ga0209676_10000984 | 197 |
| 491 | 3300025292 | Ga0209676_1000124 | Ga0209676_1000124140 | 197 |
| 492 | 3300025292 | Ga0209676_1000145 | Ga0209676_1000145118 | 197 |
| 493 | 3300025292 | Ga0209676_1016118 | Ga0209676_10161182 | 197 |
| 494 | 3300025292 | Ga0209676_1022886 | Ga0209676_10228862 | 197 |
| 495 | 3300025292 | Ga0209676_1027050 | Ga0209676_10270502 | 197 |
| 496 | 3300025294 | Ga0209025_1000204 | Ga0209025_100020494 | 197 |
| 497 | 3300025294 | Ga0209025_1000264 | Ga0209025_1000264166 | 197 |
| 498 | 3300025294 | Ga0209025_1000348 | Ga0209025_10003484 | 197 |
| 499 | 3300025294 | Ga0209025_1003744 | Ga0209025_100374410 | 197 |
| 500 | 3300025294 | Ga0209025_1005205 | Ga0209025_10052054 | 197 |
| 501 | 3300025294 | Ga0209025_1009410 | Ga0209025_10094103 | 197 |
| 502 | 3300025294 | Ga0209025_1017213 | Ga0209025_10172133 | 197 |
| 503 | 3300025294 | Ga0209025_1019826 | Ga0209025_10198263 | 197 |
| 504 | 3300025294 | Ga0209025_1024711 | Ga0209025_10247112 | 197 |
| 505 | 3300025294 | Ga0209025_1068041 | Ga0209025_10680412 | 197 |
| 506 | 3300025295 | Ga0209564_1000231 | Ga0209564_1000231166 | 197 |
| 507 | 3300025295 | Ga0209564_1000728 | Ga0209564_100072812 | 197 |
| 508 | 3300025295 | Ga0209564_1001669 | Ga0209564_10016694 | 197 |
| 509 | 3300025295 | Ga0209564_1006632 | Ga0209564_10066327 | 197 |
| 510 | 3300025297 | Ga0209758_1000222 | Ga0209758_1000222166 | 197 |
| 511 | 3300025297 | Ga0209758_1015212 | Ga0209758_10152124 | 197 |
| 512 | 3300025297 | Ga0209758_1025105 | Ga0209758_10251054 | 197 |
| 513 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012203 | 197 |
| 514 | 3300025298 | Ga0209050_1000023 | Ga0209050_100002359 | 197 |
| 515 | 3300025298 | Ga0209050_1000252 | Ga0209050_10002527 | 197 |
| 516 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003793 | 197 |
| 517 | 3300025299 | Ga0209256_1000095 | Ga0209256_100009584 | 197 |
| 518 | 3300025299 | Ga0209256_1000749 | Ga0209256_10007494 | 197 |
| 519 | 3300025299 | Ga0209256_1024835 | Ga0209256_10248352 | 197 |
| 520 | 3300025299 | Ga0209256_1040713 | Ga0209256_10407132 | 197 |
| 521 | 3300025302 | Ga0207426_1000058 | Ga0207426_100005810 | 197 |
| 522 | 3300025302 | Ga0207426_1000349 | Ga0207426_10003494 | 197 |
| 523 | 3300025302 | Ga0207426_1001961 | Ga0207426_10019618 | 197 |
| 524 | 3300025303 | Ga0209051_1000017 | Ga0209051_100001759 | 197 |
| 525 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019122 | 197 |
| 526 | 3300025303 | Ga0209051_1000098 | Ga0209051_10000984 | 197 |
| 527 | 3300025303 | Ga0209051_1000099 | Ga0209051_100009995 | 197 |
| 528 | 3300025303 | Ga0209051_1000579 | Ga0209051_10005793 | 197 |
| 529 | 3300025303 | Ga0209051_1067993 | Ga0209051_10679932 | 197 |
| 530 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024149 | 197 |
| 531 | 3300025304 | Ga0209257_1000041 | Ga0209257_100004159 | 197 |
| 532 | 3300025304 | Ga0209257_1000258 | Ga0209257_100025891 | 197 |
| 533 | 3300025304 | Ga0209257_1006531 | Ga0209257_10065314 | 197 |
| 534 | 3300025304 | Ga0209257_1021034 | Ga0209257_10210344 | 197 |
| 535 | 3300025321 | Ga0207656_10136058 | Ga0207656_101360581 | 197 |
| 536 | 3300025728 | Ga0207655_1008069 | Ga0207655_10080697 | 197 |
| 537 | 3300025907 | Ga0207645_10030133 | Ga0207645_100301335 | 197 |
| 538 | 3300025919 | Ga0207657_10333452 | Ga0207657_103334522 | 197 |
| 539 | 3300025924 | Ga0207694_10664360 | Ga0207694_106643601 | 197 |
| 540 | 3300025925 | Ga0207650_10291841 | Ga0207650_102918411 | 197 |
| 541 | 3300025933 | Ga0207706_10474020 | Ga0207706_104740203 | 197 |
| 542 | 3300025934 | Ga0207686_10470623 | Ga0207686_104706232 | 197 |
| 543 | 3300025935 | Ga0207709_10000331 | Ga0207709_100003314 | 197 |
| 544 | 3300025935 | Ga0207709_10007073 | Ga0207709_100070733 | 197 |
| 545 | 3300025937 | Ga0207669_10317294 | Ga0207669_103172941 | 197 |
| 546 | 3300025937 | Ga0207669_10587753 | Ga0207669_105877531 | 197 |
| 547 | 3300025940 | Ga0207691_10050413 | Ga0207691_100504131 | 197 |
| 548 | 3300025942 | Ga0207689_10317804 | Ga0207689_103178042 | 197 |
| 549 | 3300025945 | Ga0207679_10698259 | Ga0207679_106982591 | 197 |
| 550 | 3300025960 | Ga0207651_10144391 | Ga0207651_101443912 | 197 |
| 551 | 3300025960 | Ga0207651_10160010 | Ga0207651_101600102 | 197 |
| 552 | 3300025960 | Ga0207651_10332355 | Ga0207651_103323551 | 197 |
| 553 | 3300025986 | Ga0207658_10054381 | Ga0207658_100543813 | 197 |
| 554 | 3300026041 | Ga0207639_10114287 | Ga0207639_101142873 | 197 |
| 555 | 3300026041 | Ga0207639_10141709 | Ga0207639_101417092 | 197 |
| 556 | 3300026041 | Ga0207639_10164284 | Ga0207639_101642842 | 197 |
| 557 | 3300026089 | Ga0207648_10065975 | Ga0207648_100659753 | 197 |
| 558 | 3300026095 | Ga0207676_11259737 | Ga0207676_112597371 | 197 |
| 559 | 3300026116 | Ga0207674_10133308 | Ga0207674_101333084 | 197 |
| 560 | 3300026121 | Ga0207683_10061823 | Ga0207683_100618233 | 197 |
| 561 | 3300026121 | Ga0207683_10111598 | Ga0207683_101115983 | 197 |
| 562 | 3300026142 | Ga0207698_10029695 | Ga0207698_100296955 | 197 |
| 563 | 3300027666 | Ga0209282_1000501 | Ga0209282_100050117 | 197 |
| 564 | 3300028379 | Ga0268266_10017420 | Ga0268266_100174205 | 197 |
| 565 | 3300028380 | Ga0268265_10024287 | Ga0268265_100242874 | 197 |
| 566 | 3300028794 | Ga0307515_10000040 | Ga0307515_10000040124 | 197 |
| 567 | 3300028794 | Ga0307515_10235199 | Ga0307515_102351991 | 197 |
| 568 | 3300030522 | Ga0307512_10122949 | Ga0307512_101229492 | 197 |
| 569 | 3300030732 | Ga0316176_1014050 | Ga0316176_10140501 | 197 |
| 570 | 3300030733 | Ga0314311_1003705 | Ga0314311_10037052 | 197 |
| 571 | 3300030735 | Ga0316178_1010462 | Ga0316178_10104624 | 197 |
| 572 | 3300030742 | Ga0316183_1067419 | Ga0316183_10674196 | 197 |
| 573 | 3300030744 | Ga0316181_1007566 | Ga0316181_10075661 | 197 |
| 574 | 3300030745 | Ga0316182_1188730 | Ga0316182_11887302 | 197 |
| 575 | 3300031251 | Ga0265327_10000235 | Ga0265327_1000023595 | 197 |
| 576 | 3300031251 | Ga0265327_10001208 | Ga0265327_1000120815 | 197 |
| 577 | 3300031251 | Ga0265327_10037618 | Ga0265327_100376184 | 197 |
| 578 | 3300031344 | Ga0265316_10000332 | Ga0265316_1000033234 | 197 |
| 579 | 3300031456 | Ga0307513_10000113 | Ga0307513_1000011352 | 197 |
| 580 | 3300031456 | Ga0307513_10011506 | Ga0307513_1001150611 | 197 |
| 581 | 3300031456 | Ga0307513_10361629 | Ga0307513_103616292 | 197 |
| 582 | 3300031548 | Ga0307408_100013522 | Ga0307408_1000135225 | 197 |
| 583 | 3300031548 | Ga0307408_100102668 | Ga0307408_1001026684 | 197 |
| 584 | 3300031548 | Ga0307408_100167065 | Ga0307408_1001670652 | 197 |
| 585 | 3300031649 | Ga0307514_10133587 | Ga0307514_101335872 | 197 |
| 586 | 3300031730 | Ga0307516_10058267 | Ga0307516_100582671 | 197 |
| 587 | 3300031731 | Ga0307405_10008898 | Ga0307405_100088987 | 197 |
| 588 | 3300031731 | Ga0307405_10080257 | Ga0307405_100802574 | 197 |
| 589 | 3300031824 | Ga0307413_10287365 | Ga0307413_102873651 | 197 |
| 590 | 3300031901 | Ga0307406_10031294 | Ga0307406_100312942 | 197 |
| 591 | 3300031903 | Ga0307407_10210180 | Ga0307407_102101802 | 197 |
| 592 | 3300031911 | Ga0307412_10008057 | Ga0307412_100080577 | 197 |
| 593 | 3300031911 | Ga0307412_10052422 | Ga0307412_100524223 | 197 |
| 594 | 3300031911 | Ga0307412_10237912 | Ga0307412_102379122 | 197 |
| 595 | 3300031911 | Ga0307412_10640307 | Ga0307412_106403072 | 197 |
| 596 | 3300031995 | Ga0307409_100738712 | Ga0307409_1007387122 | 197 |
| 597 | 3300032002 | Ga0307416_100106996 | Ga0307416_1001069962 | 197 |
| 598 | 3300032002 | Ga0307416_100126451 | Ga0307416_1001264513 | 197 |
| 599 | 3300032002 | Ga0307416_100334462 | Ga0307416_1003344622 | 197 |
| 600 | 3300032004 | Ga0307414_10290726 | Ga0307414_102907262 | 197 |
| 601 | 3300032005 | Ga0307411_10053721 | Ga0307411_100537214 | 197 |
| 602 | 3300032126 | Ga0307415_100239472 | Ga0307415_1002394722 | 197 |
| 603 | 3300041404 | Ga0439436_0000562 | Ga0439436_0000562_2223_2855 | 197 |
| 604 | 3300041404 | Ga0439436_0002238 | Ga0439436_0002238_4825_5457 | 197 |
| 605 | 3300041404 | Ga0439436_0022773 | Ga0439436_0022773_361_993 | 197 |
| 606 | 3300041406 | Ga0439439_0019130 | Ga0439439_0019130_506_1138 | 197 |
| 607 | 3300041411 | Ga0439466_0010304 | Ga0439466_0010304_1179_1811 | 197 |
| 608 | 3300041411 | Ga0439466_0014211 | Ga0439466_0014211_880_1512 | 197 |
| 609 | 3300041411 | Ga0439466_0022944 | Ga0439466_0022944_1273_1905 | 197 |
| 610 | 3300041413 | Ga0439465_0000277 | Ga0439465_0000277_6623_7255 | 197 |
| 611 | 3300041413 | Ga0439465_0122542 | Ga0439465_0122542_55_687 | 197 |
| 612 | 3300041451 | Ga0451791_1838390 | Ga0451791_1838390_1423_2052 | 197 |
| 613 | 3300041452 | Ga0451793_1782101 | Ga0451793_1782101_238_864 | 197 |
| 614 | 3300041456 | Ga0451795_0347533 | Ga0451795_0347533_90_716 | 197 |
| 615 | 3300041486 | Ga0451807_0649746 | Ga0451807_0649746_113_739 | 197 |
| 616 | 3300041486 | Ga0451807_2730351 | Ga0451807_2730351_463_1095 | 197 |
| 617 | 3300041999 | Ga0439433_0001048 | Ga0439433_0001048_1412_2044 | 197 |
| 618 | 3300042002 | Ga0439442_007320 | Ga0439442_007320_1436_2068 | 197 |
| 619 | 3300042004 | Ga0439445_0000763 | Ga0439445_0000763_3230_3862 | 197 |
| 620 | 3300042004 | Ga0439445_0109876 | Ga0439445_0109876_38_670 | 197 |
| 621 | 3300042006 | Ga0439432_001936 | Ga0439432_001936_2999_3631 | 197 |
| 622 | 3300042006 | Ga0439432_003064 | Ga0439432_003064_958_1590 | 197 |
| 623 | 3300042006 | Ga0439432_039445 | Ga0439432_039445_315_947 | 197 |
| 624 | 3300042007 | Ga0439449_0000120 | Ga0439449_0000120_2948_3580 | 197 |
| 625 | 3300042007 | Ga0439449_0000453 | Ga0439449_0000453_642_1274 | 197 |
| 626 | 3300042010 | Ga0439452_002310 | Ga0439452_002310_3149_3781 | 197 |
| 627 | 3300042010 | Ga0439452_011741 | Ga0439452_011741_942_1574 | 197 |
| 628 | 3300042015 | Ga0439462_0008753 | Ga0439462_0008753_214_846 | 197 |
| 629 | 3300042015 | Ga0439462_0010910 | Ga0439462_0010910_409_1041 | 197 |
| 630 | 3300042121 | Ga0450919_001118 | Ga0450919_001118_447_1079 | 197 |
| 631 | 3300042127 | Ga0450890_009757 | Ga0450890_009757_315_947 | 197 |
| 632 | 3300042133 | Ga0450896_002703 | Ga0450896_002703_552_1184 | 197 |
| 633 | 3300042134 | Ga0450898_008896 | Ga0450898_008896_22_654 | 197 |
| 634 | 3300042135 | Ga0450899_009056 | Ga0450899_009056_352_984 | 197 |
| 635 | 3300042145 | Ga0450906_000192 | Ga0450906_000192_8617_9249 | 197 |
| 636 | 3300042145 | Ga0450906_016518 | Ga0450906_016518_330_962 | 197 |
| 637 | 3300042147 | Ga0450910_001673 | Ga0450910_001673_1689_2321 | 197 |
| 638 | 3300042184 | Ga0450908_000821 | Ga0450908_000821_949_1581 | 197 |
| 639 | 3300042184 | Ga0450908_002821 | Ga0450908_002821_116_748 | 197 |
| 640 | 3300042435 | Ga0439434_0000289 | Ga0439434_0000289_7743_8375 | 197 |
| 641 | 3300042435 | Ga0439434_0028083 | Ga0439434_0028083_666_1298 | 197 |
| 642 | 3300042531 | Ga0450918_000437 | Ga0450918_000437_4557_5189 | 197 |
| 643 | 3300042876 | Ga0451577_0029663 | Ga0451577_0029663_2692_3411 | 197 |
| 644 | 3300042876 | Ga0451577_0679486 | Ga0451577_0679486_118_756 | 197 |
| 645 | 3300044673 | Ga0453683_0003653 | Ga0453683_0003653_3278_3985 | 197 |
| 646 | 3300044712 | Ga0453684_0018472 | Ga0453684_0018472_7059_7778 | 197 |
| 647 | 3300044901 | Ga0466960_0469123 | Ga0466960_0469123_71_700 | 197 |
| 648 | 3300045051 | Ga0451576_0026738 | Ga0451576_0026738_1090_1797 | 197 |
| 649 | 3300045051 | Ga0451576_0120857 | Ga0451576_0120857_1964_2587 | 197 |
| 650 | 3300046453 | Ga0495627_016376 | Ga0495627_016376_1819_2451 | 197 |
| 651 | 3300046453 | Ga0495627_017833 | Ga0495627_017833_1699_2331 | 197 |
| 652 | 3300046459 | Ga0495629_0146988 | Ga0495629_0146988_953_1585 | 197 |
| 653 | 3300046475 | Ga0495639_0016063 | Ga0495639_0016063_1065_1697 | 197 |
| 654 | 3300046513 | Ga0495616_0023910 | Ga0495616_0023910_1268_1900 | 197 |
| 655 | 3300046515 | Ga0495620_0019241 | Ga0495620_0019241_1240_1872 | 197 |
| 656 | 3300046518 | Ga0495631_0000927 | Ga0495631_0000927_1547_2179 | 197 |
| 657 | 3300046520 | Ga0495637_0001152 | Ga0495637_0001152_13892_14524 | 197 |
| 658 | 3300046520 | Ga0495637_0061649 | Ga0495637_0061649_69_701 | 197 |
| 659 | 3300046522 | Ga0495643_0145643 | Ga0495643_0145643_231_866 | 197 |
| 660 | 3300046528 | Ga0495642_0260407 | Ga0495642_0260407_24_656 | 197 |
| 661 | 3300046530 | Ga0495654_0044568 | Ga0495654_0044568_830_1462 | 197 |
| 662 | 3300046539 | Ga0495621_0031312 | Ga0495621_0031312_174_806 | 197 |
| 663 | 3300046557 | Ga0495622_0033391 | Ga0495622_0033391_217_849 | 197 |
| 664 | 3300046615 | Ga0495656_0002859 | Ga0495656_0002859_531_1163 | 197 |
| 665 | 3300046660 | Ga0495625_0000045 | Ga0495625_0000045_118990_119622 | 197 |
| 666 | 3300046660 | Ga0495625_0041165 | Ga0495625_0041165_1293_1925 | 197 |
| 667 | 3300046663 | Ga0495635_0132374 | Ga0495635_0132374_653_1285 | 197 |
| 668 | 3300046674 | Ga0495588_0009189 | Ga0495588_0009189_1297_1929 | 197 |
| 669 | 3300046683 | Ga0495658_0012053 | Ga0495658_0012053_847_1479 | 197 |
| 670 | 3300046684 | Ga0495669_0111828 | Ga0495669_0111828_177_809 | 197 |
| 671 | 3300046691 | Ga0495670_0048023 | Ga0495670_0048023_808_1440 | 197 |
| 672 | 3300046692 | Ga0495671_0010658 | Ga0495671_0010658_2881_3513 | 197 |
| 673 | 3300046810 | Ga0495660_0326335 | Ga0495660_0326335_22_654 | 197 |
| 674 | 3300047321 | Ga0495676_0013815 | Ga0495676_0013815_4883_5515 | 197 |
| 675 | 3300047445 | Ga0495677_0065683 | Ga0495677_0065683_316_948 | 197 |
| 676 | 3300047447 | Ga0495685_116524 | Ga0495685_116524_79_711 | 197 |
| 677 | 3300047673 | Ga0495593_0012980 | Ga0495593_0012980_2306_2938 | 197 |
| 678 | 3300048089 | Ga0495614_0049081 | Ga0495614_0049081_776_1408 | 197 |
| 679 | 3300048090 | Ga0495615_0018928 | Ga0495615_0018928_195_827 | 197 |
| 680 | 3300048090 | Ga0495615_0086480 | Ga0495615_0086480_98_730 | 197 |
| 681 | 3300048903 | Ga0496100_0038094 | Ga0496100_0038094_1250_1882 | 197 |
| 682 | 3300048904 | Ga0496101_0024578 | Ga0496101_0024578_2047_2679 | 197 |
| 683 | 3300048905 | Ga0496102_0048128 | Ga0496102_0048128_1528_2160 | 197 |
| 684 | 3300048906 | Ga0496103_0039550 | Ga0496103_0039550_365_997 | 197 |
| 685 | 3300048907 | Ga0496104_0100676 | Ga0496104_0100676_1841_2473 | 197 |
| 686 | 3300048908 | Ga0496105_0047749 | Ga0496105_0047749_1248_1880 | 197 |
| 687 | 3300048909 | Ga0496106_0049724 | Ga0496106_0049724_933_1565 | 197 |
| 688 | 3300048913 | Ga0496110_0132482 | Ga0496110_0132482_1369_2001 | 197 |
| 689 | 3300048914 | Ga0496111_0046348 | Ga0496111_0046348_912_1544 | 197 |
| 690 | 3300048919 | Ga0496116_0101509 | Ga0496116_0101509_244_876 | 197 |
| 691 | 3300048920 | Ga0496117_0014880 | Ga0496117_0014880_1369_2001 | 197 |
| 692 | 3300048920 | Ga0496117_0093107 | Ga0496117_0093107_899_1537 | 197 |
| 693 | 3300048920 | Ga0496117_0100631 | Ga0496117_0100631_568_1200 | 197 |
| 694 | 3300048920 | Ga0496117_0130005 | Ga0496117_0130005_209_841 | 197 |
| 695 | 3300048921 | Ga0496118_0015707 | Ga0496118_0015707_941_1573 | 197 |
| 696 | 3300048921 | Ga0496118_0019070 | Ga0496118_0019070_1302_1934 | 197 |
| 697 | 3300048921 | Ga0496118_0409245 | Ga0496118_0409245_44_676 | 197 |
| 698 | 3300048924 | Ga0496121_0049634 | Ga0496121_0049634_1401_2033 | 197 |
| 699 | 3300048924 | Ga0496121_0143935 | Ga0496121_0143935_776_1408 | 197 |
| 700 | 3300048925 | Ga0496122_0088660 | Ga0496122_0088660_884_1516 | 197 |
| 701 | 3300048925 | Ga0496122_0093309 | Ga0496122_0093309_1373_2005 | 197 |
| 702 | 3300048925 | Ga0496122_0162766 | Ga0496122_0162766_28_660 | 197 |
| 703 | 3300048925 | Ga0496122_0355111 | Ga0496122_0355111_36_668 | 197 |
| 704 | 3300048926 | Ga0496123_0036698 | Ga0496123_0036698_342_974 | 197 |
| 705 | 3300048926 | Ga0496123_0132987 | Ga0496123_0132987_556_1182 | 197 |
| 706 | 3300048927 | Ga0496124_0089765 | Ga0496124_0089765_602_1234 | 197 |
| 707 | 3300048927 | Ga0496124_0315773 | Ga0496124_0315773_440_1072 | 197 |
| 708 | 3300048927 | Ga0496124_0323394 | Ga0496124_0323394_372_1004 | 197 |
| 709 | 3300048927 | Ga0496124_0458238 | Ga0496124_0458238_81_719 | 197 |
| 710 | 3300048928 | Ga0496125_0001189 | Ga0496125_0001189_25462_26151 | 197 |
| 711 | 3300048928 | Ga0496125_0046129 | Ga0496125_0046129_1856_2488 | 197 |
| 712 | 3300048928 | Ga0496125_0085887 | Ga0496125_0085887_970_1602 | 197 |
| 713 | 3300048928 | Ga0496125_0214612 | Ga0496125_0214612_593_1225 | 197 |
| 714 | 3300048928 | Ga0496125_0292292 | Ga0496125_0292292_133_765 | 197 |
| 715 | 3300048929 | Ga0496126_0001477 | Ga0496126_0001477_532_1221 | 197 |
| 716 | 3300049679 | Ga0501249_002182 | Ga0501249_002182_1297_1929 | 197 |
| 717 | 3300049705 | Ga0501225_0092914 | Ga0501225_0092914_47_679 | 197 |
| 718 | 3300049759 | Ga0501262_000434 | Ga0501262_000434_3231_3863 | 197 |
| 719 | 3300050489 | nmdc:mga03683_103713_c1 | nmdc:mga03683_103713_c1_299_931 | 197 |
| 720 | 3300050489 | nmdc:mga03683_15696_c1 | nmdc:mga03683_15696_c1_210_833 | 197 |
| 721 | 3300050489 | nmdc:mga03683_52700_c1 | nmdc:mga03683_52700_c1_641_1273 | 197 |
| 722 | 3300050489 | nmdc:mga03683_7472_c1 | nmdc:mga03683_7472_c1_2871_3503 | 197 |
| 723 | 3300050490 | nmdc:mga03n38_19715_c1 | nmdc:mga03n38_19715_c1_1517_2149 | 197 |
| 724 | 3300050490 | nmdc:mga03n38_20085_c1 | nmdc:mga03n38_20085_c1_1370_2002 | 197 |
| 725 | 3300050491 | nmdc:mga00v17_31009_c1 | nmdc:mga00v17_31009_c1_662_1294 | 197 |
| 726 | 3300050491 | nmdc:mga00v17_51844_c1 | nmdc:mga00v17_51844_c1_1799_2422 | 197 |
| 727 | 3300050492 | nmdc:mga0yw44_43614_c1 | nmdc:mga0yw44_43614_c1_1726_2358 | 197 |
| 728 | 3300050493 | nmdc:mga0k408_197950_c1 | nmdc:mga0k408_197950_c1_230_853 | 197 |
| 729 | 3300050493 | nmdc:mga0k408_40803_c1 | nmdc:mga0k408_40803_c1_1368_2000 | 197 |
| 730 | 3300050493 | nmdc:mga0k408_43251_c2 | nmdc:mga0k408_43251_c2_28_660 | 197 |
| 731 | 3300050493 | nmdc:mga0k408_52414_c1 | nmdc:mga0k408_52414_c1_359_991 | 197 |
| 732 | 3300050496 | nmdc:mga07m45_30257_c1 | nmdc:mga07m45_30257_c1_1184_1816 | 197 |
| 733 | 3300050496 | nmdc:mga07m45_53694_c1 | nmdc:mga07m45_53694_c1_194_826 | 197 |
| 734 | 3300050496 | nmdc:mga07m45_59868_c1 | nmdc:mga07m45_59868_c1_454_1086 | 197 |
| 735 | 3300050508 | nmdc:mga09592_20553_c1 | nmdc:mga09592_20553_c1_2882_3505 | 197 |
| 736 | 3300050509 | nmdc:mga0qj67_153805_c1 | nmdc:mga0qj67_153805_c1_618_1241 | 197 |
| 737 | 3300050516 | nmdc:mga0sz30_39319_c1 | nmdc:mga0sz30_39319_c1_1283_1915 | 197 |
| 738 | 3300053079 | Ga0500610_0001980 | Ga0500610_0001980_2001_2633 | 197 |
| 739 | 3300053079 | Ga0500610_0006936 | Ga0500610_0006936_300_917 | 197 |
| 740 | 3300053093 | Ga0500651_0000112 | Ga0500651_0000112_1419_2051 | 197 |
| 741 | 3300053094 | Ga0500566_0186619 | Ga0500566_0186619_348_989 | 197 |
| 742 | 3300053096 | Ga0500641_0087128 | Ga0500641_0087128_647_1288 | 197 |
| 743 | 3300053110 | Ga0500571_027167 | Ga0500571_027167_1366_1998 | 197 |
| 744 | 3300053111 | Ga0500572_098750 | Ga0500572_098750_124_756 | 197 |
| 745 | 3300053117 | Ga0500593_003265 | Ga0500593_003265_4277_4909 | 197 |
| 746 | 3300053128 | Ga0500626_063714 | Ga0500626_063714_95_727 | 197 |
| 747 | 3300053129 | Ga0500628_061466 | Ga0500628_061466_111_752 | 197 |
| 748 | 3300053133 | Ga0500655_000471 | Ga0500655_000471_1945_2577 | 197 |
| 749 | 3300053134 | Ga0500658_0001561 | Ga0500658_0001561_6439_7071 | 197 |
| 750 | 3300053134 | Ga0500658_0001686 | Ga0500658_0001686_1703_2335 | 197 |
| 751 | 3300053136 | Ga0500559_0012676 | Ga0500559_0012676_1467_2102 | 197 |
| 752 | 3300053139 | Ga0500568_0002695 | Ga0500568_0002695_8325_8957 | 197 |
| 753 | 3300053139 | Ga0500568_0153622 | Ga0500568_0153622_30_671 | 197 |
| 754 | 3300053162 | Ga0500638_000683 | Ga0500638_000683_2435_3067 | 197 |
| 755 | 3300053729 | Ga0500625_081534 | Ga0500625_081534_628_1260 | 197 |
| 756 | 3300053730 | Ga0500645_000661 | Ga0500645_000661_14234_14848 | 197 |
| 757 | 3300053730 | Ga0500645_031433 | Ga0500645_031433_554_1195 | 197 |
| 758 | 3300055283 | Ga0500661_001056 | Ga0500661_001056_3743_4384 | 197 |
| 759 | iso_pu_bacteria | 2643221628 | 2644161763 | 197 |
| 760 | iso_pu_bacteria | 2945909444 | 2945909915 | 197 |
| 761 | iso_pu_bacteria | 2945945610 | 2945945956 | 197 |
| 762 | iso_pu_bacteria | 2945984333 | 2945988124 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qd3-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from pseudomonas aeruginosa with 5-azacytidine at 1.89 angstrom resolution | 0.9832 | 2 | 189 |
| 8axp-assembly1.cif.gz_B | neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. | 0.9801 | 2 | 188 |
| 4fyj-assembly1.cif.gz_A | crystal structure of p. aeruginosa peptidyl-trna hydrolase | 0.9774 | 2 | 190 |
| 4p7b-assembly2.cif.gz_C | crystal structure of s. typhimurium peptidyl-trna hydrolase | 0.9705 | 1 | 187 |
| 6ix6-assembly1.cif.gz_A | crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution | 0.9701 | 2 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9583 | 2 | 187 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9448 | 1 | 188 | 3.40.50.1470 |
| 3neaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9355 | 2 | 185 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9353 | 1 | 188 | 3.40.50.1470 |
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9294 | 60 | 188 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A433SDN1-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9924 | 1 | 192 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A1D2U791-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9924 | 1 | 190 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A357JRN5-F1-model_v4 | deleted | 0.9863 | 2 | 169 |
|
| AF-A0A1D2U791-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9821 | 1 | 190 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A533ZYX7-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9809 | 2 | 187 |
GO:0004045
GO:0005737 GO:0006412 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar