F479643

General Info

Members Datasets Scaffolds Average Seq Length
762 398 702 203

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0029663|Ga0451577_0029663_2692_3411
Length 239
Sequence VGLFLFPHKHNPTMIRLFVGLGNPGPDYENTRHNAGFWWIDAVARALNAQLVVDKSYHGLVARTSVNGQTIWLLEPQTFMNLSGKSVAALAHFFKISPQEILVAHDELDVVPGEAKLKLGGSHAGHNGLRDIHAQLGTDQYWRLRLGIGHPGNKAEVVHWVLKKPSLDHRIAVDQTIDRAIKALPQLLSGDMEQATRLIHTSKPPRPKVPRPTPALTASDARVSTPMDSQPRPASTPSP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221570 Acidovorax sp. Root568 Isolate Unclassified
10 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221658 Variovorax sp. Root411 Isolate Unclassified
17 2643221660 Methylibium sp. Root1272 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2721755523 Delftia sp. HK171 Isolate Unclassified
22 2738541277 Variovorax sp. GV051 Isolate Unclassified
23 2738541307 Variovorax sp. GV008 Isolate Unclassified
24 2738543012 Acidovorax sp. CF301 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2816332133 Acidovorax radicis 2721A Isolate Unclassified
28 2818991446 Variovorax sp. 1180 Isolate Unclassified
29 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
30 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
31 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
34 2842747753 Variovorax sp. R-72060 Isolate Unclassified
35 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
36 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
37 2885198086 Variovorax sp. 679 Isolate Unclassified
38 2885211737 Variovorax sp. 553 Isolate Unclassified
39 2899924645 Variovorax sp. 369 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
43 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
44 2928037797 Variovorax sp. 1126 Isolate Unclassified
45 2928044640 Variovorax sp. 1128 Isolate Unclassified
46 2928051484 Variovorax sp. 1133 Isolate Unclassified
47 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
48 2928070936 Variovorax gossypii 1167 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
54 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
55 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
56 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
57 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
58 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
59 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
68 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
69 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
74 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
75 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
82 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
83 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
84 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
85 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
96 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
97 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
98 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
99 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
100 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
158 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
221 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
222 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
223 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
224 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
227 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
228 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
258 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
259 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
262 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
263 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
268 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
269 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
270 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
271 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
276 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
277 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
278 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
281 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
282 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
283 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
284 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
285 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
286 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
287 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
288 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
289 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
292 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
293 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
294 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
307 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
312 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
313 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
314 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
315 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
316 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
319 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
363 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
364 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
365 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
376 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
379 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
380 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
381 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
382 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
383 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
384 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
385 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
386 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
387 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
388 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
396 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
397 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
398 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.73
Metatranscriptomes 0.39
Isolates 7.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.91
Nodule 0.79
Rhizoplane 3.15
Rhizosphere 48.56
Stem 0
Stem Tuber 0
Unclassified 12.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009214 3300001979 Bacteria 3878
2 JGI24740J21852_10009701 3300001979 Bacteria 3752
3 JGI25155J39150_1000102 3300002704 Bacteria 45181
4 JGI25156J39149_1000010 3300002705 Bacteria 200080
5 JGI25154J39366_1000027 3300002738 Bacteria 200075
6 JGI25158J39367_1006527 3300002739 Bacteria 1668
7 JGI25157J39369_1000146 3300002741 Bacteria 59929
8 JGI25152J39213_1000516 3300002773 Bacteria 21501
9 JGI25152J39213_1010222 3300002773 Bacteria 2165
10 JGI25152J39213_1011717 3300002773 Bacteria 1924
11 JGI25150J39212_1003244 3300002774 Bacteria 3841
12 JGI25150J39212_1007486 3300002774 Bacteria 2189
13 JGI25150J39212_1009352 3300002774 Bacteria 1871
14 JGI25150J39212_1010392 3300002774 Bacteria 1733
15 JGI25159J45721_1000345 3300002987 Bacteria 21479
16 JGI25159J45721_1001064 3300002987 Bacteria 11731
17 JGI25159J45721_1012661 3300002987 Bacteria 1999
18 JGI25159J45721_1013590 3300002987 Bacteria 1877
19 JGI25151J46595_10010095 3300003187 Bacteria 4418
20 JGI25151J46595_10019873 3300003187 Bacteria 2842
21 JGI25151J46595_10029663 3300003187 Bacteria 2162
22 JGI25151J46595_10033026 3300003187 Bacteria 1999
23 JGI25151J46595_10033391 3300003187 Bacteria 1982
24 JGI25153J46596_10002374 3300003215 Bacteria 10904
25 JGI25153J46596_10003174 3300003215 Bacteria 9261
26 JGI25153J46596_10027356 3300003215 Bacteria 1999
27 JGI25160J50197_1000129 3300003354 Bacteria 68068
28 JGI25160J50197_1017895 3300003354 Bacteria 2227
29 JGI25160J50197_1020407 3300003354 Bacteria 1999
30 JGI25160J50197_1040051 3300003354 Bacteria 1090
31 JGI25161J50226_1000080 3300003374 Bacteria 79971
32 JGI25161J50226_1006781 3300003374 Bacteria 2015
33 Ga0006562J51391_1041255 3300003578 Bacteria 1347
34 Ga0006562J51391_1049985 3300003578 Bacteria 1500
35 Ga0006562J51391_1049987 3300003578 Bacteria 880
36 Ga0055532_1010136 3300003758 Bacteria 1131
37 Ga0055535_1002183 3300003761 Bacteria 7482
38 Ga0055542_1000583 3300003762 Bacteria 31637
39 Ga0055526_1002127 3300003771 Bacteria 13599
40 Ga0055526_1008955 3300003771 Bacteria 4902
41 Ga0055526_1024178 3300003771 Bacteria 1999
42 Ga0055526_1024290 3300003771 Bacteria 1988
43 Ga0055526_1027178 3300003771 Bacteria 1777
44 Ga0055526_1033320 3300003771 Bacteria 1432
45 Ga0055537_1000049 3300003773 Bacteria 87244
46 Ga0055537_1000779 3300003773 Bacteria 16033
47 Ga0055537_1007736 3300003773 Bacteria 2553
48 Ga0055537_1010200 3300003773 Bacteria 1999
49 Ga0055537_1010260 3300003773 Bacteria 1988
50 Ga0055524_1000120 3300003775 Bacteria 91299
51 Ga0055524_1000247 3300003775 Bacteria 56379
52 Ga0055524_1023266 3300003775 Bacteria 1999
53 Ga0055536_1001351 3300003781 Bacteria 14939
54 Ga0055536_1002957 3300003781 Bacteria 9316
55 Ga0055536_1011940 3300003781 Bacteria 3272
56 Ga0055536_1015377 3300003781 Bacteria 2624
57 Ga0055536_1019458 3300003781 Bacteria 2133
58 Ga0055534_1000049 3300003784 Bacteria 92974
59 Ga0055534_1001408 3300003784 Bacteria 9598
60 Ga0055534_1010119 3300003784 Bacteria 1999
61 Ga0055528_1001145 3300003790 Bacteria 17246
62 Ga0055528_1002656 3300003790 Bacteria 9437
63 Ga0055528_1022011 3300003790 Bacteria 1999
64 Ga0055528_1022152 3300003790 Bacteria 1988
65 Ga0055528_1026378 3300003790 Bacteria 1670
66 Ga0055530_10001709 3300003791 Bacteria 15489
67 Ga0055530_10003781 3300003791 Bacteria 8345
68 Ga0055530_10010625 3300003791 Bacteria 3380
69 Ga0055530_10013164 3300003791 Bacteria 2838
70 Ga0055540_1000067 3300003792 Bacteria 122108
71 Ga0055540_1000260 3300003792 Bacteria 47714
72 Ga0055540_1006805 3300003792 Bacteria 4458
73 Ga0055540_1007545 3300003792 Bacteria 4077
74 Ga0055540_1009661 3300003792 Bacteria 3301
75 Ga0055540_1012700 3300003792 Bacteria 2624
76 Ga0055540_1017793 3300003792 Bacteria 1971
77 Ga0055531_10001090 3300003794 Bacteria 21279
78 Ga0055531_10001465 3300003794 Bacteria 17364
79 Ga0055531_10001523 3300003794 Bacteria 16987
80 Ga0055531_10006230 3300003794 Bacteria 6813
81 Ga0055531_10018314 3300003794 Bacteria 2897
82 Ga0055531_10019468 3300003794 Bacteria 2743
83 Ga0055531_10027088 3300003794 Bacteria 2023
84 Ga0055543_1000202 3300004625 Bacteria 48648
85 Ga0055543_1009803 3300004625 Bacteria 2037
86 Ga0065165_1001775 3300005262 Bacteria 21338
87 Ga0065165_1005815 3300005262 Bacteria 6728
88 Ga0065165_1014928 3300005262 Bacteria 2991
89 Ga0065165_1024230 3300005262 Bacteria 2042
90 Ga0065165_1050712 3300005262 Bacteria 1180
91 Ga0065165_1061976 3300005262 Bacteria 1021
92 Ga0065714_10014213 3300005288 Bacteria 2291
93 Ga0065704_10076112 3300005289 Bacteria 5260
94 Ga0070658_10629042 3300005327 Bacteria 931
95 Ga0068869_100174378 3300005334 Bacteria 1682
96 Ga0068868_100338173 3300005338 Bacteria 1286
97 Ga0068868_100974123 3300005338 Bacteria 774
98 Ga0070660_100201923 3300005339 Bacteria 1613
99 Ga0070661_100000361 3300005344 Bacteria 35932
100 Ga0070661_100021114 3300005344 Bacteria 4649
101 Ga0070661_100162841 3300005344 Bacteria 1690
102 Ga0070668_100107656 3300005347 Bacteria 2216
103 Ga0070669_100032646 3300005353 Bacteria 3761
104 Ga0070675_100415574 3300005354 Bacteria 1202
105 Ga0070674_100089594 3300005356 Bacteria 2217
106 Ga0070673_100145557 3300005364 Bacteria 2002
107 Ga0070673_100192083 3300005364 Bacteria 1754
108 Ga0070673_100368749 3300005364 Bacteria 1278
109 Ga0070673_100397158 3300005364 Bacteria 1232
110 Ga0070659_100002940 3300005366 Bacteria 12145
111 Ga0070710_10191055 3300005437 Bacteria 1288
112 Ga0070678_100050277 3300005456 Bacteria 3014
113 Ga0070678_100597495 3300005456 Bacteria 985
114 Ga0070678_100602417 3300005456 Bacteria 981
115 Ga0070662_100001973 3300005457 Bacteria 12604
116 Ga0068853_100084615 3300005539 Bacteria 2779
117 Ga0068853_100176055 3300005539 Bacteria 1938
118 Ga0068853_100203649 3300005539 Bacteria 1801
119 Ga0070672_100105050 3300005543 Bacteria 2296
120 Ga0068855_100610875 3300005563 Bacteria 1175
121 Ga0070664_100012768 3300005564 Bacteria 6834
122 Ga0070664_100031855 3300005564 Bacteria 4408
123 Ga0068857_100107264 3300005577 Bacteria 2508
124 Ga0068857_100362586 3300005577 Bacteria 1343
125 Ga0068854_100157576 3300005578 Bacteria 1756
126 Ga0068854_101000924 3300005578 Bacteria 740
127 Ga0068854_101087652 3300005578 Bacteria 712
128 Ga0068852_100016390 3300005616 Bacteria 5776
129 Ga0068852_100229803 3300005616 Bacteria 1768
130 Ga0068851_10014139 3300005834 Bacteria 3786
131 Ga0068858_100804872 3300005842 Bacteria 917
132 Ga0068862_100011728 3300005844 Bacteria 7234
133 Ga0075365_10024063 3300006038 Bacteria 3837
134 Ga0075363_100086618 3300006048 Bacteria 1720
135 Ga0075364_10069982 3300006051 Bacteria 2309
136 Ga0075364_10075286 3300006051 Bacteria 2227
137 Ga0075364_10132379 3300006051 Bacteria 1674
138 Ga0075432_10007264 3300006058 Bacteria 3773
139 Ga0075432_10065093 3300006058 Bacteria 1303
140 Ga0075432_10107833 3300006058 Bacteria 1035
141 Ga0075362_10014486 3300006177 Bacteria 3184
142 Ga0075362_10028411 3300006177 Bacteria 2402
143 Ga0075362_10031463 3300006177 Bacteria 2296
144 Ga0075362_10048721 3300006177 Bacteria 1891
145 Ga0075362_10209693 3300006177 Bacteria 950
146 Ga0075367_10092119 3300006178 Bacteria 1845
147 Ga0075367_10150449 3300006178 Bacteria 1444
148 Ga0075367_10437290 3300006178 Bacteria 829
149 Ga0075369_10023885 3300006186 Bacteria 2530
150 Ga0075366_10009278 3300006195 Bacteria 5493
151 Ga0075366_10017692 3300006195 Bacteria 4107
152 Ga0075366_10056332 3300006195 Bacteria 2335
153 Ga0075366_10140381 3300006195 Bacteria 1460
154 Ga0097621_100388322 3300006237 Bacteria 1248
155 Ga0097621_100459103 3300006237 Bacteria 1148
156 Ga0075370_10000282 3300006353 Bacteria 18351
157 Ga0075370_10000918 3300006353 Bacteria 12102
158 Ga0075370_10018552 3300006353 Bacteria 3777
159 Ga0075370_10028661 3300006353 Bacteria 3096
160 Ga0075370_10047822 3300006353 Bacteria 2422
161 Ga0075370_10132707 3300006353 Bacteria 1454
162 Ga0075429_100488514 3300006880 Bacteria 1079
163 Ga0068865_100572676 3300006881 Bacteria 951
164 Ga0079104_1000055 3300006946 Bacteria 166522
165 Ga0079104_1000714 3300006946 Bacteria 30116
166 Ga0105244_10004556 3300009036 Bacteria 9491
167 Ga0105250_10000934 3300009092 Bacteria 17188
168 Ga0105240_10281395 3300009093 Bacteria 1910
169 Ga0105240_10651654 3300009093 Bacteria 1154
170 Ga0105245_10197255 3300009098 Bacteria 1932
171 Ga0105243_10003653 3300009148 Bacteria 12382
172 Ga0105243_10012778 3300009148 Bacteria 6342
173 Ga0105241_10056465 3300009174 Bacteria 3010
174 Ga0105242_10002298 3300009176 Bacteria 15099
175 Ga0105242_10051506 3300009176 Bacteria 3355
176 Ga0105248_10409986 3300009177 Bacteria 1526
177 Ga0105237_10121150 3300009545 Bacteria 2611
178 Ga0105238_10235490 3300009551 Bacteria 1808
179 Ga0105239_10146308 3300010375 Bacteria 2635
180 Ga0105239_10499729 3300010375 Bacteria 1382
181 Ga0105246_10086033 3300011119 Bacteria 2253
182 Ga0105246_10170122 3300011119 Bacteria 1668
183 Ga0105246_10194393 3300011119 Bacteria 1573
184 Ga0105246_10209400 3300011119 Bacteria 1521
185 Ga0157326_1001779 3300012513 Bacteria 2350
186 Ga0157373_10055234 3300013100 Bacteria 2821
187 Ga0157373_10081013 3300013100 Bacteria 2289
188 Ga0157371_10141288 3300013102 Bacteria 1715
189 Ga0157370_10003589 3300013104 Bacteria 18150
190 Ga0157369_10037069 3300013105 Bacteria 5340
191 Ga0157374_10103917 3300013296 Bacteria 2727
192 Ga0163162_10186099 3300013306 Bacteria 2204
193 Ga0163162_10542396 3300013306 Bacteria 1292
194 Ga0157372_10043961 3300013307 Bacteria 4948
195 Ga0157375_10317222 3300013308 Bacteria 1723
196 Ga0157375_10656933 3300013308 Bacteria 1204
197 Ga0182008_10002011 3300014497 Bacteria 13053
198 Ga0182008_10003005 3300014497 Bacteria 10376
199 Ga0182008_10010313 3300014497 Bacteria 5003
200 Ga0182008_10049350 3300014497 Bacteria 2089
201 Ga0157376_10002202 3300014969 Bacteria 13148
202 Ga0182006_1028312 3300015261 Bacteria 2279
203 Ga0182006_1085716 3300015261 Bacteria 1142
204 Ga0182006_1109726 3300015261 Bacteria 970
205 Ga0182007_10000674 3300015262 Bacteria 19632
206 Ga0182007_10008930 3300015262 Bacteria 4082
207 Ga0182005_1067553 3300015265 Bacteria 980
208 Ga0183362_10005 3300015683 Bacteria 437616
209 Ga0163161_10000114 3300017792 Bacteria 76397
210 Ga0163161_10101536 3300017792 Bacteria 2141
211 Ga0163161_10122410 3300017792 Bacteria 1956
212 Ga0163161_10129392 3300017792 Bacteria 1903
213 Ga0163161_10268375 3300017792 Bacteria 1335
214 Ga0163161_10454163 3300017792 Bacteria 1036
215 Ga0213872_10004249 3300021361 Bacteria 7679
216 Ga0209435_100003 3300025206 Bacteria 669534
217 Ga0209436_106469 3300025208 Bacteria 2562
218 Ga0209436_109896 3300025208 Bacteria 1780
219 Ga0209672_104078 3300025228 Bacteria 2812
220 Ga0209147_105455 3300025229 Bacteria 1899
221 Ga0209258_100568 3300025242 Bacteria 31666
222 Ga0207425_1001221 3300025245 Bacteria 11309
223 Ga0207425_1002159 3300025245 Bacteria 7193
224 Ga0207425_1011740 3300025245 Bacteria 2075
225 Ga0207425_1012211 3300025245 Bacteria 2022
226 Ga0209646_1000008 3300025246 Bacteria 669534
227 Ga0209026_1000007 3300025250 Bacteria 669534
228 Ga0209148_1000033 3300025254 Bacteria 555508
229 Ga0209759_1000019 3300025256 Bacteria 357908
230 Ga0209129_1000227 3300025258 Bacteria 63512
231 Ga0209129_1000294 3300025258 Bacteria 47351
232 Ga0209129_1006379 3300025258 Bacteria 3832
233 Ga0209129_1010140 3300025258 Bacteria 2387
234 Ga0209129_1011664 3300025258 Bacteria 2082
235 Ga0209565_1000020 3300025263 Bacteria 432627
236 Ga0209565_1000116 3300025263 Bacteria 114340
237 Ga0209565_1000171 3300025263 Bacteria 84566
238 Ga0209565_1005961 3300025263 Bacteria 3486
239 Ga0209565_1009957 3300025263 Bacteria 2379
240 Ga0209673_1000295 3300025273 Bacteria 92499
241 Ga0209673_1001210 3300025273 Bacteria 27444
242 Ga0209673_1001360 3300025273 Bacteria 24264
243 Ga0209673_1001942 3300025273 Bacteria 16305
244 Ga0209673_1020479 3300025273 Bacteria 2340
245 Ga0209673_1029925 3300025273 Bacteria 1725
246 Ga0209673_1032115 3300025273 Bacteria 1622
247 Ga0209130_1000095 3300025284 Bacteria 145126
248 Ga0209130_1000134 3300025284 Bacteria 119102
249 Ga0209130_1000193 3300025284 Bacteria 84550
250 Ga0209130_1000560 3300025284 Bacteria 36900
251 Ga0209675_1000014 3300025291 Bacteria 421902
252 Ga0209675_1001804 3300025291 Bacteria 11691
253 Ga0209675_1003215 3300025291 Bacteria 7913
254 Ga0209675_1008491 3300025291 Bacteria 3765
255 Ga0209675_1012282 3300025291 Bacteria 2771
256 Ga0209675_1017248 3300025291 Bacteria 2068
257 Ga0209675_1026281 3300025291 Bacteria 1451
258 Ga0209676_1000048 3300025292 Bacteria 403716
259 Ga0209676_1000098 3300025292 Bacteria 234305
260 Ga0209676_1000124 3300025292 Bacteria 194206
261 Ga0209676_1000145 3300025292 Bacteria 174391
262 Ga0209676_1016118 3300025292 Bacteria 2716
263 Ga0209676_1022886 3300025292 Bacteria 2058
264 Ga0209676_1027050 3300025292 Bacteria 1810
265 Ga0209025_1000204 3300025294 Bacteria 142193
266 Ga0209025_1000264 3300025294 Bacteria 123411
267 Ga0209025_1000348 3300025294 Bacteria 100228
268 Ga0209025_1003744 3300025294 Bacteria 13938
269 Ga0209025_1005205 3300025294 Bacteria 10733
270 Ga0209025_1009410 3300025294 Bacteria 6812
271 Ga0209025_1017213 3300025294 Bacteria 4193
272 Ga0209025_1019826 3300025294 Bacteria 3716
273 Ga0209025_1024711 3300025294 Bacteria 3090
274 Ga0209025_1068041 3300025294 Bacteria 1282
275 Ga0209564_1000231 3300025295 Bacteria 123417
276 Ga0209564_1000300 3300025295 Bacteria 98386
277 Ga0209564_1000728 3300025295 Bacteria 46991
278 Ga0209564_1001669 3300025295 Bacteria 21246
279 Ga0209564_1006632 3300025295 Bacteria 6186
280 Ga0209758_1000222 3300025297 Bacteria 123411
281 Ga0209758_1000453 3300025297 Bacteria 68482
282 Ga0209758_1000605 3300025297 Bacteria 55552
283 Ga0209758_1015212 3300025297 Bacteria 4008
284 Ga0209758_1025105 3300025297 Bacteria 2626
285 Ga0209758_1047085 3300025297 Bacteria 1548
286 Ga0209050_1000012 3300025298 Bacteria 813717
287 Ga0209050_1000023 3300025298 Bacteria 537172
288 Ga0209050_1000252 3300025298 Bacteria 115215
289 Ga0209050_1003801 3300025298 Bacteria 10778
290 Ga0209050_1003829 3300025298 Bacteria 10730
291 Ga0209256_1000003 3300025299 Bacteria 1661127
292 Ga0209256_1000049 3300025299 Bacteria 310696
293 Ga0209256_1000095 3300025299 Bacteria 206120
294 Ga0209256_1000749 3300025299 Bacteria 42336
295 Ga0209256_1024835 3300025299 Bacteria 1757
296 Ga0209256_1040713 3300025299 Bacteria 1185
297 Ga0207426_1000058 3300025302 Bacteria 363857
298 Ga0207426_1000349 3300025302 Bacteria 84546
299 Ga0207426_1000397 3300025302 Bacteria 73966
300 Ga0207426_1001961 3300025302 Bacteria 14639
301 Ga0209051_1000017 3300025303 Bacteria 537172
302 Ga0209051_1000019 3300025303 Bacteria 511268
303 Ga0209051_1000098 3300025303 Bacteria 165284
304 Ga0209051_1000099 3300025303 Bacteria 165161
305 Ga0209051_1000247 3300025303 Bacteria 91122
306 Ga0209051_1000456 3300025303 Bacteria 54000
307 Ga0209051_1000579 3300025303 Bacteria 43794
308 Ga0209051_1067993 3300025303 Bacteria 1086
309 Ga0209051_1086562 3300025303 Bacteria 886
310 Ga0209257_1000015 3300025304 Bacteria 908141
311 Ga0209257_1000024 3300025304 Bacteria 726068
312 Ga0209257_1000041 3300025304 Bacteria 537172
313 Ga0209257_1000141 3300025304 Bacteria 201130
314 Ga0209257_1000258 3300025304 Bacteria 122220
315 Ga0209257_1006531 3300025304 Bacteria 7455
316 Ga0209257_1021034 3300025304 Bacteria 2385
317 Ga0207656_10136058 3300025321 Bacteria 1155
318 Ga0207696_1002314 3300025711 Bacteria 9448
319 Ga0207655_1008069 3300025728 Bacteria 6743
320 Ga0207682_10081227 3300025893 Bacteria 1390
321 Ga0207645_10030133 3300025907 Bacteria 3496
322 Ga0207657_10333452 3300025919 Bacteria 1198
323 Ga0207649_10000335 3300025920 Bacteria 35710
324 Ga0207681_10011235 3300025923 Bacteria 5500
325 Ga0207681_10263225 3300025923 Bacteria 1351
326 Ga0207694_10664360 3300025924 Bacteria 878
327 Ga0207650_10291841 3300025925 Bacteria 1330
328 Ga0207690_10000176 3300025932 Bacteria 49560
329 Ga0207706_10005101 3300025933 Bacteria 12262
330 Ga0207706_10474020 3300025933 Bacteria 1082
331 Ga0207686_10011578 3300025934 Bacteria 4833
332 Ga0207686_10470623 3300025934 Bacteria 970
333 Ga0207709_10000331 3300025935 Bacteria 50983
334 Ga0207709_10000728 3300025935 Bacteria 26361
335 Ga0207709_10007073 3300025935 Bacteria 6272
336 Ga0207669_10317294 3300025937 Bacteria 1191
337 Ga0207669_10587753 3300025937 Bacteria 903
338 Ga0207691_10050413 3300025940 Bacteria 3811
339 Ga0207691_10225673 3300025940 Bacteria 1623
340 Ga0207689_10317804 3300025942 Bacteria 1292
341 Ga0207679_10000168 3300025945 Bacteria 54187
342 Ga0207679_10698259 3300025945 Bacteria 920
343 Ga0207667_10210076 3300025949 Bacteria 1995
344 Ga0207667_10474508 3300025949 Bacteria 1270
345 Ga0207651_10144391 3300025960 Bacteria 1843
346 Ga0207651_10160010 3300025960 Bacteria 1764
347 Ga0207651_10332355 3300025960 Bacteria 1274
348 Ga0207668_10302357 3300025972 Bacteria 1321
349 Ga0207658_10054381 3300025986 Bacteria 2962
350 Ga0207677_10112838 3300026023 Bacteria 2028
351 Ga0207677_10445882 3300026023 Bacteria 1108
352 Ga0207639_10114287 3300026041 Bacteria 2206
353 Ga0207639_10141709 3300026041 Bacteria 2003
354 Ga0207639_10164284 3300026041 Bacteria 1874
355 Ga0207648_10065975 3300026089 Bacteria 3156
356 Ga0207676_11259737 3300026095 Bacteria 734
357 Ga0207674_10133308 3300026116 Bacteria 2447
358 Ga0207683_10061823 3300026121 Bacteria 3297
359 Ga0207683_10111598 3300026121 Bacteria 2448
360 Ga0207683_10372091 3300026121 Bacteria 1313
361 Ga0207698_10029695 3300026142 Bacteria 3919
362 Ga0207698_10173197 3300026142 Bacteria 1903
363 Ga0209281_1000007 3300027111 Bacteria 938265
364 Ga0209281_1001190 3300027111 Bacteria 17791
365 Ga0209970_1000068 3300027614 Bacteria 14109
366 Ga0209282_1000501 3300027666 Bacteria 19021
367 Ga0209971_1002743 3300027682 Bacteria 4207
368 Ga0209998_10012096 3300027717 Bacteria 1791
369 Ga0209974_10025576 3300027876 Bacteria 1954
370 Ga0207428_10472031 3300027907 Bacteria 913
371 Ga0268266_10017420 3300028379 Bacteria 6127
372 Ga0268265_10024287 3300028380 Bacteria 4287
373 Ga0268265_10045754 3300028380 Bacteria 3268
374 Ga0307515_10000040 3300028794 Bacteria 322704
375 Ga0307515_10000257 3300028794 Bacteria 131732
376 Ga0307515_10235199 3300028794 Bacteria 1615
377 Ga0307512_10122949 3300030522 Bacteria 1659
378 Ga0316176_1014050 3300030732 Bacteria 1792
379 Ga0314311_1003705 3300030733 Bacteria 9220
380 Ga0316178_1010462 3300030735 Bacteria 4027
381 Ga0316183_1067419 3300030742 Bacteria 8873
382 Ga0316181_1007566 3300030744 Bacteria 1026
383 Ga0316182_1188730 3300030745 Bacteria 1381
384 Ga0265330_10000046 3300031235 Bacteria 108853
385 Ga0265332_10000005 3300031238 Bacteria 377525
386 Ga0265332_10000028 3300031238 Bacteria 184029
387 Ga0265320_10079453 3300031240 Bacteria 1533
388 Ga0265325_10001397 3300031241 Bacteria 17039
389 Ga0265340_10037610 3300031247 Bacteria 2397
390 Ga0265327_10000235 3300031251 Bacteria 111362
391 Ga0265327_10001208 3300031251 Bacteria 34808
392 Ga0265327_10037618 3300031251 Bacteria 2647
393 Ga0265316_10000332 3300031344 Bacteria 52832
394 Ga0307513_10000113 3300031456 Bacteria 114576
395 Ga0307513_10004582 3300031456 Bacteria 18428
396 Ga0307513_10011506 3300031456 Bacteria 10991
397 Ga0307513_10361629 3300031456 Bacteria 1196
398 Ga0307408_100000101 3300031548 Bacteria 94089
399 Ga0307408_100013522 3300031548 Bacteria 5417
400 Ga0307408_100102668 3300031548 Bacteria 2181
401 Ga0307408_100167065 3300031548 Bacteria 1753
402 Ga0307408_100650033 3300031548 Bacteria 943
403 Ga0307514_10000928 3300031649 Bacteria 44600
404 Ga0307514_10133587 3300031649 Bacteria 1703
405 Ga0265314_10000054 3300031711 Bacteria 184029
406 Ga0307516_10058267 3300031730 Bacteria 3760
407 Ga0307516_10063255 3300031730 Bacteria 3583
408 Ga0307405_10008898 3300031731 Bacteria 5119
409 Ga0307405_10080257 3300031731 Bacteria 2129
410 Ga0307413_10287365 3300031824 Bacteria 1240
411 Ga0307410_10185345 3300031852 Bacteria 1579
412 Ga0307406_10000497 3300031901 Bacteria 22565
413 Ga0307406_10031294 3300031901 Bacteria 3238
414 Ga0307407_10210180 3300031903 Bacteria 1309
415 Ga0307412_10008057 3300031911 Bacteria 6003
416 Ga0307412_10052422 3300031911 Bacteria 2701
417 Ga0307412_10237912 3300031911 Bacteria 1406
418 Ga0307412_10260067 3300031911 Bacteria 1352
419 Ga0307412_10293715 3300031911 Bacteria 1281
420 Ga0307412_10465026 3300031911 Bacteria 1045
421 Ga0307412_10640307 3300031911 Bacteria 905
422 Ga0307409_100738712 3300031995 Bacteria 987
423 Ga0307416_100106996 3300032002 Bacteria 2453
424 Ga0307416_100126451 3300032002 Bacteria 2290
425 Ga0307416_100216767 3300032002 Bacteria 1831
426 Ga0307416_100334462 3300032002 Bacteria 1524
427 Ga0307414_10290726 3300032004 Bacteria 1377
428 Ga0307411_10053721 3300032005 Bacteria 2641
429 Ga0307411_10062461 3300032005 Bacteria 2485
430 Ga0307411_11033111 3300032005 Bacteria 737
431 Ga0307415_100239472 3300032126 Bacteria 1467
432 Ga0395899_0006932 3300037312 Bacteria 8777
433 Ga0395900_0032376 3300037418 Bacteria 5377
434 Ga0395900_0036214 3300037418 Bacteria 5086
435 Ga0395898_0023156 3300037466 Bacteria 6278
436 Ga0395898_0035122 3300037466 Bacteria 4989
437 Ga0395905_0000212 3300037471 Bacteria 89838
438 Ga0395905_0000607 3300037471 Bacteria 47962
439 Ga0395905_0004023 3300037471 Bacteria 15426
440 Ga0395905_0099475 3300037471 Bacteria 2731
441 Ga0395905_0134600 3300037471 Bacteria 2324
442 Ga0395905_0392916 3300037471 Bacteria 1281
443 Ga0395905_0493229 3300037471 Bacteria 1125
444 Ga0395905_0665289 3300037471 Bacteria 943
445 Ga0395901_0133122 3300038443 Bacteria 2612
446 Ga0395901_0141343 3300038443 Bacteria 2530
447 Ga0395901_0161929 3300038443 Bacteria 2350
448 Ga0436361_0247854 3300039447 Bacteria 31958
449 Ga0439436_0000562 3300041404 Bacteria 9794
450 Ga0439436_0002238 3300041404 Bacteria 5788
451 Ga0439436_0022773 3300041404 Bacteria 1855
452 Ga0439438_022578 3300041405 Bacteria 1744
453 Ga0439439_0008098 3300041406 Bacteria 2472
454 Ga0439439_0019130 3300041406 Bacteria 1697
455 Ga0439466_0010304 3300041411 Bacteria 3475
456 Ga0439466_0014211 3300041411 Bacteria 2902
457 Ga0439466_0022944 3300041411 Bacteria 2198
458 Ga0439465_0000277 3300041413 Bacteria 14344
459 Ga0439465_0122542 3300041413 Bacteria 912
460 Ga0451791_1838390 3300041451 Bacteria 3287
461 Ga0451793_1782101 3300041452 Bacteria 1192
462 Ga0451795_0347533 3300041456 Bacteria 996
463 Ga0451795_0584715 3300041456 Bacteria 2323
464 Ga0451802_0579892 3300041460 Bacteria 913
465 Ga0451807_0649746 3300041486 Bacteria 1023
466 Ga0451807_0729911 3300041486 Bacteria 1160
467 Ga0451807_2730351 3300041486 Bacteria 1305
468 Ga0451853_1882879 3300041512 Bacteria 759
469 Ga0439433_0001048 3300041999 Bacteria 5613
470 Ga0439437_008399 3300042000 Bacteria 1161
471 Ga0439437_011307 3300042000 Bacteria 1022
472 Ga0439441_039044 3300042001 Bacteria 946
473 Ga0439442_007320 3300042002 Bacteria 2219
474 Ga0439445_0000763 3300042004 Bacteria 6751
475 Ga0439445_0020134 3300042004 Bacteria 1668
476 Ga0439445_0109876 3300042004 Bacteria 786
477 Ga0439432_001936 3300042006 Bacteria 7821
478 Ga0439432_003064 3300042006 Bacteria 6225
479 Ga0439432_039445 3300042006 Bacteria 1501
480 Ga0439449_0000120 3300042007 Bacteria 25953
481 Ga0439449_0000453 3300042007 Bacteria 15268
482 Ga0439449_0002248 3300042007 Bacteria 7592
483 Ga0439449_0080899 3300042007 Bacteria 1198
484 Ga0439452_002310 3300042010 Bacteria 7105
485 Ga0439452_011741 3300042010 Bacteria 2509
486 Ga0439462_0004564 3300042015 Bacteria 3387
487 Ga0439462_0008753 3300042015 Bacteria 2558
488 Ga0439462_0010910 3300042015 Bacteria 2307
489 Ga0439462_0079854 3300042015 Bacteria 893
490 Ga0439462_0092446 3300042015 Bacteria 831
491 Ga0439463_097418 3300042016 Bacteria 758
492 Ga0450911_000351 3300042115 Bacteria 15672
493 Ga0450919_001118 3300042121 Bacteria 3472
494 Ga0450923_007069 3300042125 Bacteria 1884
495 Ga0450923_025754 3300042125 Bacteria 1174
496 Ga0450888_006212 3300042126 Bacteria 1294
497 Ga0450890_006779 3300042127 Bacteria 1462
498 Ga0450890_009757 3300042127 Bacteria 1233
499 Ga0450894_010502 3300042131 Bacteria 1201
500 Ga0450896_002703 3300042133 Bacteria 2309
501 Ga0450898_004060 3300042134 Bacteria 2140
502 Ga0450898_004975 3300042134 Bacteria 1989
503 Ga0450898_008896 3300042134 Bacteria 1597
504 Ga0450899_009056 3300042135 Bacteria 1094
505 Ga0450906_000192 3300042145 Bacteria 11600
506 Ga0450906_016518 3300042145 Bacteria 1335
507 Ga0450910_001673 3300042147 Bacteria 2843
508 Ga0450908_000821 3300042184 Bacteria 5979
509 Ga0450908_002821 3300042184 Bacteria 3377
510 Ga0439434_0000289 3300042435 Bacteria 14374
511 Ga0439434_0028083 3300042435 Bacteria 1703
512 Ga0439434_0120115 3300042435 Bacteria 856
513 Ga0439464_0054046 3300042439 Bacteria 1166
514 Ga0450918_000077 3300042531 Bacteria 20527
515 Ga0450918_000437 3300042531 Bacteria 8985
516 Ga0451577_0029663 3300042876 Bacteria 4944
517 Ga0451577_0679486 3300042876 Bacteria 933
518 Ga0466969_0017993 3300044656 Bacteria 3686
519 Ga0466969_0049594 3300044656 Bacteria 2071
520 Ga0466972_0059783 3300044658 Bacteria 1829
521 Ga0453683_0001887 3300044673 Bacteria 17174
522 Ga0453683_0003653 3300044673 Bacteria 11274
523 Ga0466965_0007028 3300044683 Bacteria 5151
524 Ga0466966_0018603 3300044684 Bacteria 4578
525 Ga0466961_0014170 3300044693 Bacteria 5116
526 Ga0466961_0076262 3300044693 Bacteria 2125
527 Ga0453684_0018472 3300044712 Bacteria 10699
528 Ga0453684_0713528 3300044712 Bacteria 1089
529 Ga0466971_0346123 3300044719 Bacteria 719
530 Ga0466970_0201719 3300044765 Bacteria 1107
531 Ga0466957_0151992 3300044842 Bacteria 1498
532 Ga0466957_0257573 3300044842 Bacteria 1162
533 Ga0466957_0262072 3300044842 Bacteria 1152
534 Ga0466960_0469123 3300044901 Bacteria 734
535 Ga0466959_0088349 3300045049 Bacteria 2228
536 Ga0451576_0026738 3300045051 Bacteria 6203
537 Ga0451576_0120857 3300045051 Bacteria 2727
538 Ga0466967_0495772 3300045976 Bacteria 1198
539 Ga0495627_016376 3300046453 Bacteria 2538
540 Ga0495627_017833 3300046453 Bacteria 2404
541 Ga0495629_0146988 3300046459 Bacteria 1639
542 Ga0495638_0075820 3300046460 Bacteria 2049
543 Ga0495639_0016063 3300046475 Bacteria 3247
544 Ga0495616_0023910 3300046513 Bacteria 3283
545 Ga0495620_0019241 3300046515 Bacteria 3363
546 Ga0495631_0000927 3300046518 Bacteria 18232
547 Ga0495632_0005292 3300046519 Bacteria 8572
548 Ga0495637_0001152 3300046520 Bacteria 16212
549 Ga0495637_0061649 3300046520 Bacteria 1537
550 Ga0495643_0145643 3300046522 Bacteria 1177
551 Ga0495642_0002659 3300046528 Bacteria 7190
552 Ga0495642_0260407 3300046528 Bacteria 758
553 Ga0495654_0001504 3300046530 Bacteria 15939
554 Ga0495654_0044568 3300046530 Bacteria 2194
555 Ga0495654_0096826 3300046530 Bacteria 1363
556 Ga0495621_0031312 3300046539 Bacteria 1824
557 Ga0495622_0033391 3300046557 Bacteria 2402
558 Ga0495633_0001809 3300046558 Bacteria 15760
559 Ga0495633_0156063 3300046558 Bacteria 1053
560 Ga0495656_0002859 3300046615 Bacteria 5785
561 Ga0495625_0000045 3300046660 Bacteria 202475
562 Ga0495625_0041165 3300046660 Bacteria 3364
563 Ga0495635_0132374 3300046663 Bacteria 1700
564 Ga0495661_0087152 3300046665 Bacteria 1786
565 Ga0495588_0009189 3300046674 Bacteria 4563
566 Ga0495658_0012053 3300046683 Bacteria 4366
567 Ga0495669_0111828 3300046684 Bacteria 1276
568 Ga0495670_0048023 3300046691 Bacteria 2135
569 Ga0495671_0010658 3300046692 Bacteria 5085
570 Ga0495660_0326335 3300046810 Bacteria 688
571 Ga0495674_0086548 3300047319 Bacteria 2683
572 Ga0495676_0013815 3300047321 Bacteria 7239
573 Ga0495677_0057140 3300047445 Bacteria 1442
574 Ga0495677_0065683 3300047445 Bacteria 1349
575 Ga0495685_031458 3300047447 Bacteria 1824
576 Ga0495685_116524 3300047447 Bacteria 878
577 Ga0495593_0012980 3300047673 Bacteria 4758
578 Ga0495614_0049081 3300048089 Bacteria 1809
579 Ga0495615_0007612 3300048090 Bacteria 2062
580 Ga0495615_0018928 3300048090 Bacteria 1523
581 Ga0495615_0086480 3300048090 Bacteria 867
582 Ga0496100_0038094 3300048903 Bacteria 3044
583 Ga0496101_0024578 3300048904 Bacteria 4170
584 Ga0496102_0048128 3300048905 Bacteria 3876
585 Ga0496103_0039550 3300048906 Bacteria 2898
586 Ga0496104_0100676 3300048907 Bacteria 2766
587 Ga0496105_0047749 3300048908 Bacteria 3533
588 Ga0496106_0049724 3300048909 Bacteria 3159
589 Ga0496106_0248819 3300048909 Bacteria 1421
590 Ga0496107_0012575 3300048910 Bacteria 5911
591 Ga0496110_0132482 3300048913 Bacteria 2251
592 Ga0496110_0451658 3300048913 Bacteria 1171
593 Ga0496111_0046348 3300048914 Bacteria 3130
594 Ga0496114_0046024 3300048917 Bacteria 3625
595 Ga0496116_0043465 3300048919 Bacteria 3061
596 Ga0496116_0101509 3300048919 Bacteria 1717
597 Ga0496117_0014880 3300048920 Bacteria 6673
598 Ga0496117_0093107 3300048920 Bacteria 1934
599 Ga0496117_0100631 3300048920 Bacteria 1830
600 Ga0496117_0130005 3300048920 Bacteria 1528
601 Ga0496118_0015707 3300048921 Bacteria 6991
602 Ga0496118_0019070 3300048921 Bacteria 6148
603 Ga0496118_0409245 3300048921 Bacteria 702
604 Ga0496121_0049634 3300048924 Bacteria 3555
605 Ga0496121_0056714 3300048924 Bacteria 3251
606 Ga0496121_0143935 3300048924 Bacteria 1764
607 Ga0496122_0000331 3300048925 Bacteria 102617
608 Ga0496122_0088660 3300048925 Bacteria 2119
609 Ga0496122_0093309 3300048925 Bacteria 2042
610 Ga0496122_0162766 3300048925 Bacteria 1358
611 Ga0496122_0355111 3300048925 Bacteria 763
612 Ga0496123_0001132 3300048926 Bacteria 39831
613 Ga0496123_0036698 3300048926 Bacteria 3471
614 Ga0496123_0132987 3300048926 Bacteria 1374
615 Ga0496123_0137343 3300048926 Bacteria 1343
616 Ga0496124_0053987 3300048927 Bacteria 3403
617 Ga0496124_0089765 3300048927 Bacteria 2508
618 Ga0496124_0315773 3300048927 Bacteria 1121
619 Ga0496124_0323394 3300048927 Bacteria 1103
620 Ga0496124_0458238 3300048927 Bacteria 867
621 Ga0496125_0001189 3300048928 Bacteria 39370
622 Ga0496125_0024091 3300048928 Bacteria 5604
623 Ga0496125_0046129 3300048928 Bacteria 3659
624 Ga0496125_0085887 3300048928 Bacteria 2382
625 Ga0496125_0214612 3300048928 Bacteria 1246
626 Ga0496125_0292292 3300048928 Bacteria 1003
627 Ga0496126_0001477 3300048929 Bacteria 36534
628 Ga0496126_0057238 3300048929 Bacteria 3521
629 Ga0496126_0443543 3300048929 Bacteria 1046
630 Ga0496126_0940626 3300048929 Bacteria 652
631 Ga0501034_0622574 3300049571 Bacteria 983
632 Ga0501036_0218417 3300049572 Bacteria 1601
633 Ga0501047_0057504 3300049581 Bacteria 3761
634 Ga0501249_002182 3300049679 Bacteria 3988
635 Ga0501225_0092914 3300049705 Bacteria 875
636 Ga0501262_000434 3300049759 Bacteria 5015
637 Ga0501266_034053 3300049763 Bacteria 737
638 nmdc:mga03683_103713_c1 3300050489 Bacteria 1252
639 nmdc:mga03683_151260_c1 3300050489 Bacteria 1047
640 nmdc:mga03683_15696_c1 3300050489 Bacteria 2831
641 nmdc:mga03683_183083_c1 3300050489 Bacteria 956
642 nmdc:mga03683_235671_c1 3300050489 Bacteria 847
643 nmdc:mga03683_52700_c1 3300050489 Bacteria 1701
644 nmdc:mga03683_7472_c1 3300050489 Bacteria 3794
645 nmdc:mga03n38_19715_c1 3300050490 Bacteria 2684
646 nmdc:mga03n38_20085_c1 3300050490 Bacteria 2667
647 nmdc:mga03n38_98848_c1 3300050490 Bacteria 1404
648 nmdc:mga00v17_31009_c1 3300050491 Bacteria 3150
649 nmdc:mga00v17_51844_c1 3300050491 Bacteria 2495
650 nmdc:mga0yw44_38982_c1 3300050492 Bacteria 2814
651 nmdc:mga0yw44_43614_c1 3300050492 Bacteria 2679
652 nmdc:mga0k408_17127_c1 3300050493 Bacteria 4032
653 nmdc:mga0k408_197950_c1 3300050493 Bacteria 1199
654 nmdc:mga0k408_203247_c1 3300050493 Bacteria 1183
655 nmdc:mga0k408_40803_c1 3300050493 Bacteria 2672
656 nmdc:mga0k408_43251_c2 3300050493 Bacteria 703
657 nmdc:mga0k408_506192_c1 3300050493 Bacteria 715
658 nmdc:mga0k408_52414_c1 3300050493 Bacteria 2365
659 nmdc:mga0k408_59892_c1 3300050493 Bacteria 2212
660 nmdc:mga07m45_158071_c1 3300050496 Bacteria 1315
661 nmdc:mga07m45_161406_c1 3300050496 Bacteria 1301
662 nmdc:mga07m45_21021_c1 3300050496 Bacteria 3063
663 nmdc:mga07m45_30257_c1 3300050496 Bacteria 2998
664 nmdc:mga07m45_53694_c1 3300050496 Bacteria 2277
665 nmdc:mga07m45_59868_c1 3300050496 Bacteria 2155
666 nmdc:mga09592_20553_c1 3300050508 Bacteria 5431
667 nmdc:mga0qj67_153805_c1 3300050509 Bacteria 1866
668 nmdc:mga0sz30_39319_c1 3300050516 Bacteria 1984
669 Ga0500610_0001980 3300053079 Bacteria 7301
670 Ga0500610_0006936 3300053079 Bacteria 4802
671 Ga0500578_0000025 3300053086 Bacteria 151485
672 Ga0500646_0019599 3300053090 Bacteria 1790
673 Ga0500651_0000112 3300053093 Bacteria 49988
674 Ga0500651_0013143 3300053093 Bacteria 5034
675 Ga0500651_0062947 3300053093 Bacteria 2316
676 Ga0500566_0186619 3300053094 Bacteria 1059
677 Ga0500641_0087128 3300053096 Bacteria 1330
678 Ga0500569_071464 3300053109 Bacteria 1093
679 Ga0500571_027167 3300053110 Bacteria 3165
680 Ga0500572_098750 3300053111 Bacteria 932
681 Ga0500593_003265 3300053117 Bacteria 6104
682 Ga0500593_006316 3300053117 Bacteria 4735
683 Ga0500626_063714 3300053128 Bacteria 1647
684 Ga0500628_061466 3300053129 Bacteria 918
685 Ga0500628_125924 3300053129 Bacteria 699
686 Ga0500652_000177 3300053131 Bacteria 24784
687 Ga0500655_000471 3300053133 Bacteria 8190
688 Ga0500658_0001561 3300053134 Bacteria 9140
689 Ga0500658_0001686 3300053134 Bacteria 8759
690 Ga0500559_0012676 3300053136 Bacteria 3578
691 Ga0500559_0105712 3300053136 Bacteria 1301
692 Ga0500568_0002695 3300053139 Bacteria 10296
693 Ga0500568_0153622 3300053139 Bacteria 851
694 Ga0500622_0000087 3300053156 Bacteria 98385
695 Ga0500622_0067097 3300053156 Bacteria 1820
696 Ga0500634_0055091 3300053161 Bacteria 2129
697 Ga0500638_000683 3300053162 Bacteria 8972
698 Ga0500625_081534 3300053729 Bacteria 1411
699 Ga0500645_000661 3300053730 Bacteria 21613
700 Ga0500645_031433 3300053730 Bacteria 1595
701 Ga0500661_001056 3300055283 Bacteria 5200
702 Ga0590075_014569 3300059424 Bacteria 1923

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10191055 Ga0070710_101910552 186
2 3300047319 Ga0495674_0086548 Ga0495674_0086548_544_1149 186
3 3300005364 Ga0070673_100368749 Ga0070673_1003687492 188
4 3300005543 Ga0070672_100105050 Ga0070672_1001050503 188
5 3300025893 Ga0207682_10081227 Ga0207682_100812272 188
6 3300025923 Ga0207681_10263225 Ga0207681_102632251 188
7 3300025940 Ga0207691_10225673 Ga0207691_102256732 188
8 3300025972 Ga0207668_10302357 Ga0207668_103023572 188
9 3300041512 Ga0451853_1882879 Ga0451853_1882879_40_705 188
10 3300005262 Ga0065165_1001775 Ga0065165_100177522 189
11 3300048910 Ga0496107_0012575 Ga0496107_0012575_202_780 189
12 iso_pu_bacteria 2547132374 2548498969 189
13 iso_pu_bacteria 2585428057 2587725541 189
14 iso_pu_bacteria 2643221570 2643867813 189
15 iso_pu_bacteria 2643221592 2643970056 189
16 iso_pu_bacteria 2643221596 2643991677 189
17 iso_pu_bacteria 2643221625 2644142970 189
18 iso_pu_bacteria 2643221648 2644271970 189
19 iso_pu_bacteria 2643221717 2644648428 189
20 iso_pu_bacteria 2721755523 2722882029 189
21 iso_pu_bacteria 2839138175 2839142538 189
22 iso_pu_bacteria 2932422444 2932426391 189
23 iso_pu_bacteria 2990710928 2990713877 189
24 3300006048 Ga0075363_100086618 Ga0075363_1000866183 190
25 3300006177 Ga0075362_10048721 Ga0075362_100487212 190
26 3300002773 JGI25152J39213_1000516 JGI25152J39213_100051620 191
27 3300002774 JGI25150J39212_1009352 JGI25150J39212_10093522 191
28 3300003215 JGI25153J46596_10003174 JGI25153J46596_100031743 191
29 3300003771 Ga0055526_1002127 Ga0055526_100212711 191
30 3300005344 Ga0070661_100162841 Ga0070661_1001628412 191
31 3300025245 Ga0207425_1001221 Ga0207425_10012214 191
32 3300025258 Ga0209129_1000294 Ga0209129_100029445 191
33 3300025273 Ga0209673_1032115 Ga0209673_10321152 191
34 3300025295 Ga0209564_1000300 Ga0209564_100030063 191
35 3300025297 Ga0209758_1000605 Ga0209758_100060544 191
36 3300031548 Ga0307408_100000101 Ga0307408_10000010146 191
37 3300031901 Ga0307406_10000497 Ga0307406_1000049721 191
38 3300032005 Ga0307411_10062461 Ga0307411_100624613 191
39 3300046528 Ga0495642_0002659 Ga0495642_0002659_4938_5546 191
40 3300046558 Ga0495633_0156063 Ga0495633_0156063_265_873 191
41 3300046665 Ga0495661_0087152 Ga0495661_0087152_250_858 191
42 3300047445 Ga0495677_0057140 Ga0495677_0057140_404_1012 191
43 3300047447 Ga0495685_031458 Ga0495685_031458_1199_1807 191
44 3300048909 Ga0496106_0248819 Ga0496106_0248819_397_1005 191
45 3300050489 nmdc:mga03683_183083_c1 nmdc:mga03683_183083_c1_52_672 191
46 3300003791 Ga0055530_10003781 Ga0055530_100037815 192
47 3300003792 Ga0055540_1000260 Ga0055540_100026025 192
48 3300003792 Ga0055540_1006805 Ga0055540_10068053 192
49 3300003794 Ga0055531_10001090 Ga0055531_1000109020 192
50 3300003794 Ga0055531_10006230 Ga0055531_100062307 192
51 3300006195 Ga0075366_10140381 Ga0075366_101403812 192
52 3300006353 Ga0075370_10000282 Ga0075370_1000028214 192
53 3300021361 Ga0213872_10004249 Ga0213872_100042497 192
54 3300025273 Ga0209673_1020479 Ga0209673_10204792 192
55 3300025298 Ga0209050_1003829 Ga0209050_100382913 192
56 3300025303 Ga0209051_1000247 Ga0209051_100024725 192
57 3300025303 Ga0209051_1000456 Ga0209051_10004563 192
58 3300025304 Ga0209257_1000015 Ga0209257_1000015837 192
59 3300025304 Ga0209257_1000141 Ga0209257_100014125 192
60 3300027717 Ga0209998_10012096 Ga0209998_100120962 192
61 3300028794 Ga0307515_10000257 Ga0307515_1000025743 192
62 3300031456 Ga0307513_10004582 Ga0307513_1000458211 192
63 3300031649 Ga0307514_10000928 Ga0307514_1000092811 192
64 3300031730 Ga0307516_10063255 Ga0307516_100632554 192
65 3300039447 Ga0436361_0247854 Ga0436361_0247854_18129_18773 192
66 3300044656 Ga0466969_0049594 Ga0466969_0049594_358_972 192
67 3300044693 Ga0466961_0076262 Ga0466961_0076262_357_971 192
68 3300044842 Ga0466957_0151992 Ga0466957_0151992_270_887 192
69 3300048929 Ga0496126_0940626 Ga0496126_0940626_28_636 192
70 3300050493 nmdc:mga0k408_506192_c1 nmdc:mga0k408_506192_c1_17_625 192
71 3300003775 Ga0055524_1000247 Ga0055524_100024729 193
72 3300005327 Ga0070658_10629042 Ga0070658_106290421 193
73 3300005338 Ga0068868_100338173 Ga0068868_1003381732 193
74 3300005338 Ga0068868_100974123 Ga0068868_1009741231 193
75 3300005344 Ga0070661_100000361 Ga0070661_1000003614 193
76 3300005366 Ga0070659_100002940 Ga0070659_1000029408 193
77 3300005563 Ga0068855_100610875 Ga0068855_1006108752 193
78 3300005564 Ga0070664_100012768 Ga0070664_1000127688 193
79 3300005578 Ga0068854_101000924 Ga0068854_1010009241 193
80 3300006195 Ga0075366_10009278 Ga0075366_100092785 193
81 3300006195 Ga0075366_10017692 Ga0075366_100176922 193
82 3300006880 Ga0075429_100488514 Ga0075429_1004885142 193
83 3300006946 Ga0079104_1000055 Ga0079104_100005585 193
84 3300006946 Ga0079104_1000714 Ga0079104_10007143 193
85 3300009092 Ga0105250_10000934 Ga0105250_100009345 193
86 3300009093 Ga0105240_10651654 Ga0105240_106516542 193
87 3300009098 Ga0105245_10197255 Ga0105245_101972552 193
88 3300009148 Ga0105243_10003653 Ga0105243_100036538 193
89 3300009174 Ga0105241_10056465 Ga0105241_100564653 193
90 3300013296 Ga0157374_10103917 Ga0157374_101039173 193
91 3300014969 Ga0157376_10002202 Ga0157376_100022023 193
92 3300025299 Ga0209256_1000049 Ga0209256_100004945 193
93 3300025711 Ga0207696_1002314 Ga0207696_10023149 193
94 3300025920 Ga0207649_10000335 Ga0207649_1000033529 193
95 3300025932 Ga0207690_10000176 Ga0207690_1000017638 193
96 3300025935 Ga0207709_10000728 Ga0207709_1000072813 193
97 3300025945 Ga0207679_10000168 Ga0207679_1000016824 193
98 3300025949 Ga0207667_10210076 Ga0207667_102100764 193
99 3300025949 Ga0207667_10474508 Ga0207667_104745082 193
100 3300026023 Ga0207677_10112838 Ga0207677_101128383 193
101 3300026023 Ga0207677_10445882 Ga0207677_104458822 193
102 3300027111 Ga0209281_1000007 Ga0209281_1000007744 193
103 3300027111 Ga0209281_1001190 Ga0209281_10011902 193
104 3300027614 Ga0209970_1000068 Ga0209970_100006812 193
105 3300027682 Ga0209971_1002743 Ga0209971_10027433 193
106 3300027876 Ga0209974_10025576 Ga0209974_100255763 193
107 3300031235 Ga0265330_10000046 Ga0265330_1000004650 193
108 3300031238 Ga0265332_10000028 Ga0265332_1000002862 193
109 3300031240 Ga0265320_10079453 Ga0265320_100794531 193
110 3300031241 Ga0265325_10001397 Ga0265325_1000139713 193
111 3300031247 Ga0265340_10037610 Ga0265340_100376102 193
112 3300031548 Ga0307408_100650033 Ga0307408_1006500331 193
113 3300031711 Ga0265314_10000054 Ga0265314_1000005462 193
114 3300031911 Ga0307412_10293715 Ga0307412_102937152 193
115 3300032002 Ga0307416_100216767 Ga0307416_1002167672 193
116 3300037466 Ga0395898_0023156 Ga0395898_0023156_4048_4671 193
117 3300037471 Ga0395905_0004023 Ga0395905_0004023_2178_2810 193
118 3300037471 Ga0395905_0099475 Ga0395905_0099475_564_1172 193
119 3300037471 Ga0395905_0134600 Ga0395905_0134600_599_1222 193
120 3300038443 Ga0395901_0141343 Ga0395901_0141343_1265_1891 193
121 3300038443 Ga0395901_0161929 Ga0395901_0161929_144_752 193
122 3300041486 Ga0451807_0729911 Ga0451807_0729911_180_788 193
123 3300042000 Ga0439437_008399 Ga0439437_008399_245_853 193
124 3300042000 Ga0439437_011307 Ga0439437_011307_26_634 193
125 3300042004 Ga0439445_0020134 Ga0439445_0020134_540_1175 193
126 3300042015 Ga0439462_0004564 Ga0439462_0004564_2441_3058 193
127 3300042016 Ga0439463_097418 Ga0439463_097418_61_693 193
128 3300042115 Ga0450911_000351 Ga0450911_000351_11017_11652 193
129 3300042125 Ga0450923_007069 Ga0450923_007069_162_779 193
130 3300042125 Ga0450923_025754 Ga0450923_025754_272_880 193
131 3300042126 Ga0450888_006212 Ga0450888_006212_125_733 193
132 3300042127 Ga0450890_006779 Ga0450890_006779_189_797 193
133 3300042134 Ga0450898_004060 Ga0450898_004060_196_804 193
134 3300042134 Ga0450898_004975 Ga0450898_004975_272_919 193
135 3300042435 Ga0439434_0120115 Ga0439434_0120115_65_682 193
136 3300042439 Ga0439464_0054046 Ga0439464_0054046_293_901 193
137 3300042531 Ga0450918_000077 Ga0450918_000077_19783_20400 193
138 3300044673 Ga0453683_0001887 Ga0453683_0001887_3294_3902 193
139 3300044712 Ga0453684_0713528 Ga0453684_0713528_394_1002 193
140 3300044842 Ga0466957_0262072 Ga0466957_0262072_395_1003 193
141 3300046519 Ga0495632_0005292 Ga0495632_0005292_7872_8510 193
142 3300046530 Ga0495654_0001504 Ga0495654_0001504_933_1604 193
143 3300046558 Ga0495633_0001809 Ga0495633_0001809_13914_14522 193
144 3300048090 Ga0495615_0007612 Ga0495615_0007612_492_1100 193
145 3300048917 Ga0496114_0046024 Ga0496114_0046024_753_1397 193
146 3300048924 Ga0496121_0056714 Ga0496121_0056714_120_749 193
147 3300048926 Ga0496123_0137343 Ga0496123_0137343_415_1023 193
148 3300048927 Ga0496124_0053987 Ga0496124_0053987_1203_1838 193
149 3300048928 Ga0496125_0024091 Ga0496125_0024091_2123_2752 193
150 3300048929 Ga0496126_0057238 Ga0496126_0057238_1174_1836 193
151 3300049572 Ga0501036_0218417 Ga0501036_0218417_762_1379 193
152 3300050489 nmdc:mga03683_151260_c1 nmdc:mga03683_151260_c1_363_971 193
153 3300050492 nmdc:mga0yw44_38982_c1 nmdc:mga0yw44_38982_c1_606_1214 193
154 3300050493 nmdc:mga0k408_17127_c1 nmdc:mga0k408_17127_c1_1309_1956 193
155 3300050493 nmdc:mga0k408_59892_c1 nmdc:mga0k408_59892_c1_948_1556 193
156 3300050496 nmdc:mga07m45_158071_c1 nmdc:mga07m45_158071_c1_582_1190 193
157 3300053086 Ga0500578_0000025 Ga0500578_0000025_50946_51575 193
158 3300053117 Ga0500593_006316 Ga0500593_006316_79_681 193
159 3300053161 Ga0500634_0055091 Ga0500634_0055091_343_951 193
160 3300059424 Ga0590075_014569 Ga0590075_014569_770_1387 193
161 iso_pu_bacteria 2511231002 2511242748 193
162 iso_pu_bacteria 2513020051 2513229625 193
163 iso_pu_bacteria 2599185214 2599627984 193
164 iso_pu_bacteria 2599185226 2599677795 193
165 iso_pu_bacteria 2599185227 2599685613 193
166 iso_pu_bacteria 2599185229 2599697466 193
167 iso_pu_bacteria 2643221611 2644071330 193
168 iso_pu_bacteria 2643221658 2644325770 193
169 iso_pu_bacteria 2643221660 2644338569 193
170 iso_pu_bacteria 2643221672 2644399692 193
171 iso_pu_bacteria 2643221683 2644465196 193
172 iso_pu_bacteria 2738541277 2738723983 193
173 iso_pu_bacteria 2738541307 2738880601 193
174 iso_pu_bacteria 2738543012 2739246482 193
175 iso_pu_bacteria 2738543013 2739247884 193
176 iso_pu_bacteria 2738543019 2739284668 193
177 iso_pu_bacteria 2816332133 2816476336 193
178 iso_pu_bacteria 2818991446 2819602816 193
179 iso_pu_bacteria 2831265667 2831268109 193
180 iso_pu_bacteria 2838054893 2838059151 193
181 iso_pu_bacteria 2842677519 2842679734 193
182 iso_pu_bacteria 2842718218 2842718774 193
183 iso_pu_bacteria 2842747753 2842752553 193
184 iso_pu_bacteria 2881101125 2881102648 193
185 iso_pu_bacteria 2885192300 2885193036 193
186 iso_pu_bacteria 2885198086 2885203114 193
187 iso_pu_bacteria 2885211737 2885216489 193
188 iso_pu_bacteria 2899924645 2899928048 193
189 iso_pu_bacteria 2904449895 2904452536 193
190 iso_pu_bacteria 2904456579 2904460865 193
191 iso_pu_bacteria 2904541872 2904545250 193
192 iso_pu_bacteria 2919462493 2919463834 193
193 iso_pu_bacteria 2928037797 2928041052 193
194 iso_pu_bacteria 2928044640 2928047894 193
195 iso_pu_bacteria 2928051484 2928055789 193
196 iso_pu_bacteria 2928064002 2928066737 193
197 iso_pu_bacteria 2928070936 2928075253 193
198 iso_pu_bacteria 2928084124 2928088586 193
199 iso_pu_bacteria 2928115317 2928117299 193
200 iso_pu_bacteria 2929160207 2929165442 193
201 iso_pu_bacteria 2929520902 2929522831 193
202 iso_pu_bacteria 2939631187 2939632132 193
203 iso_pu_bacteria 2954767861 2954768981 193
204 iso_pu_bacteria 2974320154 2974320342 193
205 3300002987 JGI25159J45721_1000345 JGI25159J45721_100034515 194
206 3300003354 JGI25160J50197_1000129 JGI25160J50197_100012941 194
207 3300003374 JGI25161J50226_1000080 JGI25161J50226_100008060 194
208 3300004625 Ga0055543_1000202 Ga0055543_100020260 194
209 3300005262 Ga0065165_1050712 Ga0065165_10507122 194
210 3300025284 Ga0209130_1000095 Ga0209130_100009596 194
211 3300025297 Ga0209758_1047085 Ga0209758_10470853 194
212 3300025298 Ga0209050_1003801 Ga0209050_100380111 194
213 3300025302 Ga0207426_1000397 Ga0207426_100039762 194
214 3300031238 Ga0265332_10000005 Ga0265332_10000005211 194
215 3300037312 Ga0395899_0006932 Ga0395899_0006932_8063_8701 194
216 3300037418 Ga0395900_0032376 Ga0395900_0032376_4396_5034 194
217 3300037466 Ga0395898_0035122 Ga0395898_0035122_4168_4806 194
218 3300037471 Ga0395905_0000212 Ga0395905_0000212_55131_55754 194
219 3300037471 Ga0395905_0665289 Ga0395905_0665289_121_759 194
220 3300038443 Ga0395901_0133122 Ga0395901_0133122_472_1110 194
221 3300041460 Ga0451802_0579892 Ga0451802_0579892_164_793 194
222 3300042001 Ga0439441_039044 Ga0439441_039044_246_884 194
223 3300042007 Ga0439449_0080899 Ga0439449_0080899_15_650 194
224 3300042015 Ga0439462_0079854 Ga0439462_0079854_173_808 194
225 3300042015 Ga0439462_0092446 Ga0439462_0092446_15_662 194
226 3300044656 Ga0466969_0017993 Ga0466969_0017993_130_765 194
227 3300044684 Ga0466966_0018603 Ga0466966_0018603_3763_4398 194
228 3300044693 Ga0466961_0014170 Ga0466961_0014170_1717_2352 194
229 3300044765 Ga0466970_0201719 Ga0466970_0201719_303_941 194
230 3300044842 Ga0466957_0257573 Ga0466957_0257573_21_632 194
231 3300045049 Ga0466959_0088349 Ga0466959_0088349_227_862 194
232 3300048913 Ga0496110_0451658 Ga0496110_0451658_190_840 194
233 3300049763 Ga0501266_034053 Ga0501266_034053_78_686 194
234 3300050490 nmdc:mga03n38_98848_c1 nmdc:mga03n38_98848_c1_451_1089 194
235 3300053136 Ga0500559_0105712 Ga0500559_0105712_174_812 194
236 3300003215 JGI25153J46596_10002374 JGI25153J46596_100023743 195
237 3300005353 Ga0070669_100032646 Ga0070669_1000326465 195
238 3300005364 Ga0070673_100397158 Ga0070673_1003971582 195
239 3300005456 Ga0070678_100602417 Ga0070678_1006024172 195
240 3300005457 Ga0070662_100001973 Ga0070662_10000197311 195
241 3300005616 Ga0068852_100229803 Ga0068852_1002298034 195
242 3300005844 Ga0068862_100011728 Ga0068862_1000117282 195
243 3300006353 Ga0075370_10028661 Ga0075370_100286614 195
244 3300009176 Ga0105242_10002298 Ga0105242_100022984 195
245 3300013104 Ga0157370_10003589 Ga0157370_100035892 195
246 3300014497 Ga0182008_10049350 Ga0182008_100493503 195
247 3300017792 Ga0163161_10101536 Ga0163161_101015361 195
248 3300025297 Ga0209758_1000453 Ga0209758_100045358 195
249 3300025923 Ga0207681_10011235 Ga0207681_100112353 195
250 3300025933 Ga0207706_10005101 Ga0207706_100051019 195
251 3300025934 Ga0207686_10011578 Ga0207686_100115784 195
252 3300026121 Ga0207683_10372091 Ga0207683_103720912 195
253 3300026142 Ga0207698_10173197 Ga0207698_101731972 195
254 3300027907 Ga0207428_10472031 Ga0207428_104720312 195
255 3300028380 Ga0268265_10045754 Ga0268265_100457542 195
256 3300037471 Ga0395905_0000607 Ga0395905_0000607_46604_47275 195
257 3300037471 Ga0395905_0392916 Ga0395905_0392916_555_1199 195
258 3300041405 Ga0439438_022578 Ga0439438_022578_222_854 195
259 3300044658 Ga0466972_0059783 Ga0466972_0059783_726_1373 195
260 3300044683 Ga0466965_0007028 Ga0466965_0007028_4326_4973 195
261 3300044719 Ga0466971_0346123 Ga0466971_0346123_36_683 195
262 3300046530 Ga0495654_0096826 Ga0495654_0096826_248_886 195
263 3300048919 Ga0496116_0043465 Ga0496116_0043465_144_779 195
264 3300048925 Ga0496122_0000331 Ga0496122_0000331_67939_68577 195
265 3300048926 Ga0496123_0001132 Ga0496123_0001132_34942_35580 195
266 3300048929 Ga0496126_0443543 Ga0496126_0443543_141_776 195
267 3300050493 nmdc:mga0k408_203247_c1 nmdc:mga0k408_203247_c1_496_1095 195
268 3300050496 nmdc:mga07m45_161406_c1 nmdc:mga07m45_161406_c1_91_723 195
269 3300050496 nmdc:mga07m45_21021_c1 nmdc:mga07m45_21021_c1_2205_2861 195
270 3300053156 Ga0500622_0067097 Ga0500622_0067097_1005_1652 195
271 3300006177 Ga0075362_10209693 Ga0075362_102096932 196
272 3300014497 Ga0182008_10003005 Ga0182008_1000300511 196
273 3300025303 Ga0209051_1086562 Ga0209051_10865622 196
274 3300031852 Ga0307410_10185345 Ga0307410_101853453 196
275 3300031911 Ga0307412_10260067 Ga0307412_102600672 196
276 3300031911 Ga0307412_10465026 Ga0307412_104650262 196
277 3300032005 Ga0307411_11033111 Ga0307411_110331111 196
278 3300037418 Ga0395900_0036214 Ga0395900_0036214_477_1109 196
279 3300037471 Ga0395905_0493229 Ga0395905_0493229_370_987 196
280 3300041406 Ga0439439_0008098 Ga0439439_0008098_675_1307 196
281 3300041456 Ga0451795_0584715 Ga0451795_0584715_1035_1673 196
282 3300042007 Ga0439449_0002248 Ga0439449_0002248_3199_3831 196
283 3300042131 Ga0450894_010502 Ga0450894_010502_469_1101 196
284 3300045976 Ga0466967_0495772 Ga0466967_0495772_521_1153 196
285 3300046460 Ga0495638_0075820 Ga0495638_0075820_1336_1974 196
286 3300049571 Ga0501034_0622574 Ga0501034_0622574_312_950 196
287 3300049581 Ga0501047_0057504 Ga0501047_0057504_1335_1970 196
288 3300050489 nmdc:mga03683_235671_c1 nmdc:mga03683_235671_c1_91_765 196
289 3300053090 Ga0500646_0019599 Ga0500646_0019599_1099_1737 196
290 3300053093 Ga0500651_0013143 Ga0500651_0013143_3707_4345 196
291 3300053093 Ga0500651_0062947 Ga0500651_0062947_1297_1914 196
292 3300053109 Ga0500569_071464 Ga0500569_071464_87_725 196
293 3300053129 Ga0500628_125924 Ga0500628_125924_13_651 196
294 3300053131 Ga0500652_000177 Ga0500652_000177_4377_5015 196
295 3300053156 Ga0500622_0000087 Ga0500622_0000087_93452_94090 196
296 3300001979 JGI24740J21852_10009214 JGI24740J21852_100092144 197
297 3300001979 JGI24740J21852_10009701 JGI24740J21852_100097015 197
298 3300002704 JGI25155J39150_1000102 JGI25155J39150_100010227 197
299 3300002705 JGI25156J39149_1000010 JGI25156J39149_1000010147 197
300 3300002738 JGI25154J39366_1000027 JGI25154J39366_1000027147 197
301 3300002739 JGI25158J39367_1006527 JGI25158J39367_10065273 197
302 3300002741 JGI25157J39369_1000146 JGI25157J39369_100014641 197
303 3300002773 JGI25152J39213_1010222 JGI25152J39213_10102222 197
304 3300002773 JGI25152J39213_1011717 JGI25152J39213_10117173 197
305 3300002774 JGI25150J39212_1003244 JGI25150J39212_10032442 197
306 3300002774 JGI25150J39212_1007486 JGI25150J39212_10074862 197
307 3300002774 JGI25150J39212_1010392 JGI25150J39212_10103923 197
308 3300002987 JGI25159J45721_1001064 JGI25159J45721_10010648 197
309 3300002987 JGI25159J45721_1012661 JGI25159J45721_10126613 197
310 3300002987 JGI25159J45721_1013590 JGI25159J45721_10135902 197
311 3300003187 JGI25151J46595_10010095 JGI25151J46595_100100955 197
312 3300003187 JGI25151J46595_10019873 JGI25151J46595_100198734 197
313 3300003187 JGI25151J46595_10029663 JGI25151J46595_100296634 197
314 3300003187 JGI25151J46595_10033026 JGI25151J46595_100330262 197
315 3300003187 JGI25151J46595_10033391 JGI25151J46595_100333913 197
316 3300003215 JGI25153J46596_10027356 JGI25153J46596_100273562 197
317 3300003354 JGI25160J50197_1017895 JGI25160J50197_10178952 197
318 3300003354 JGI25160J50197_1020407 JGI25160J50197_10204072 197
319 3300003354 JGI25160J50197_1040051 JGI25160J50197_10400512 197
320 3300003374 JGI25161J50226_1006781 JGI25161J50226_10067812 197
321 3300003578 Ga0006562J51391_1041255 Ga0006562J51391_10412552 197
322 3300003578 Ga0006562J51391_1049985 Ga0006562J51391_10499852 197
323 3300003578 Ga0006562J51391_1049987 Ga0006562J51391_10499871 197
324 3300003758 Ga0055532_1010136 Ga0055532_10101361 197
325 3300003761 Ga0055535_1002183 Ga0055535_10021834 197
326 3300003762 Ga0055542_1000583 Ga0055542_100058336 197
327 3300003771 Ga0055526_1008955 Ga0055526_10089552 197
328 3300003771 Ga0055526_1024178 Ga0055526_10241783 197
329 3300003771 Ga0055526_1024290 Ga0055526_10242903 197
330 3300003771 Ga0055526_1027178 Ga0055526_10271783 197
331 3300003771 Ga0055526_1033320 Ga0055526_10333202 197
332 3300003773 Ga0055537_1000049 Ga0055537_100004945 197
333 3300003773 Ga0055537_1000779 Ga0055537_100077911 197
334 3300003773 Ga0055537_1007736 Ga0055537_10077364 197
335 3300003773 Ga0055537_1010200 Ga0055537_10102003 197
336 3300003773 Ga0055537_1010260 Ga0055537_10102603 197
337 3300003775 Ga0055524_1000120 Ga0055524_100012029 197
338 3300003775 Ga0055524_1023266 Ga0055524_10232662 197
339 3300003781 Ga0055536_1001351 Ga0055536_10013513 197
340 3300003781 Ga0055536_1002957 Ga0055536_10029572 197
341 3300003781 Ga0055536_1011940 Ga0055536_10119404 197
342 3300003781 Ga0055536_1015377 Ga0055536_10153772 197
343 3300003781 Ga0055536_1019458 Ga0055536_10194583 197
344 3300003784 Ga0055534_1000049 Ga0055534_100004954 197
345 3300003784 Ga0055534_1001408 Ga0055534_10014081 197
346 3300003784 Ga0055534_1010119 Ga0055534_10101193 197
347 3300003790 Ga0055528_1001145 Ga0055528_10011455 197
348 3300003790 Ga0055528_1002656 Ga0055528_10026568 197
349 3300003790 Ga0055528_1022011 Ga0055528_10220112 197
350 3300003790 Ga0055528_1022152 Ga0055528_10221523 197
351 3300003790 Ga0055528_1026378 Ga0055528_10263783 197
352 3300003791 Ga0055530_10001709 Ga0055530_100017093 197
353 3300003791 Ga0055530_10010625 Ga0055530_100106252 197
354 3300003791 Ga0055530_10013164 Ga0055530_100131643 197
355 3300003792 Ga0055540_1000067 Ga0055540_100006759 197
356 3300003792 Ga0055540_1007545 Ga0055540_10075454 197
357 3300003792 Ga0055540_1009661 Ga0055540_10096612 197
358 3300003792 Ga0055540_1012700 Ga0055540_10127002 197
359 3300003792 Ga0055540_1017793 Ga0055540_10177933 197
360 3300003794 Ga0055531_10001465 Ga0055531_100014659 197
361 3300003794 Ga0055531_10001523 Ga0055531_1000152319 197
362 3300003794 Ga0055531_10018314 Ga0055531_100183143 197
363 3300003794 Ga0055531_10019468 Ga0055531_100194684 197
364 3300003794 Ga0055531_10027088 Ga0055531_100270884 197
365 3300004625 Ga0055543_1009803 Ga0055543_10098032 197
366 3300005262 Ga0065165_1005815 Ga0065165_10058152 197
367 3300005262 Ga0065165_1014928 Ga0065165_10149282 197
368 3300005262 Ga0065165_1024230 Ga0065165_10242302 197
369 3300005262 Ga0065165_1061976 Ga0065165_10619761 197
370 3300005288 Ga0065714_10014213 Ga0065714_100142133 197
371 3300005289 Ga0065704_10076112 Ga0065704_100761126 197
372 3300005334 Ga0068869_100174378 Ga0068869_1001743782 197
373 3300005339 Ga0070660_100201923 Ga0070660_1002019232 197
374 3300005344 Ga0070661_100021114 Ga0070661_1000211145 197
375 3300005347 Ga0070668_100107656 Ga0070668_1001076563 197
376 3300005354 Ga0070675_100415574 Ga0070675_1004155742 197
377 3300005356 Ga0070674_100089594 Ga0070674_1000895943 197
378 3300005364 Ga0070673_100145557 Ga0070673_1001455572 197
379 3300005364 Ga0070673_100192083 Ga0070673_1001920832 197
380 3300005456 Ga0070678_100050277 Ga0070678_1000502772 197
381 3300005456 Ga0070678_100597495 Ga0070678_1005974952 197
382 3300005539 Ga0068853_100084615 Ga0068853_1000846154 197
383 3300005539 Ga0068853_100176055 Ga0068853_1001760552 197
384 3300005539 Ga0068853_100203649 Ga0068853_1002036492 197
385 3300005564 Ga0070664_100031855 Ga0070664_1000318552 197
386 3300005577 Ga0068857_100107264 Ga0068857_1001072643 197
387 3300005577 Ga0068857_100362586 Ga0068857_1003625862 197
388 3300005578 Ga0068854_100157576 Ga0068854_1001575762 197
389 3300005578 Ga0068854_101087652 Ga0068854_1010876521 197
390 3300005616 Ga0068852_100016390 Ga0068852_1000163905 197
391 3300005834 Ga0068851_10014139 Ga0068851_100141393 197
392 3300005842 Ga0068858_100804872 Ga0068858_1008048721 197
393 3300006038 Ga0075365_10024063 Ga0075365_100240634 197
394 3300006051 Ga0075364_10069982 Ga0075364_100699822 197
395 3300006051 Ga0075364_10075286 Ga0075364_100752863 197
396 3300006051 Ga0075364_10132379 Ga0075364_101323792 197
397 3300006058 Ga0075432_10007264 Ga0075432_100072645 197
398 3300006058 Ga0075432_10065093 Ga0075432_100650933 197
399 3300006058 Ga0075432_10107833 Ga0075432_101078332 197
400 3300006177 Ga0075362_10014486 Ga0075362_100144864 197
401 3300006177 Ga0075362_10028411 Ga0075362_100284112 197
402 3300006177 Ga0075362_10031463 Ga0075362_100314634 197
403 3300006178 Ga0075367_10092119 Ga0075367_100921194 197
404 3300006178 Ga0075367_10150449 Ga0075367_101504492 197
405 3300006178 Ga0075367_10437290 Ga0075367_104372901 197
406 3300006186 Ga0075369_10023885 Ga0075369_100238854 197
407 3300006195 Ga0075366_10056332 Ga0075366_100563322 197
408 3300006237 Ga0097621_100388322 Ga0097621_1003883222 197
409 3300006237 Ga0097621_100459103 Ga0097621_1004591032 197
410 3300006353 Ga0075370_10000918 Ga0075370_100009188 197
411 3300006353 Ga0075370_10018552 Ga0075370_100185522 197
412 3300006353 Ga0075370_10047822 Ga0075370_100478222 197
413 3300006353 Ga0075370_10132707 Ga0075370_101327073 197
414 3300006881 Ga0068865_100572676 Ga0068865_1005726761 197
415 3300009036 Ga0105244_10004556 Ga0105244_100045569 197
416 3300009093 Ga0105240_10281395 Ga0105240_102813954 197
417 3300009148 Ga0105243_10012778 Ga0105243_100127787 197
418 3300009176 Ga0105242_10051506 Ga0105242_100515062 197
419 3300009177 Ga0105248_10409986 Ga0105248_104099862 197
420 3300009545 Ga0105237_10121150 Ga0105237_101211502 197
421 3300009551 Ga0105238_10235490 Ga0105238_102354903 197
422 3300010375 Ga0105239_10146308 Ga0105239_101463082 197
423 3300010375 Ga0105239_10499729 Ga0105239_104997292 197
424 3300011119 Ga0105246_10086033 Ga0105246_100860334 197
425 3300011119 Ga0105246_10170122 Ga0105246_101701222 197
426 3300011119 Ga0105246_10194393 Ga0105246_101943932 197
427 3300011119 Ga0105246_10209400 Ga0105246_102094002 197
428 3300012513 Ga0157326_1001779 Ga0157326_10017793 197
429 3300013100 Ga0157373_10055234 Ga0157373_100552343 197
430 3300013100 Ga0157373_10081013 Ga0157373_100810133 197
431 3300013102 Ga0157371_10141288 Ga0157371_101412882 197
432 3300013105 Ga0157369_10037069 Ga0157369_100370697 197
433 3300013306 Ga0163162_10186099 Ga0163162_101860993 197
434 3300013306 Ga0163162_10542396 Ga0163162_105423962 197
435 3300013307 Ga0157372_10043961 Ga0157372_100439612 197
436 3300013308 Ga0157375_10317222 Ga0157375_103172222 197
437 3300013308 Ga0157375_10656933 Ga0157375_106569332 197
438 3300014497 Ga0182008_10002011 Ga0182008_100020114 197
439 3300014497 Ga0182008_10010313 Ga0182008_100103133 197
440 3300015261 Ga0182006_1028312 Ga0182006_10283123 197
441 3300015261 Ga0182006_1085716 Ga0182006_10857161 197
442 3300015261 Ga0182006_1109726 Ga0182006_11097262 197
443 3300015262 Ga0182007_10000674 Ga0182007_1000067419 197
444 3300015262 Ga0182007_10008930 Ga0182007_100089302 197
445 3300015265 Ga0182005_1067553 Ga0182005_10675531 197
446 3300015683 Ga0183362_10005 Ga0183362_10005314 197
447 3300017792 Ga0163161_10000114 Ga0163161_1000011479 197
448 3300017792 Ga0163161_10122410 Ga0163161_101224103 197
449 3300017792 Ga0163161_10129392 Ga0163161_101293923 197
450 3300017792 Ga0163161_10268375 Ga0163161_102683752 197
451 3300017792 Ga0163161_10454163 Ga0163161_104541632 197
452 3300025206 Ga0209435_100003 Ga0209435_100003425 197
453 3300025208 Ga0209436_106469 Ga0209436_1064694 197
454 3300025208 Ga0209436_109896 Ga0209436_1098964 197
455 3300025228 Ga0209672_104078 Ga0209672_1040783 197
456 3300025229 Ga0209147_105455 Ga0209147_1054552 197
457 3300025242 Ga0209258_100568 Ga0209258_1005684 197
458 3300025245 Ga0207425_1002159 Ga0207425_10021592 197
459 3300025245 Ga0207425_1011740 Ga0207425_10117404 197
460 3300025245 Ga0207425_1012211 Ga0207425_10122114 197
461 3300025246 Ga0209646_1000008 Ga0209646_1000008425 197
462 3300025250 Ga0209026_1000007 Ga0209026_1000007425 197
463 3300025254 Ga0209148_1000033 Ga0209148_1000033126 197
464 3300025256 Ga0209759_1000019 Ga0209759_1000019146 197
465 3300025258 Ga0209129_1000227 Ga0209129_100022791 197
466 3300025258 Ga0209129_1006379 Ga0209129_10063795 197
467 3300025258 Ga0209129_1010140 Ga0209129_10101403 197
468 3300025258 Ga0209129_1011664 Ga0209129_10116644 197
469 3300025263 Ga0209565_1000020 Ga0209565_1000020360 197
470 3300025263 Ga0209565_1000116 Ga0209565_100011630 197
471 3300025263 Ga0209565_1000171 Ga0209565_1000171107 197
472 3300025263 Ga0209565_1005961 Ga0209565_10059614 197
473 3300025263 Ga0209565_1009957 Ga0209565_10099574 197
474 3300025273 Ga0209673_1000295 Ga0209673_100029554 197
475 3300025273 Ga0209673_1001210 Ga0209673_10012106 197
476 3300025273 Ga0209673_1001360 Ga0209673_100136030 197
477 3300025273 Ga0209673_1001942 Ga0209673_100194217 197
478 3300025273 Ga0209673_1029925 Ga0209673_10299252 197
479 3300025284 Ga0209130_1000134 Ga0209130_100013429 197
480 3300025284 Ga0209130_1000193 Ga0209130_10001934 197
481 3300025284 Ga0209130_1000560 Ga0209130_100056031 197
482 3300025291 Ga0209675_1000014 Ga0209675_1000014349 197
483 3300025291 Ga0209675_1001804 Ga0209675_10018044 197
484 3300025291 Ga0209675_1003215 Ga0209675_10032154 197
485 3300025291 Ga0209675_1008491 Ga0209675_10084914 197
486 3300025291 Ga0209675_1012282 Ga0209675_10122823 197
487 3300025291 Ga0209675_1017248 Ga0209675_10172484 197
488 3300025291 Ga0209675_1026281 Ga0209675_10262812 197
489 3300025292 Ga0209676_1000048 Ga0209676_1000048203 197
490 3300025292 Ga0209676_1000098 Ga0209676_10000984 197
491 3300025292 Ga0209676_1000124 Ga0209676_1000124140 197
492 3300025292 Ga0209676_1000145 Ga0209676_1000145118 197
493 3300025292 Ga0209676_1016118 Ga0209676_10161182 197
494 3300025292 Ga0209676_1022886 Ga0209676_10228862 197
495 3300025292 Ga0209676_1027050 Ga0209676_10270502 197
496 3300025294 Ga0209025_1000204 Ga0209025_100020494 197
497 3300025294 Ga0209025_1000264 Ga0209025_1000264166 197
498 3300025294 Ga0209025_1000348 Ga0209025_10003484 197
499 3300025294 Ga0209025_1003744 Ga0209025_100374410 197
500 3300025294 Ga0209025_1005205 Ga0209025_10052054 197
501 3300025294 Ga0209025_1009410 Ga0209025_10094103 197
502 3300025294 Ga0209025_1017213 Ga0209025_10172133 197
503 3300025294 Ga0209025_1019826 Ga0209025_10198263 197
504 3300025294 Ga0209025_1024711 Ga0209025_10247112 197
505 3300025294 Ga0209025_1068041 Ga0209025_10680412 197
506 3300025295 Ga0209564_1000231 Ga0209564_1000231166 197
507 3300025295 Ga0209564_1000728 Ga0209564_100072812 197
508 3300025295 Ga0209564_1001669 Ga0209564_10016694 197
509 3300025295 Ga0209564_1006632 Ga0209564_10066327 197
510 3300025297 Ga0209758_1000222 Ga0209758_1000222166 197
511 3300025297 Ga0209758_1015212 Ga0209758_10152124 197
512 3300025297 Ga0209758_1025105 Ga0209758_10251054 197
513 3300025298 Ga0209050_1000012 Ga0209050_1000012203 197
514 3300025298 Ga0209050_1000023 Ga0209050_100002359 197
515 3300025298 Ga0209050_1000252 Ga0209050_10002527 197
516 3300025299 Ga0209256_1000003 Ga0209256_1000003793 197
517 3300025299 Ga0209256_1000095 Ga0209256_100009584 197
518 3300025299 Ga0209256_1000749 Ga0209256_10007494 197
519 3300025299 Ga0209256_1024835 Ga0209256_10248352 197
520 3300025299 Ga0209256_1040713 Ga0209256_10407132 197
521 3300025302 Ga0207426_1000058 Ga0207426_100005810 197
522 3300025302 Ga0207426_1000349 Ga0207426_10003494 197
523 3300025302 Ga0207426_1001961 Ga0207426_10019618 197
524 3300025303 Ga0209051_1000017 Ga0209051_100001759 197
525 3300025303 Ga0209051_1000019 Ga0209051_1000019122 197
526 3300025303 Ga0209051_1000098 Ga0209051_10000984 197
527 3300025303 Ga0209051_1000099 Ga0209051_100009995 197
528 3300025303 Ga0209051_1000579 Ga0209051_10005793 197
529 3300025303 Ga0209051_1067993 Ga0209051_10679932 197
530 3300025304 Ga0209257_1000024 Ga0209257_1000024149 197
531 3300025304 Ga0209257_1000041 Ga0209257_100004159 197
532 3300025304 Ga0209257_1000258 Ga0209257_100025891 197
533 3300025304 Ga0209257_1006531 Ga0209257_10065314 197
534 3300025304 Ga0209257_1021034 Ga0209257_10210344 197
535 3300025321 Ga0207656_10136058 Ga0207656_101360581 197
536 3300025728 Ga0207655_1008069 Ga0207655_10080697 197
537 3300025907 Ga0207645_10030133 Ga0207645_100301335 197
538 3300025919 Ga0207657_10333452 Ga0207657_103334522 197
539 3300025924 Ga0207694_10664360 Ga0207694_106643601 197
540 3300025925 Ga0207650_10291841 Ga0207650_102918411 197
541 3300025933 Ga0207706_10474020 Ga0207706_104740203 197
542 3300025934 Ga0207686_10470623 Ga0207686_104706232 197
543 3300025935 Ga0207709_10000331 Ga0207709_100003314 197
544 3300025935 Ga0207709_10007073 Ga0207709_100070733 197
545 3300025937 Ga0207669_10317294 Ga0207669_103172941 197
546 3300025937 Ga0207669_10587753 Ga0207669_105877531 197
547 3300025940 Ga0207691_10050413 Ga0207691_100504131 197
548 3300025942 Ga0207689_10317804 Ga0207689_103178042 197
549 3300025945 Ga0207679_10698259 Ga0207679_106982591 197
550 3300025960 Ga0207651_10144391 Ga0207651_101443912 197
551 3300025960 Ga0207651_10160010 Ga0207651_101600102 197
552 3300025960 Ga0207651_10332355 Ga0207651_103323551 197
553 3300025986 Ga0207658_10054381 Ga0207658_100543813 197
554 3300026041 Ga0207639_10114287 Ga0207639_101142873 197
555 3300026041 Ga0207639_10141709 Ga0207639_101417092 197
556 3300026041 Ga0207639_10164284 Ga0207639_101642842 197
557 3300026089 Ga0207648_10065975 Ga0207648_100659753 197
558 3300026095 Ga0207676_11259737 Ga0207676_112597371 197
559 3300026116 Ga0207674_10133308 Ga0207674_101333084 197
560 3300026121 Ga0207683_10061823 Ga0207683_100618233 197
561 3300026121 Ga0207683_10111598 Ga0207683_101115983 197
562 3300026142 Ga0207698_10029695 Ga0207698_100296955 197
563 3300027666 Ga0209282_1000501 Ga0209282_100050117 197
564 3300028379 Ga0268266_10017420 Ga0268266_100174205 197
565 3300028380 Ga0268265_10024287 Ga0268265_100242874 197
566 3300028794 Ga0307515_10000040 Ga0307515_10000040124 197
567 3300028794 Ga0307515_10235199 Ga0307515_102351991 197
568 3300030522 Ga0307512_10122949 Ga0307512_101229492 197
569 3300030732 Ga0316176_1014050 Ga0316176_10140501 197
570 3300030733 Ga0314311_1003705 Ga0314311_10037052 197
571 3300030735 Ga0316178_1010462 Ga0316178_10104624 197
572 3300030742 Ga0316183_1067419 Ga0316183_10674196 197
573 3300030744 Ga0316181_1007566 Ga0316181_10075661 197
574 3300030745 Ga0316182_1188730 Ga0316182_11887302 197
575 3300031251 Ga0265327_10000235 Ga0265327_1000023595 197
576 3300031251 Ga0265327_10001208 Ga0265327_1000120815 197
577 3300031251 Ga0265327_10037618 Ga0265327_100376184 197
578 3300031344 Ga0265316_10000332 Ga0265316_1000033234 197
579 3300031456 Ga0307513_10000113 Ga0307513_1000011352 197
580 3300031456 Ga0307513_10011506 Ga0307513_1001150611 197
581 3300031456 Ga0307513_10361629 Ga0307513_103616292 197
582 3300031548 Ga0307408_100013522 Ga0307408_1000135225 197
583 3300031548 Ga0307408_100102668 Ga0307408_1001026684 197
584 3300031548 Ga0307408_100167065 Ga0307408_1001670652 197
585 3300031649 Ga0307514_10133587 Ga0307514_101335872 197
586 3300031730 Ga0307516_10058267 Ga0307516_100582671 197
587 3300031731 Ga0307405_10008898 Ga0307405_100088987 197
588 3300031731 Ga0307405_10080257 Ga0307405_100802574 197
589 3300031824 Ga0307413_10287365 Ga0307413_102873651 197
590 3300031901 Ga0307406_10031294 Ga0307406_100312942 197
591 3300031903 Ga0307407_10210180 Ga0307407_102101802 197
592 3300031911 Ga0307412_10008057 Ga0307412_100080577 197
593 3300031911 Ga0307412_10052422 Ga0307412_100524223 197
594 3300031911 Ga0307412_10237912 Ga0307412_102379122 197
595 3300031911 Ga0307412_10640307 Ga0307412_106403072 197
596 3300031995 Ga0307409_100738712 Ga0307409_1007387122 197
597 3300032002 Ga0307416_100106996 Ga0307416_1001069962 197
598 3300032002 Ga0307416_100126451 Ga0307416_1001264513 197
599 3300032002 Ga0307416_100334462 Ga0307416_1003344622 197
600 3300032004 Ga0307414_10290726 Ga0307414_102907262 197
601 3300032005 Ga0307411_10053721 Ga0307411_100537214 197
602 3300032126 Ga0307415_100239472 Ga0307415_1002394722 197
603 3300041404 Ga0439436_0000562 Ga0439436_0000562_2223_2855 197
604 3300041404 Ga0439436_0002238 Ga0439436_0002238_4825_5457 197
605 3300041404 Ga0439436_0022773 Ga0439436_0022773_361_993 197
606 3300041406 Ga0439439_0019130 Ga0439439_0019130_506_1138 197
607 3300041411 Ga0439466_0010304 Ga0439466_0010304_1179_1811 197
608 3300041411 Ga0439466_0014211 Ga0439466_0014211_880_1512 197
609 3300041411 Ga0439466_0022944 Ga0439466_0022944_1273_1905 197
610 3300041413 Ga0439465_0000277 Ga0439465_0000277_6623_7255 197
611 3300041413 Ga0439465_0122542 Ga0439465_0122542_55_687 197
612 3300041451 Ga0451791_1838390 Ga0451791_1838390_1423_2052 197
613 3300041452 Ga0451793_1782101 Ga0451793_1782101_238_864 197
614 3300041456 Ga0451795_0347533 Ga0451795_0347533_90_716 197
615 3300041486 Ga0451807_0649746 Ga0451807_0649746_113_739 197
616 3300041486 Ga0451807_2730351 Ga0451807_2730351_463_1095 197
617 3300041999 Ga0439433_0001048 Ga0439433_0001048_1412_2044 197
618 3300042002 Ga0439442_007320 Ga0439442_007320_1436_2068 197
619 3300042004 Ga0439445_0000763 Ga0439445_0000763_3230_3862 197
620 3300042004 Ga0439445_0109876 Ga0439445_0109876_38_670 197
621 3300042006 Ga0439432_001936 Ga0439432_001936_2999_3631 197
622 3300042006 Ga0439432_003064 Ga0439432_003064_958_1590 197
623 3300042006 Ga0439432_039445 Ga0439432_039445_315_947 197
624 3300042007 Ga0439449_0000120 Ga0439449_0000120_2948_3580 197
625 3300042007 Ga0439449_0000453 Ga0439449_0000453_642_1274 197
626 3300042010 Ga0439452_002310 Ga0439452_002310_3149_3781 197
627 3300042010 Ga0439452_011741 Ga0439452_011741_942_1574 197
628 3300042015 Ga0439462_0008753 Ga0439462_0008753_214_846 197
629 3300042015 Ga0439462_0010910 Ga0439462_0010910_409_1041 197
630 3300042121 Ga0450919_001118 Ga0450919_001118_447_1079 197
631 3300042127 Ga0450890_009757 Ga0450890_009757_315_947 197
632 3300042133 Ga0450896_002703 Ga0450896_002703_552_1184 197
633 3300042134 Ga0450898_008896 Ga0450898_008896_22_654 197
634 3300042135 Ga0450899_009056 Ga0450899_009056_352_984 197
635 3300042145 Ga0450906_000192 Ga0450906_000192_8617_9249 197
636 3300042145 Ga0450906_016518 Ga0450906_016518_330_962 197
637 3300042147 Ga0450910_001673 Ga0450910_001673_1689_2321 197
638 3300042184 Ga0450908_000821 Ga0450908_000821_949_1581 197
639 3300042184 Ga0450908_002821 Ga0450908_002821_116_748 197
640 3300042435 Ga0439434_0000289 Ga0439434_0000289_7743_8375 197
641 3300042435 Ga0439434_0028083 Ga0439434_0028083_666_1298 197
642 3300042531 Ga0450918_000437 Ga0450918_000437_4557_5189 197
643 3300042876 Ga0451577_0029663 Ga0451577_0029663_2692_3411 197
644 3300042876 Ga0451577_0679486 Ga0451577_0679486_118_756 197
645 3300044673 Ga0453683_0003653 Ga0453683_0003653_3278_3985 197
646 3300044712 Ga0453684_0018472 Ga0453684_0018472_7059_7778 197
647 3300044901 Ga0466960_0469123 Ga0466960_0469123_71_700 197
648 3300045051 Ga0451576_0026738 Ga0451576_0026738_1090_1797 197
649 3300045051 Ga0451576_0120857 Ga0451576_0120857_1964_2587 197
650 3300046453 Ga0495627_016376 Ga0495627_016376_1819_2451 197
651 3300046453 Ga0495627_017833 Ga0495627_017833_1699_2331 197
652 3300046459 Ga0495629_0146988 Ga0495629_0146988_953_1585 197
653 3300046475 Ga0495639_0016063 Ga0495639_0016063_1065_1697 197
654 3300046513 Ga0495616_0023910 Ga0495616_0023910_1268_1900 197
655 3300046515 Ga0495620_0019241 Ga0495620_0019241_1240_1872 197
656 3300046518 Ga0495631_0000927 Ga0495631_0000927_1547_2179 197
657 3300046520 Ga0495637_0001152 Ga0495637_0001152_13892_14524 197
658 3300046520 Ga0495637_0061649 Ga0495637_0061649_69_701 197
659 3300046522 Ga0495643_0145643 Ga0495643_0145643_231_866 197
660 3300046528 Ga0495642_0260407 Ga0495642_0260407_24_656 197
661 3300046530 Ga0495654_0044568 Ga0495654_0044568_830_1462 197
662 3300046539 Ga0495621_0031312 Ga0495621_0031312_174_806 197
663 3300046557 Ga0495622_0033391 Ga0495622_0033391_217_849 197
664 3300046615 Ga0495656_0002859 Ga0495656_0002859_531_1163 197
665 3300046660 Ga0495625_0000045 Ga0495625_0000045_118990_119622 197
666 3300046660 Ga0495625_0041165 Ga0495625_0041165_1293_1925 197
667 3300046663 Ga0495635_0132374 Ga0495635_0132374_653_1285 197
668 3300046674 Ga0495588_0009189 Ga0495588_0009189_1297_1929 197
669 3300046683 Ga0495658_0012053 Ga0495658_0012053_847_1479 197
670 3300046684 Ga0495669_0111828 Ga0495669_0111828_177_809 197
671 3300046691 Ga0495670_0048023 Ga0495670_0048023_808_1440 197
672 3300046692 Ga0495671_0010658 Ga0495671_0010658_2881_3513 197
673 3300046810 Ga0495660_0326335 Ga0495660_0326335_22_654 197
674 3300047321 Ga0495676_0013815 Ga0495676_0013815_4883_5515 197
675 3300047445 Ga0495677_0065683 Ga0495677_0065683_316_948 197
676 3300047447 Ga0495685_116524 Ga0495685_116524_79_711 197
677 3300047673 Ga0495593_0012980 Ga0495593_0012980_2306_2938 197
678 3300048089 Ga0495614_0049081 Ga0495614_0049081_776_1408 197
679 3300048090 Ga0495615_0018928 Ga0495615_0018928_195_827 197
680 3300048090 Ga0495615_0086480 Ga0495615_0086480_98_730 197
681 3300048903 Ga0496100_0038094 Ga0496100_0038094_1250_1882 197
682 3300048904 Ga0496101_0024578 Ga0496101_0024578_2047_2679 197
683 3300048905 Ga0496102_0048128 Ga0496102_0048128_1528_2160 197
684 3300048906 Ga0496103_0039550 Ga0496103_0039550_365_997 197
685 3300048907 Ga0496104_0100676 Ga0496104_0100676_1841_2473 197
686 3300048908 Ga0496105_0047749 Ga0496105_0047749_1248_1880 197
687 3300048909 Ga0496106_0049724 Ga0496106_0049724_933_1565 197
688 3300048913 Ga0496110_0132482 Ga0496110_0132482_1369_2001 197
689 3300048914 Ga0496111_0046348 Ga0496111_0046348_912_1544 197
690 3300048919 Ga0496116_0101509 Ga0496116_0101509_244_876 197
691 3300048920 Ga0496117_0014880 Ga0496117_0014880_1369_2001 197
692 3300048920 Ga0496117_0093107 Ga0496117_0093107_899_1537 197
693 3300048920 Ga0496117_0100631 Ga0496117_0100631_568_1200 197
694 3300048920 Ga0496117_0130005 Ga0496117_0130005_209_841 197
695 3300048921 Ga0496118_0015707 Ga0496118_0015707_941_1573 197
696 3300048921 Ga0496118_0019070 Ga0496118_0019070_1302_1934 197
697 3300048921 Ga0496118_0409245 Ga0496118_0409245_44_676 197
698 3300048924 Ga0496121_0049634 Ga0496121_0049634_1401_2033 197
699 3300048924 Ga0496121_0143935 Ga0496121_0143935_776_1408 197
700 3300048925 Ga0496122_0088660 Ga0496122_0088660_884_1516 197
701 3300048925 Ga0496122_0093309 Ga0496122_0093309_1373_2005 197
702 3300048925 Ga0496122_0162766 Ga0496122_0162766_28_660 197
703 3300048925 Ga0496122_0355111 Ga0496122_0355111_36_668 197
704 3300048926 Ga0496123_0036698 Ga0496123_0036698_342_974 197
705 3300048926 Ga0496123_0132987 Ga0496123_0132987_556_1182 197
706 3300048927 Ga0496124_0089765 Ga0496124_0089765_602_1234 197
707 3300048927 Ga0496124_0315773 Ga0496124_0315773_440_1072 197
708 3300048927 Ga0496124_0323394 Ga0496124_0323394_372_1004 197
709 3300048927 Ga0496124_0458238 Ga0496124_0458238_81_719 197
710 3300048928 Ga0496125_0001189 Ga0496125_0001189_25462_26151 197
711 3300048928 Ga0496125_0046129 Ga0496125_0046129_1856_2488 197
712 3300048928 Ga0496125_0085887 Ga0496125_0085887_970_1602 197
713 3300048928 Ga0496125_0214612 Ga0496125_0214612_593_1225 197
714 3300048928 Ga0496125_0292292 Ga0496125_0292292_133_765 197
715 3300048929 Ga0496126_0001477 Ga0496126_0001477_532_1221 197
716 3300049679 Ga0501249_002182 Ga0501249_002182_1297_1929 197
717 3300049705 Ga0501225_0092914 Ga0501225_0092914_47_679 197
718 3300049759 Ga0501262_000434 Ga0501262_000434_3231_3863 197
719 3300050489 nmdc:mga03683_103713_c1 nmdc:mga03683_103713_c1_299_931 197
720 3300050489 nmdc:mga03683_15696_c1 nmdc:mga03683_15696_c1_210_833 197
721 3300050489 nmdc:mga03683_52700_c1 nmdc:mga03683_52700_c1_641_1273 197
722 3300050489 nmdc:mga03683_7472_c1 nmdc:mga03683_7472_c1_2871_3503 197
723 3300050490 nmdc:mga03n38_19715_c1 nmdc:mga03n38_19715_c1_1517_2149 197
724 3300050490 nmdc:mga03n38_20085_c1 nmdc:mga03n38_20085_c1_1370_2002 197
725 3300050491 nmdc:mga00v17_31009_c1 nmdc:mga00v17_31009_c1_662_1294 197
726 3300050491 nmdc:mga00v17_51844_c1 nmdc:mga00v17_51844_c1_1799_2422 197
727 3300050492 nmdc:mga0yw44_43614_c1 nmdc:mga0yw44_43614_c1_1726_2358 197
728 3300050493 nmdc:mga0k408_197950_c1 nmdc:mga0k408_197950_c1_230_853 197
729 3300050493 nmdc:mga0k408_40803_c1 nmdc:mga0k408_40803_c1_1368_2000 197
730 3300050493 nmdc:mga0k408_43251_c2 nmdc:mga0k408_43251_c2_28_660 197
731 3300050493 nmdc:mga0k408_52414_c1 nmdc:mga0k408_52414_c1_359_991 197
732 3300050496 nmdc:mga07m45_30257_c1 nmdc:mga07m45_30257_c1_1184_1816 197
733 3300050496 nmdc:mga07m45_53694_c1 nmdc:mga07m45_53694_c1_194_826 197
734 3300050496 nmdc:mga07m45_59868_c1 nmdc:mga07m45_59868_c1_454_1086 197
735 3300050508 nmdc:mga09592_20553_c1 nmdc:mga09592_20553_c1_2882_3505 197
736 3300050509 nmdc:mga0qj67_153805_c1 nmdc:mga0qj67_153805_c1_618_1241 197
737 3300050516 nmdc:mga0sz30_39319_c1 nmdc:mga0sz30_39319_c1_1283_1915 197
738 3300053079 Ga0500610_0001980 Ga0500610_0001980_2001_2633 197
739 3300053079 Ga0500610_0006936 Ga0500610_0006936_300_917 197
740 3300053093 Ga0500651_0000112 Ga0500651_0000112_1419_2051 197
741 3300053094 Ga0500566_0186619 Ga0500566_0186619_348_989 197
742 3300053096 Ga0500641_0087128 Ga0500641_0087128_647_1288 197
743 3300053110 Ga0500571_027167 Ga0500571_027167_1366_1998 197
744 3300053111 Ga0500572_098750 Ga0500572_098750_124_756 197
745 3300053117 Ga0500593_003265 Ga0500593_003265_4277_4909 197
746 3300053128 Ga0500626_063714 Ga0500626_063714_95_727 197
747 3300053129 Ga0500628_061466 Ga0500628_061466_111_752 197
748 3300053133 Ga0500655_000471 Ga0500655_000471_1945_2577 197
749 3300053134 Ga0500658_0001561 Ga0500658_0001561_6439_7071 197
750 3300053134 Ga0500658_0001686 Ga0500658_0001686_1703_2335 197
751 3300053136 Ga0500559_0012676 Ga0500559_0012676_1467_2102 197
752 3300053139 Ga0500568_0002695 Ga0500568_0002695_8325_8957 197
753 3300053139 Ga0500568_0153622 Ga0500568_0153622_30_671 197
754 3300053162 Ga0500638_000683 Ga0500638_000683_2435_3067 197
755 3300053729 Ga0500625_081534 Ga0500625_081534_628_1260 197
756 3300053730 Ga0500645_000661 Ga0500645_000661_14234_14848 197
757 3300053730 Ga0500645_031433 Ga0500645_031433_554_1195 197
758 3300055283 Ga0500661_001056 Ga0500661_001056_3743_4384 197
759 iso_pu_bacteria 2643221628 2644161763 197
760 iso_pu_bacteria 2945909444 2945909915 197
761 iso_pu_bacteria 2945945610 2945945956 197
762 iso_pu_bacteria 2945984333 2945988124 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

17

200

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qd3-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from pseudomonas aeruginosa with 5-azacytidine at 1.89 angstrom resolution 0.9832 2 189
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9801 2 188
4fyj-assembly1.cif.gz_A crystal structure of p. aeruginosa peptidyl-trna hydrolase 0.9774 2 190
4p7b-assembly2.cif.gz_C crystal structure of s. typhimurium peptidyl-trna hydrolase 0.9705 1 187
6ix6-assembly1.cif.gz_A crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution 0.9701 2 192
ID Description Score Start End Superfamily
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9583 2 187 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9448 1 188 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9355 2 185 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9353 1 188 3.40.50.1470
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9294 60 188 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A433SDN1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9924 1 192 GO:0004045
GO:0005737
GO:0006412
AF-A0A1D2U791-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9924 1 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A357JRN5-F1-model_v4 deleted 0.9863 2 169
AF-A0A1D2U791-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9821 1 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A533ZYX7-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9809 2 187 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
92.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map