F479562

General Info

Members Datasets Scaffolds Average Seq Length
761 367 1522 110

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100029929|Ga0070687_1000299292
Length 135
Sequence MEAAAPRTHNPSHPRLRMTSWLTRSPLAPVLLLTVSNVFMTFAWYGHLRHKGSPLLTVILVSWGIAFFEYCFQVPANRWGNAHFSAAQLKTIQEVISLLVFGVFSVLYLREEMRWNHLAGFALIVAAVFVVFHEW

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
273 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
309 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
310 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
311 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
312 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
363 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
364 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
365 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
366 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
367 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.26
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0.26
Rhizoplane 1.71
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100029929 3300005343 Bacteria 2657
2 SwRhRL3b_contig_3036283 2162886006 Bacteria 837
3 JGI24746J21847_1070769 3300001977 Bacteria 507
4 JGI24737J22298_10011586 3300001990 Bacteria 2887
5 JGI26128J50194_1011394 3300003347 Bacteria 559
6 JGI26145J50221_1001316 3300003371 Bacteria 1963
7 Ga0065714_10339184 3300005288 Bacteria 645
8 Ga0065715_10026351 3300005293 Bacteria 2215
9 Ga0065707_10083648 3300005295 Bacteria 8545
10 Ga0070676_10001301 3300005328 Bacteria 12553
11 Ga0070676_10019899 3300005328 Bacteria 3740
12 Ga0070683_100009578 3300005329 Bacteria 8293
13 Ga0070683_100025787 3300005329 Bacteria 5285
14 Ga0070690_100001503 3300005330 Bacteria 12209
15 Ga0070690_100039507 3300005330 Bacteria 2981
16 Ga0070670_100000392 3300005331 Bacteria 36161
17 Ga0070670_100795920 3300005331 Bacteria 854
18 Ga0068869_100017308 3300005334 Bacteria 4883
19 Ga0068869_100178390 3300005334 Bacteria 1664
20 Ga0070666_10004812 3300005335 Bacteria 8257
21 Ga0070666_10024420 3300005335 Bacteria 3937
22 Ga0070666_10084373 3300005335 Bacteria 2174
23 Ga0070680_100001254 3300005336 Bacteria 18335
24 Ga0070680_100144922 3300005336 Bacteria 1992
25 Ga0070680_100474009 3300005336 Bacteria 1070
26 Ga0070680_101201742 3300005336 Bacteria 656
27 Ga0070682_100008286 3300005337 Bacteria 5860
28 Ga0070682_100042808 3300005337 Bacteria 2798
29 Ga0070682_100097852 3300005337 Bacteria 1932
30 Ga0068868_100000631 3300005338 Bacteria 23708
31 Ga0068868_100010455 3300005338 Bacteria 6720
32 Ga0068868_100085270 3300005338 Bacteria 2538
33 Ga0068868_100441531 3300005338 Bacteria 1130
34 Ga0070660_100000949 3300005339 Bacteria 19357
35 Ga0070660_100034186 3300005339 Bacteria 3838
36 Ga0070689_100000913 3300005340 Bacteria 18437
37 Ga0070689_100048898 3300005340 Bacteria 3263
38 Ga0070691_10003443 3300005341 Bacteria 7116
39 Ga0070687_100043367 3300005343 Bacteria 2285
40 Ga0070687_100045001 3300005343 Bacteria 2251
41 Ga0070687_100167666 3300005343 Bacteria 1304
42 Ga0070687_100192339 3300005343 Bacteria 1230
43 Ga0070661_100001397 3300005344 Bacteria 16871
44 Ga0070661_100046636 3300005344 Bacteria 3171
45 Ga0070692_10011714 3300005345 Bacteria 4035
46 Ga0070692_10945831 3300005345 Bacteria 599
47 Ga0070668_100000519 3300005347 Bacteria 25486
48 Ga0070668_100003430 3300005347 Bacteria 11706
49 Ga0070668_100275440 3300005347 Bacteria 1404
50 Ga0070669_100000301 3300005353 Bacteria 38907
51 Ga0070669_100260113 3300005353 Bacteria 1385
52 Ga0070675_100005318 3300005354 Bacteria 9837
53 Ga0070675_100073469 3300005354 Bacteria 2839
54 Ga0070671_100009501 3300005355 Bacteria 7803
55 Ga0070671_100022515 3300005355 Bacteria 5145
56 Ga0070671_100512846 3300005355 Unclassified 1032
57 Ga0070674_100000326 3300005356 Bacteria 23479
58 Ga0070673_100003391 3300005364 Bacteria 9911
59 Ga0070673_100082204 3300005364 Bacteria 2614
60 Ga0070673_100096357 3300005364 Bacteria 2428
61 Ga0070688_100043150 3300005365 Bacteria 2777
62 Ga0070688_100147817 3300005365 Bacteria 1603
63 Ga0070688_100517901 3300005365 Bacteria 902
64 Ga0070659_100004252 3300005366 Bacteria 10221
65 Ga0070659_100090920 3300005366 Bacteria 2446
66 Ga0070667_100004733 3300005367 Bacteria 11406
67 Ga0070667_100026175 3300005367 Bacteria 4852
68 Ga0070667_100052399 3300005367 Bacteria 3443
69 Ga0070667_100280986 3300005367 Unclassified 1495
70 Ga0070703_10119272 3300005406 Bacteria 955
71 Ga0070709_10011042 3300005434 Bacteria 5019
72 Ga0070709_10065312 3300005434 Bacteria 2330
73 Ga0070709_10207205 3300005434 Bacteria 1392
74 Ga0070709_10305987 3300005434 Bacteria 1162
75 Ga0070714_100152311 3300005435 Bacteria 2085
76 Ga0070714_100185372 3300005435 Bacteria 1896
77 Ga0070714_100947178 3300005435 Bacteria 837
78 Ga0070714_102240698 3300005435 Bacteria 532
79 Ga0070713_100000876 3300005436 Bacteria 19291
80 Ga0070713_100110456 3300005436 Bacteria 2397
81 Ga0070713_100132488 3300005436 Unclassified 2199
82 Ga0070713_100147676 3300005436 Bacteria 2088
83 Ga0070710_10057455 3300005437 Bacteria 2205
84 Ga0070701_10290456 3300005438 Unclassified 1002
85 Ga0070701_10769062 3300005438 Bacteria 654
86 Ga0070711_100106113 3300005439 Bacteria 2053
87 Ga0070711_100137391 3300005439 Bacteria 1828
88 Ga0070711_100225063 3300005439 Bacteria 1460
89 Ga0070711_100255644 3300005439 Unclassified 1376
90 Ga0070705_100019477 3300005440 Bacteria 3572
91 Ga0070705_100576392 3300005440 Bacteria 867
92 Ga0070705_101930170 3300005440 Bacteria 503
93 Ga0070700_100001235 3300005441 Bacteria 12667
94 Ga0070694_100002303 3300005444 Bacteria 11294
95 Ga0070694_100066088 3300005444 Bacteria 2480
96 Ga0070694_100327380 3300005444 Bacteria 1181
97 Ga0070708_100157715 3300005445 Bacteria 2113
98 Ga0070708_100259005 3300005445 Bacteria 1635
99 Ga0070708_100262278 3300005445 Bacteria 1624
100 Ga0070663_100010560 3300005455 Bacteria 5758
101 Ga0070663_100031236 3300005455 Bacteria 3659
102 Ga0070663_100382200 3300005455 Bacteria 1147
103 Ga0070663_101367454 3300005455 Bacteria 626
104 Ga0070678_100001651 3300005456 Bacteria 11958
105 Ga0070678_100061067 3300005456 Bacteria 2777
106 Ga0070678_101484876 3300005456 Bacteria 634
107 Ga0070678_101824874 3300005456 Unclassified 573
108 Ga0070662_100004692 3300005457 Bacteria 8665
109 Ga0070662_100190315 3300005457 Bacteria 1622
110 Ga0070662_100712149 3300005457 Bacteria 850
111 Ga0070681_10001107 3300005458 Bacteria 23052
112 Ga0070681_10026349 3300005458 Bacteria 5844
113 Ga0070681_10154093 3300005458 Bacteria 2223
114 Ga0070681_10385054 3300005458 Bacteria 1313
115 Ga0068867_100000390 3300005459 Bacteria 29308
116 Ga0068867_100013788 3300005459 Bacteria 5723
117 Ga0070685_10967156 3300005466 Bacteria 637
118 Ga0070706_100104323 3300005467 Bacteria 2637
119 Ga0070706_100282067 3300005467 Bacteria 1550
120 Ga0070706_101679179 3300005467 Bacteria 579
121 Ga0070707_100019684 3300005468 Bacteria 6362
122 Ga0070707_100046295 3300005468 Bacteria 4163
123 Ga0070707_100997559 3300005468 Bacteria 803
124 Ga0070698_100007655 3300005471 Bacteria 11687
125 Ga0070698_100074939 3300005471 Bacteria 3389
126 Ga0070698_100217504 3300005471 Bacteria 1845
127 Ga0070699_100017443 3300005518 Bacteria 6163
128 Ga0070699_101242802 3300005518 Bacteria 683
129 Ga0070679_100009642 3300005530 Bacteria 9132
130 Ga0070679_100175944 3300005530 Bacteria 2112
131 Ga0070679_100316286 3300005530 Bacteria 1511
132 Ga0070679_100508297 3300005530 Bacteria 1149
133 Ga0070684_100002340 3300005535 Bacteria 13967
134 Ga0070684_100014102 3300005535 Bacteria 6463
135 Ga0070697_100053352 3300005536 Bacteria 3286
136 Ga0070697_100254819 3300005536 Bacteria 1501
137 Ga0070697_100558184 3300005536 Bacteria 1004
138 Ga0068853_100020421 3300005539 Bacteria 5508
139 Ga0068853_100545403 3300005539 Bacteria 1098
140 Ga0068853_100927731 3300005539 Bacteria 837
141 Ga0070672_100002559 3300005543 Bacteria 11597
142 Ga0070672_100010108 3300005543 Bacteria 6534
143 Ga0070672_101525355 3300005543 Bacteria 599
144 Ga0070686_100009691 3300005544 Bacteria 5414
145 Ga0070686_100025301 3300005544 Unclassified 3570
146 Ga0070686_100060892 3300005544 Bacteria 2437
147 Ga0070686_100293676 3300005544 Bacteria 1203
148 Ga0070695_100002278 3300005545 Bacteria 10994
149 Ga0070695_100026296 3300005545 Bacteria 3599
150 Ga0070695_100217353 3300005545 Bacteria 1375
151 Ga0070696_100000652 3300005546 Bacteria 22200
152 Ga0070696_100025256 3300005546 Bacteria 4038
153 Ga0070696_100353472 3300005546 Bacteria 1139
154 Ga0070693_100007814 3300005547 Bacteria 5243
155 Ga0070693_100082322 3300005547 Bacteria 1921
156 Ga0070693_100379375 3300005547 Bacteria 975
157 Ga0070665_100032890 3300005548 Bacteria 5217
158 Ga0070704_101193178 3300005549 Bacteria 694
159 Ga0070704_101423493 3300005549 Bacteria 636
160 Ga0068855_100419764 3300005563 Bacteria 1463
161 Ga0068855_100665443 3300005563 Bacteria 1117
162 Ga0068855_101291269 3300005563 Bacteria 756
163 Ga0068855_102334177 3300005563 Bacteria 535
164 Ga0070664_100000174 3300005564 Bacteria 45062
165 Ga0070664_100001439 3300005564 Bacteria 18981
166 Ga0070664_100016225 3300005564 Bacteria 6106
167 Ga0070664_100066009 3300005564 Bacteria 3089
168 Ga0070664_100503003 3300005564 Bacteria 1117
169 Ga0068857_100163919 3300005577 Bacteria 2018
170 Ga0068854_100005368 3300005578 Bacteria 8092
171 Ga0068854_100035640 3300005578 Bacteria 3484
172 Ga0068856_100005248 3300005614 Bacteria 12781
173 Ga0068856_100481866 3300005614 Bacteria 1261
174 Ga0068856_101324904 3300005614 Bacteria 735
175 Ga0070702_100052699 3300005615 Bacteria 2334
176 Ga0070702_100258220 3300005615 Unclassified 1185
177 Ga0068852_100005689 3300005616 Bacteria 8939
178 Ga0068852_100450456 3300005616 Bacteria 1274
179 Ga0068859_100004708 3300005617 Bacteria 13865
180 Ga0068859_100018293 3300005617 Bacteria 7044
181 Ga0068859_100057797 3300005617 Bacteria 3907
182 Ga0068859_100176282 3300005617 Bacteria 2220
183 Ga0068859_101672798 3300005617 Bacteria 703
184 Ga0068864_100001076 3300005618 Bacteria 22922
185 Ga0068864_100012658 3300005618 Bacteria 6975
186 Ga0068864_100078303 3300005618 Bacteria 2893
187 Ga0068864_100213562 3300005618 Bacteria 1778
188 Ga0068864_100787697 3300005618 Bacteria 934
189 Ga0068864_100885695 3300005618 Bacteria 881
190 Ga0068866_10911846 3300005718 Bacteria 619
191 Ga0068861_100047607 3300005719 Bacteria 3237
192 Ga0068861_100152984 3300005719 Bacteria 1895
193 Ga0068851_10007324 3300005834 Bacteria 5061
194 Ga0068851_10383060 3300005834 Bacteria 824
195 Ga0068870_10003265 3300005840 Bacteria 6845
196 Ga0068863_100005556 3300005841 Bacteria 12394
197 Ga0068863_100010887 3300005841 Bacteria 8819
198 Ga0068863_100091739 3300005841 Bacteria 2881
199 Ga0068863_100148856 3300005841 Bacteria 2239
200 Ga0068858_100097007 3300005842 Bacteria 2747
201 Ga0068858_100140057 3300005842 Bacteria 2271
202 Ga0068858_100302247 3300005842 Unclassified 1527
203 Ga0068860_100006372 3300005843 Bacteria 11845
204 Ga0068860_100009618 3300005843 Bacteria 9606
205 Ga0068860_100011083 3300005843 Bacteria 8886
206 Ga0068860_100054490 3300005843 Unclassified 3801
207 Ga0068860_100188735 3300005843 Bacteria 1994
208 Ga0068862_100007868 3300005844 Bacteria 8818
209 Ga0068862_100073565 3300005844 Bacteria 2954
210 Ga0068862_100344056 3300005844 Unclassified 1382
211 Ga0081538_10008034 3300005981 Bacteria 9019
212 Ga0070717_10024463 3300006028 Bacteria 4796
213 Ga0070717_10031327 3300006028 Bacteria 4277
214 Ga0070717_10098074 3300006028 Unclassified 2484
215 Ga0070717_10255455 3300006028 Bacteria 1549
216 Ga0070717_10393414 3300006028 Bacteria 1244
217 Ga0070717_10652982 3300006028 Bacteria 955
218 Ga0075432_10002165 3300006058 Bacteria 6533
219 Ga0075432_10126119 3300006058 Unclassified 966
220 Ga0070716_100000237 3300006173 Bacteria 22073
221 Ga0070716_100038082 3300006173 Bacteria 2661
222 Ga0070716_100108584 3300006173 Bacteria 1715
223 Ga0070716_100240202 3300006173 Bacteria 1228
224 Ga0070716_100409853 3300006173 Bacteria 977
225 Ga0070716_100535311 3300006173 Bacteria 870
226 Ga0070716_100702306 3300006173 Bacteria 773
227 Ga0070712_100000551 3300006175 Bacteria 21697
228 Ga0070712_101640498 3300006175 Bacteria 563
229 Ga0097621_100013930 3300006237 Bacteria 6006
230 Ga0097621_100028044 3300006237 Bacteria 4434
231 Ga0097621_100036220 3300006237 Bacteria 3947
232 Ga0097621_100711635 3300006237 Bacteria 925
233 Ga0075370_10069468 3300006353 Bacteria 2013
234 Ga0068871_100012995 3300006358 Bacteria 6167
235 Ga0068871_100031475 3300006358 Bacteria 4184
236 Ga0068871_100045649 3300006358 Bacteria 3527
237 Ga0068871_100568177 3300006358 Bacteria 1029
238 Ga0068871_100699394 3300006358 Bacteria 928
239 Ga0075428_100088121 3300006844 Bacteria 3385
240 Ga0075428_100104020 3300006844 Bacteria 3096
241 Ga0075428_100108429 3300006844 Bacteria 3026
242 Ga0075428_100170044 3300006844 Bacteria 2363
243 Ga0075428_100614107 3300006844 Bacteria 1161
244 Ga0075430_100000359 3300006846 Bacteria 33321
245 Ga0075430_100031657 3300006846 Bacteria 4488
246 Ga0075431_100002707 3300006847 Bacteria 17183
247 Ga0075431_100164504 3300006847 Bacteria 2281
248 Ga0075431_100660245 3300006847 Bacteria 1025
249 Ga0075433_10010417 3300006852 Bacteria 7461
250 Ga0075433_10129938 3300006852 Bacteria 2238
251 Ga0075434_100042133 3300006871 Bacteria 4525
252 Ga0075434_100333559 3300006871 Bacteria 1537
253 Ga0075434_100787839 3300006871 Bacteria 967
254 Ga0075434_101109395 3300006871 Bacteria 804
255 Ga0075434_102380084 3300006871 Bacteria 532
256 Ga0075429_100012398 3300006880 Bacteria 7395
257 Ga0075429_100430930 3300006880 Bacteria 1155
258 Ga0068865_100000814 3300006881 Bacteria 17566
259 Ga0068865_100011443 3300006881 Bacteria 5555
260 Ga0068865_100100419 3300006881 Bacteria 2117
261 Ga0068865_100137809 3300006881 Bacteria 1836
262 Ga0075436_100008572 3300006914 Bacteria 6986
263 Ga0075436_100031200 3300006914 Bacteria 3669
264 Ga0075436_100103475 3300006914 Bacteria 1984
265 Ga0075436_100125523 3300006914 Bacteria 1798
266 Ga0075436_100339381 3300006914 Bacteria 1081
267 Ga0075436_100816736 3300006914 Bacteria 695
268 Ga0097620_100004708 3300006931 Bacteria 13865
269 Ga0097620_100018293 3300006931 Bacteria 7044
270 Ga0097620_100057796 3300006931 Bacteria 3907
271 Ga0097620_100176287 3300006931 Bacteria 2220
272 Ga0097620_101672900 3300006931 Bacteria 703
273 Ga0075435_100036739 3300007076 Bacteria 3895
274 Ga0075435_100068086 3300007076 Bacteria 2899
275 Ga0075435_100216878 3300007076 Bacteria 1624
276 Ga0075435_100232870 3300007076 Bacteria 1565
277 Ga0075435_100722498 3300007076 Bacteria 866
278 Ga0099794_10021462 3300007265 Bacteria 2934
279 Ga0099794_10188683 3300007265 Bacteria 1054
280 Ga0099795_10025978 3300007788 Bacteria 1968
281 Ga0099795_10073307 3300007788 Bacteria 1296
282 Ga0105250_10551674 3300009092 Bacteria 529
283 Ga0105240_10071358 3300009093 Bacteria 4296
284 Ga0105240_10500002 3300009093 Bacteria 1352
285 Ga0111539_10002311 3300009094 Bacteria 25357
286 Ga0111539_10038086 3300009094 Bacteria 5801
287 Ga0111539_10197185 3300009094 Bacteria 2348
288 Ga0111539_10212964 3300009094 Bacteria 2251
289 Ga0105245_10013372 3300009098 Bacteria 7154
290 Ga0105245_10056397 3300009098 Bacteria 3531
291 Ga0105245_10882395 3300009098 Bacteria 935
292 Ga0105247_10187871 3300009101 Bacteria 1382
293 Ga0105247_11244491 3300009101 Bacteria 595
294 Ga0114129_10009429 3300009147 Bacteria 13917
295 Ga0114129_11363257 3300009147 Bacteria 876
296 Ga0114129_11638592 3300009147 Bacteria 787
297 Ga0105243_10001619 3300009148 Bacteria 19588
298 Ga0105243_10249662 3300009148 Bacteria 1583
299 Ga0105241_10008069 3300009174 Bacteria 7746
300 Ga0105241_10029341 3300009174 Bacteria 4104
301 Ga0105241_10805934 3300009174 Bacteria 865
302 Ga0105242_10000263 3300009176 Bacteria 41757
303 Ga0105242_10006066 3300009176 Bacteria 9315
304 Ga0105248_10000525 3300009177 Bacteria 43619
305 Ga0105248_10011037 3300009177 Bacteria 9964
306 Ga0105248_10573055 3300009177 Bacteria 1274
307 Ga0105248_11548792 3300009177 Bacteria 751
308 Ga0105248_12069987 3300009177 Bacteria 647
309 Ga0105248_12232697 3300009177 Bacteria 623
310 Ga0105237_10026026 3300009545 Bacteria 5980
311 Ga0105237_10065300 3300009545 Bacteria 3636
312 Ga0105237_10217389 3300009545 Bacteria 1911
313 Ga0105237_10225202 3300009545 Bacteria 1876
314 Ga0105238_10048154 3300009551 Bacteria 4296
315 Ga0105238_10197787 3300009551 Bacteria 1986
316 Ga0105249_10003059 3300009553 Bacteria 14441
317 Ga0105249_10003275 3300009553 Bacteria 14032
318 Ga0105249_10125334 3300009553 Bacteria 2445
319 Ga0105249_10821353 3300009553 Bacteria 994
320 Ga0099796_10035437 3300010159 Bacteria 1655
321 Ga0105239_10043178 3300010375 Bacteria 4940
322 Ga0105239_10061439 3300010375 Bacteria 4123
323 Ga0105239_10185334 3300010375 Bacteria 2329
324 Ga0105246_10000015 3300011119 Bacteria 66144
325 Ga0105246_10036384 3300011119 Bacteria 3297
326 Ga0157373_10007558 3300013100 Bacteria 8078
327 Ga0157373_10070137 3300013100 Bacteria 2477
328 Ga0157373_10403657 3300013100 Bacteria 980
329 Ga0157373_10736792 3300013100 Bacteria 724
330 Ga0157371_10087982 3300013102 Bacteria 2199
331 Ga0157369_10021326 3300013105 Bacteria 7246
332 Ga0157369_12023238 3300013105 Bacteria 584
333 Ga0157369_12203318 3300013105 Bacteria 559
334 Ga0157374_10007404 3300013296 Bacteria 9363
335 Ga0157374_10018993 3300013296 Bacteria 6080
336 Ga0157374_10237871 3300013296 Bacteria 1790
337 Ga0157374_11022486 3300013296 Bacteria 846
338 Ga0157378_10008019 3300013297 Bacteria 9219
339 Ga0157378_10013271 3300013297 Bacteria 7202
340 Ga0157378_11994870 3300013297 Bacteria 630
341 Ga0163162_10003645 3300013306 Bacteria 14771
342 Ga0163162_10014138 3300013306 Bacteria 7800
343 Ga0163162_10089117 3300013306 Bacteria 3165
344 Ga0163162_10177097 3300013306 Bacteria 2258
345 Ga0163162_10248514 3300013306 Bacteria 1911
346 Ga0163162_12480743 3300013306 Bacteria 596
347 Ga0157372_10015288 3300013307 Bacteria 8221
348 Ga0157372_10035918 3300013307 Bacteria 5457
349 Ga0157372_10077167 3300013307 Unclassified 3762
350 Ga0157372_11885088 3300013307 Bacteria 687
351 Ga0157372_12284827 3300013307 Bacteria 621
352 Ga0157372_13369654 3300013307 Bacteria 509
353 Ga0157375_10001271 3300013308 Bacteria 21815
354 Ga0157375_10017979 3300013308 Bacteria 6401
355 Ga0157375_10045383 3300013308 Bacteria 4277
356 Ga0157375_10295408 3300013308 Bacteria 1783
357 Ga0157375_11031830 3300013308 Bacteria 961
358 Ga0163163_10035239 3300014325 Bacteria 4854
359 Ga0163163_10080789 3300014325 Bacteria 3252
360 Ga0163163_10171434 3300014325 Bacteria 2217
361 Ga0163163_10323881 3300014325 Bacteria 1595
362 Ga0157380_10012825 3300014326 Bacteria 6091
363 Ga0157380_10059376 3300014326 Bacteria 3052
364 Ga0157380_10819334 3300014326 Bacteria 950
365 Ga0157377_10147136 3300014745 Bacteria 1453
366 Ga0157377_11266181 3300014745 Bacteria 575
367 Ga0157379_10028421 3300014968 Bacteria 4973
368 Ga0157379_10063918 3300014968 Bacteria 3290
369 Ga0157379_10088836 3300014968 Bacteria 2772
370 Ga0157376_10000017 3300014969 Bacteria 268501
371 Ga0157376_10001074 3300014969 Bacteria 17895
372 Ga0157376_10084150 3300014969 Bacteria 2738
373 Ga0157376_10121942 3300014969 Bacteria 2312
374 Ga0157376_10782666 3300014969 Bacteria 965
375 Ga0182005_1047628 3300015265 Bacteria 1165
376 Ga0163161_10067609 3300017792 Bacteria 2610
377 Ga0213874_10020058 3300021377 Bacteria 1828
378 Ga0213876_10001389 3300021384 Bacteria 15112
379 Ga0228598_1032691 3300024227 Bacteria 1025
380 Ga0209233_1028566 3300025261 Bacteria 1336
381 Ga0207656_10005362 3300025321 Bacteria 4526
382 Ga0207692_10122485 3300025898 Bacteria 1458
383 Ga0207692_11177170 3300025898 Bacteria 509
384 Ga0207642_10179402 3300025899 Bacteria 1153
385 Ga0207710_10102408 3300025900 Bacteria 1352
386 Ga0207688_10023792 3300025901 Bacteria 3358
387 Ga0207688_10441925 3300025901 Bacteria 810
388 Ga0207680_10004311 3300025903 Bacteria 6743
389 Ga0207680_10026856 3300025903 Bacteria 3196
390 Ga0207680_10097074 3300025903 Bacteria 1886
391 Ga0207647_10033302 3300025904 Bacteria 3300
392 Ga0207647_10120976 3300025904 Bacteria 1544
393 Ga0207699_10006592 3300025906 Bacteria 5635
394 Ga0207699_10033211 3300025906 Bacteria 2915
395 Ga0207699_10483933 3300025906 Unclassified 892
396 Ga0207699_10888460 3300025906 Unclassified 657
397 Ga0207645_10000032 3300025907 Bacteria 92521
398 Ga0207645_10012777 3300025907 Bacteria 5689
399 Ga0207645_11223963 3300025907 Bacteria 504
400 Ga0207643_10004833 3300025908 Bacteria 7214
401 Ga0207684_10145023 3300025910 Bacteria 2042
402 Ga0207684_10684121 3300025910 Bacteria 873
403 Ga0207654_10004038 3300025911 Bacteria 7389
404 Ga0207654_10005024 3300025911 Bacteria 6684
405 Ga0207707_10009993 3300025912 Bacteria 8232
406 Ga0207707_10016144 3300025912 Bacteria 6513
407 Ga0207707_10035451 3300025912 Bacteria 4363
408 Ga0207707_10725370 3300025912 Bacteria 833
409 Ga0207707_10732753 3300025912 Bacteria 828
410 Ga0207695_10010784 3300025913 Bacteria 11144
411 Ga0207695_10686277 3300025913 Bacteria 905
412 Ga0207695_11351349 3300025913 Bacteria 593
413 Ga0207671_10047281 3300025914 Bacteria 3185
414 Ga0207671_11042570 3300025914 Bacteria 644
415 Ga0207693_10005205 3300025915 Bacteria 10890
416 Ga0207693_10596822 3300025915 Bacteria 860
417 Ga0207693_10944025 3300025915 Bacteria 660
418 Ga0207663_10049918 3300025916 Bacteria 2598
419 Ga0207663_10297022 3300025916 Bacteria 1205
420 Ga0207663_10298936 3300025916 Unclassified 1202
421 Ga0207663_10498872 3300025916 Bacteria 945
422 Ga0207660_10030509 3300025917 Bacteria 3706
423 Ga0207660_10054769 3300025917 Bacteria 2848
424 Ga0207660_10413101 3300025917 Bacteria 1088
425 Ga0207660_10672913 3300025917 Bacteria 844
426 Ga0207662_10020491 3300025918 Bacteria 3773
427 Ga0207662_10082489 3300025918 Bacteria 1964
428 Ga0207662_10085087 3300025918 Bacteria 1936
429 Ga0207657_10001078 3300025919 Bacteria 28923
430 Ga0207657_10001179 3300025919 Bacteria 27739
431 Ga0207649_10004656 3300025920 Bacteria 7425
432 Ga0207652_10179880 3300025921 Bacteria 1900
433 Ga0207652_10203441 3300025921 Bacteria 1782
434 Ga0207652_10257578 3300025921 Bacteria 1574
435 Ga0207646_10006231 3300025922 Bacteria 12396
436 Ga0207646_10044299 3300025922 Bacteria 3994
437 Ga0207646_10434518 3300025922 Bacteria 1185
438 Ga0207681_10310586 3300025923 Bacteria 1250
439 Ga0207681_10355466 3300025923 Bacteria 1173
440 Ga0207694_10012267 3300025924 Bacteria 6458
441 Ga0207650_10005499 3300025925 Bacteria 8648
442 Ga0207659_10001944 3300025926 Bacteria 12257
443 Ga0207659_10003062 3300025926 Bacteria 9983
444 Ga0207687_10002689 3300025927 Bacteria 12026
445 Ga0207687_10020393 3300025927 Bacteria 4396
446 Ga0207700_10002088 3300025928 Bacteria 11395
447 Ga0207700_10034420 3300025928 Bacteria 3636
448 Ga0207700_10362929 3300025928 Unclassified 1263
449 Ga0207700_10931860 3300025928 Bacteria 777
450 Ga0207664_10000029 3300025929 Bacteria 183815
451 Ga0207664_10171898 3300025929 Bacteria 1855
452 Ga0207664_10206631 3300025929 Bacteria 1697
453 Ga0207664_10275946 3300025929 Bacteria 1474
454 Ga0207664_11107987 3300025929 Bacteria 708
455 Ga0207644_10097781 3300025931 Bacteria 2199
456 Ga0207690_10001499 3300025932 Bacteria 14585
457 Ga0207690_10334722 3300025932 Bacteria 1193
458 Ga0207706_10000100 3300025933 Bacteria 90861
459 Ga0207706_10000507 3300025933 Bacteria 41467
460 Ga0207706_10609993 3300025933 Bacteria 937
461 Ga0207686_10004154 3300025934 Bacteria 7772
462 Ga0207686_10037971 3300025934 Bacteria 2910
463 Ga0207686_10062140 3300025934 Bacteria 2371
464 Ga0207709_10018277 3300025935 Bacteria 3924
465 Ga0207709_10190889 3300025935 Bacteria 1455
466 Ga0207709_10437726 3300025935 Bacteria 1008
467 Ga0207670_10005319 3300025936 Bacteria 7053
468 Ga0207669_10001776 3300025937 Bacteria 9146
469 Ga0207704_10001431 3300025938 Bacteria 10670
470 Ga0207704_10089521 3300025938 Bacteria 2017
471 Ga0207704_10659929 3300025938 Bacteria 862
472 Ga0207665_10018207 3300025939 Unclassified 4615
473 Ga0207665_10050687 3300025939 Bacteria 2792
474 Ga0207665_10054792 3300025939 Bacteria 2690
475 Ga0207665_10057340 3300025939 Bacteria 2631
476 Ga0207665_10071660 3300025939 Bacteria 2366
477 Ga0207665_10733220 3300025939 Bacteria 778
478 Ga0207665_10958136 3300025939 Bacteria 680
479 Ga0207691_10000100 3300025940 Bacteria 75517
480 Ga0207691_10091034 3300025940 Bacteria 2733
481 Ga0207711_10002705 3300025941 Bacteria 15655
482 Ga0207711_10003638 3300025941 Bacteria 13332
483 Ga0207689_10001064 3300025942 Bacteria 26424
484 Ga0207689_10190517 3300025942 Bacteria 1692
485 Ga0207661_10069694 3300025944 Bacteria 2868
486 Ga0207661_10097222 3300025944 Bacteria 2465
487 Ga0207679_10006745 3300025945 Bacteria 7275
488 Ga0207679_10025036 3300025945 Bacteria 4099
489 Ga0207679_10047993 3300025945 Bacteria 3106
490 Ga0207679_11097489 3300025945 Bacteria 730
491 Ga0207667_10003960 3300025949 Bacteria 18222
492 Ga0207667_10032235 3300025949 Bacteria 5649
493 Ga0207667_10528400 3300025949 Bacteria 1195
494 Ga0207667_10939392 3300025949 Bacteria 855
495 Ga0207651_10022185 3300025960 Bacteria 3875
496 Ga0207651_10039181 3300025960 Bacteria 3122
497 Ga0207712_10006475 3300025961 Bacteria 7384
498 Ga0207712_11251663 3300025961 Bacteria 663
499 Ga0207668_10001786 3300025972 Bacteria 12558
500 Ga0207668_10247591 3300025972 Bacteria 1446
501 Ga0207640_10007863 3300025981 Bacteria 5883
502 Ga0207640_10009773 3300025981 Bacteria 5379
503 Ga0207658_10084515 3300025986 Bacteria 2442
504 Ga0207677_10007648 3300026023 Bacteria 5998
505 Ga0207677_10094347 3300026023 Bacteria 2184
506 Ga0207677_10702500 3300026023 Bacteria 897
507 Ga0207703_10303714 3300026035 Bacteria 1456
508 Ga0207703_10652701 3300026035 Bacteria 998
509 Ga0207703_10715150 3300026035 Bacteria 953
510 Ga0207639_10089287 3300026041 Bacteria 2462
511 Ga0207639_10837008 3300026041 Bacteria 858
512 Ga0207639_11535610 3300026041 Bacteria 625
513 Ga0207678_10004899 3300026067 Bacteria 12026
514 Ga0207678_10028864 3300026067 Bacteria 4844
515 Ga0207678_10688343 3300026067 Bacteria 899
516 Ga0207708_10000051 3300026075 Bacteria 108519
517 Ga0207708_10027667 3300026075 Unclassified 4295
518 Ga0207702_10007472 3300026078 Bacteria 9321
519 Ga0207702_10078716 3300026078 Bacteria 2855
520 Ga0207641_10057096 3300026088 Bacteria 3319
521 Ga0207648_10000034 3300026089 Bacteria 125133
522 Ga0207648_10029962 3300026089 Bacteria 4825
523 Ga0207676_10030506 3300026095 Bacteria 4048
524 Ga0207676_10073430 3300026095 Bacteria 2753
525 Ga0207676_10964251 3300026095 Bacteria 839
526 Ga0207674_10101985 3300026116 Bacteria 2850
527 Ga0207674_10144118 3300026116 Bacteria 2341
528 Ga0207675_100121560 3300026118 Bacteria 2471
529 Ga0207675_100210878 3300026118 Bacteria 1868
530 Ga0207675_101432054 3300026118 Bacteria 712
531 Ga0207683_10000013 3300026121 Bacteria 133581
532 Ga0207683_10852638 3300026121 Bacteria 846
533 Ga0207698_10032480 3300026142 Bacteria 3782
534 Ga0207698_10054306 3300026142 Bacteria 3082
535 Ga0209973_1000418 3300027252 Bacteria 3191
536 Ga0209969_1000033 3300027360 Bacteria 16592
537 Ga0209967_1000004 3300027364 Bacteria 29892
538 Ga0209981_1001745 3300027378 Bacteria 2752
539 Ga0209996_1000720 3300027395 Bacteria 3962
540 Ga0209984_1000097 3300027424 Bacteria 9905
541 Ga0210000_1000026 3300027462 Bacteria 22992
542 Ga0209995_1000050 3300027471 Bacteria 18507
543 Ga0209968_1000001 3300027526 Bacteria 93556
544 Ga0209999_1000102 3300027543 Bacteria 10262
545 Ga0209970_1000032 3300027614 Bacteria 18035
546 Ga0210002_1000185 3300027617 Bacteria 8946
547 Ga0209983_1000142 3300027665 Bacteria 13115
548 Ga0209588_1027997 3300027671 Bacteria 1793
549 Ga0209588_1062710 3300027671 Bacteria 1201
550 Ga0209588_1212148 3300027671 Bacteria 601
551 Ga0209971_1000046 3300027682 Bacteria 39347
552 Ga0209966_1000002 3300027695 Bacteria 119552
553 Ga0209998_10000011 3300027717 Bacteria 94915
554 Ga0209974_10000038 3300027876 Bacteria 31908
555 Ga0207428_10000337 3300027907 Bacteria 61014
556 Ga0207428_10233123 3300027907 Bacteria 1377
557 Ga0207428_10290586 3300027907 Bacteria 1211
558 Ga0268266_10030043 3300028379 Bacteria 4617
559 Ga0268265_10746959 3300028380 Unclassified 949
560 Ga0268264_10033264 3300028381 Bacteria 4234
561 Ga0268264_10073609 3300028381 Bacteria 2900
562 Ga0268264_10208979 3300028381 Bacteria 1790
563 Ga0268264_11547523 3300028381 Bacteria 674
564 Ga0268264_11881020 3300028381 Bacteria 608
565 Ga0265319_1079513 3300028563 Bacteria 1042
566 Ga0265334_10016568 3300028573 Bacteria 3047
567 Ga0265323_10028435 3300028653 Bacteria 2096
568 Ga0265338_10005487 3300028800 Bacteria 16534
569 Ga0265338_10007013 3300028800 Bacteria 14145
570 Ga0265338_10223229 3300028800 Bacteria 1406
571 Ga0265770_1024852 3300030878 Bacteria 971
572 Ga0265760_10002098 3300031090 Bacteria 5847
573 Ga0265325_10004087 3300031241 Bacteria 9296
574 Ga0265340_10038047 3300031247 Bacteria 2381
575 Ga0265339_10037987 3300031249 Bacteria 2688
576 Ga0265339_10046693 3300031249 Bacteria 2379
577 Ga0265316_10420902 3300031344 Bacteria 960
578 Ga0307408_100198452 3300031548 Bacteria 1622
579 Ga0265313_10000305 3300031595 Bacteria 53305
580 Ga0265313_10010621 3300031595 Bacteria 5799
581 Ga0265314_10009049 3300031711 Bacteria 8461
582 Ga0307405_11144331 3300031731 Bacteria 671
583 Ga0373930_0009034 3300034816 Bacteria 1756
584 Ga0373934_0044725 3300035086 Bacteria 1750
585 Ga0373944_0016899 3300035089 Bacteria 2064
586 Ga0373952_0099989 3300035092 Bacteria 764
587 Ga0373952_0228987 3300035092 Bacteria 555
588 Ga0373923_0025136 3300035111 Bacteria 2357
589 Ga0373932_0144842 3300035112 Bacteria 811
590 Ga0373936_0007653 3300035113 Bacteria 4058
591 Ga0373941_0004758 3300035115 Bacteria 3157
592 Ga0373945_0000644 3300035116 Bacteria 10060
593 Ga0373953_0070282 3300035117 Bacteria 1443
594 Ga0373954_0059392 3300035118 Bacteria 1802
595 Ga0373956_0075167 3300035119 Bacteria 1545
596 Ga0373957_0044981 3300035120 Bacteria 1671
597 Ga0373960_0256019 3300035121 Bacteria 638
598 Ga0373943_0000107 3300035170 Bacteria 30563
599 Ga0373946_0003824 3300035171 Bacteria 5345
600 Ga0373942_0030753 3300035207 Bacteria 1416
601 Ga0373961_0158842 3300035241 Bacteria 775
602 Ga0373962_0075623 3300035242 Bacteria 1014
603 Ga0373924_0081032 3300035410 Bacteria 1380
604 Ga0373924_0315765 3300035410 Bacteria 694
605 Ga0373931_0002239 3300035691 Bacteria 8547
606 Ga0373931_0048423 3300035691 Bacteria 2253
607 Ga0373935_0000588 3300035692 Bacteria 18933
608 Ga0373927_0000070 3300035695 Bacteria 73849
609 Ga0373933_0034531 3300035724 Bacteria 2947
610 Ga0373947_0000202 3300035725 Bacteria 33146
611 Ga0373947_0589703 3300035725 Bacteria 757
612 Ga0373937_0083219 3300036401 Bacteria 2960
613 Ga0373937_1503508 3300036401 Bacteria 621
614 Ga0373925_0001143 3300037068 Bacteria 23596
615 Ga0373925_1352525 3300037068 Bacteria 584
616 Ga0395899_0099766 3300037312 Bacteria 2097
617 Ga0395900_1666392 3300037418 Bacteria 549
618 Ga0395905_0078563 3300037471 Bacteria 3092
619 Ga0395901_0012858 3300038443 Bacteria 8488
620 Ga0242420_085483 3300038996 Bacteria 656
621 Ga0436365_0265044 3300039437 Bacteria 1462
622 Ga0436365_0416654 3300039437 Bacteria 14987
623 Ga0436360_1354953 3300039438 Bacteria 535
624 Ga0436363_0894046 3300039450 Bacteria 10361
625 Ga0436362_0408064 3300039453 Bacteria 1135
626 Ga0451787_445637 3300041441 Bacteria 516
627 Ga0450890_013862 3300042127 Bacteria 1055
628 Ga0439435_0262688 3300042436 Bacteria 584
629 Ga0439464_0039981 3300042439 Bacteria 1335
630 Ga0439460_0024955 3300042461 Bacteria 1661
631 Ga0451577_0994819 3300042876 Bacteria 753
632 Ga0453684_0107637 3300044712 Bacteria 3394
633 Ga0453684_2483231 3300044712 Bacteria 512
634 Ga0451576_0019085 3300045051 Bacteria 7493
635 Ga0451576_0097676 3300045051 Bacteria 3054
636 Ga0451576_0134369 3300045051 Bacteria 2579
637 Ga0451576_1929631 3300045051 Bacteria 609
638 Ga0495653_0115987 3300046463 Bacteria 1916
639 Ga0495580_0015084 3300046472 Bacteria 5847
640 Ga0495580_0420814 3300046472 Bacteria 899
641 Ga0495662_0376905 3300046476 Bacteria 697
642 Ga0495664_0020194 3300046477 Bacteria 3840
643 Ga0495584_0103319 3300046491 Bacteria 1441
644 Ga0495630_0156574 3300046517 Bacteria 1734
645 Ga0495630_0514175 3300046517 Bacteria 918
646 Ga0495587_0048470 3300046536 Bacteria 2516
647 Ga0495634_0837897 3300046642 Bacteria 523
648 Ga0495657_0148201 3300046675 Bacteria 1459
649 Ga0495624_0037271 3300046690 Bacteria 3130
650 Ga0495581_0288614 3300047315 Bacteria 959
651 Ga0495581_0327482 3300047315 Bacteria 895
652 Ga0495604_0526822 3300047317 Bacteria 764
653 Ga0495636_0104664 3300047318 Bacteria 1240
654 Ga0495674_0158123 3300047319 Bacteria 1897
655 Ga0495676_0111195 3300047321 Bacteria 2010
656 Ga0495680_0295744 3300047322 Bacteria 1138
657 Ga0495680_0885617 3300047322 Bacteria 578
658 Ga0495675_0805145 3300047444 Bacteria 520
659 Ga0495602_0470925 3300048088 Bacteria 883
660 Ga0496100_0058547 3300048903 Bacteria 2529
661 Ga0496100_0909207 3300048903 Bacteria 691
662 Ga0496102_0052629 3300048905 Bacteria 3710
663 Ga0496102_0303074 3300048905 Bacteria 1506
664 Ga0496103_0015479 3300048906 Bacteria 4540
665 Ga0496104_0232183 3300048907 Bacteria 1757
666 Ga0496106_0195492 3300048909 Bacteria 1609
667 Ga0496106_0387338 3300048909 Bacteria 1123
668 Ga0496112_0012312 3300048915 Bacteria 7856
669 Ga0496113_0166107 3300048916 Bacteria 1746
670 Ga0496114_0001136 3300048917 Bacteria 20130
671 Ga0496115_0004423 3300048918 Bacteria 10184
672 Ga0496126_0063178 3300048929 Bacteria 3320
673 Ga0501291_018472 3300049514 Bacteria 1085
674 Ga0501292_076467 3300049515 Bacteria 630
675 Ga0501298_006283 3300049521 Bacteria 1939
676 Ga0501299_009697 3300049522 Bacteria 1593
677 Ga0501300_056751 3300049523 Bacteria 613
678 Ga0501031_0301494 3300049568 Bacteria 1038
679 Ga0501032_0246699 3300049569 Bacteria 1159
680 Ga0501033_0184640 3300049570 Bacteria 1494
681 Ga0501033_0927377 3300049570 Bacteria 584
682 Ga0501034_0000869 3300049571 Bacteria 44611
683 Ga0501034_0488770 3300049571 Bacteria 1145
684 Ga0501036_0027396 3300049572 Bacteria 4816
685 Ga0501036_0075416 3300049572 Bacteria 2852
686 Ga0501036_0182293 3300049572 Bacteria 1767
687 Ga0501038_0019594 3300049574 Bacteria 6094
688 Ga0501038_0444295 3300049574 Bacteria 998
689 Ga0501039_1432863 3300049575 Bacteria 531
690 Ga0501039_1438288 3300049575 Bacteria 530
691 Ga0501040_0132708 3300049576 Bacteria 1752
692 Ga0501041_0056160 3300049577 Bacteria 2405
693 Ga0501042_0171634 3300049578 Bacteria 1565
694 Ga0501043_1053730 3300049579 Bacteria 576
695 Ga0501046_0079385 3300049580 Bacteria 2537
696 Ga0501046_0808537 3300049580 Bacteria 657
697 Ga0501047_0092123 3300049581 Bacteria 2909
698 Ga0501048_0137161 3300049582 Bacteria 1729
699 Ga0501048_0830654 3300049582 Bacteria 664
700 Ga0501048_1159771 3300049582 Bacteria 556
701 Ga0501068_0989772 3300049584 Bacteria 555
702 Ga0501071_0449781 3300049587 Bacteria 986
703 Ga0501071_0642295 3300049587 Bacteria 816
704 Ga0501075_0007312 3300049591 Bacteria 7658
705 Ga0501076_0398947 3300049592 Unclassified 1131
706 Ga0501077_0068233 3300049593 Unclassified 2254
707 Ga0501219_026954 3300049703 Bacteria 525
708 Ga0501079_0103030 3300049741 Bacteria 2213
709 Ga0501080_0355117 3300049742 Bacteria 1323
710 Ga0501081_0022861 3300049743 Bacteria 4186
711 Ga0501083_0218583 3300049744 Bacteria 1242
712 Ga0501035_0215185 3300049822 Bacteria 1643
713 Ga0501035_0420613 3300049822 Bacteria 1109
714 Ga0501035_0627071 3300049822 Bacteria 874
715 Ga0501044_0068034 3300049823 Bacteria 3628
716 Ga0501045_0023631 3300049824 Bacteria 4409
717 Ga0501045_1000876 3300049824 Bacteria 613
718 nmdc:mga07m45_47639_c1 3300050496 Bacteria 2410
719 nmdc:mga05p37_16424_c1 3300050507 Bacteria 8920
720 nmdc:mga09592_1345736_c1 3300050508 Bacteria 585
721 nmdc:mga0qj67_307682_c1 3300050509 Bacteria 1284
722 nmdc:mga0qj67_4_c1 3300050509 Bacteria 176711
723 nmdc:mga06r32_212338_c1 3300050510 Bacteria 1923
724 nmdc:mga06r32_30228_c1 3300050510 Bacteria 5083
725 nmdc:mga06r32_737566_c1 3300050510 Bacteria 949
726 nmdc:mga08y16_17780_c1 3300050511 Bacteria 7489
727 nmdc:mga08y16_277955_c1 3300050511 Bacteria 1728
728 nmdc:mga08y16_66845_c1 3300050511 Bacteria 3751
729 nmdc:mga0n895_2751_c1 3300050512 Bacteria 13887
730 nmdc:mga0n895_374545_c1 3300050512 Bacteria 1441
731 nmdc:mga0n895_71353_c1 3300050512 Bacteria 3444
732 nmdc:mga0rr50_1136_c1 3300050513 Bacteria 14462
733 nmdc:mga0rr50_423263_c1 3300050513 Bacteria 1127
734 nmdc:mga0rr50_643979_c1 3300050513 Bacteria 904
735 nmdc:mga08x19_138933_c1 3300050514 Bacteria 1640
736 nmdc:mga08x19_312204_c1 3300050514 Bacteria 1093
737 nmdc:mga08x19_332951_c1 3300050514 Bacteria 1058
738 nmdc:mga08x19_43548_c1 3300050514 Bacteria 2864
739 nmdc:mga08x19_664740_c1 3300050514 Bacteria 739
740 nmdc:mga08x19_955330_c1 3300050514 Unclassified 609
741 nmdc:mga0a205_171778_c1 3300050515 Bacteria 2064
742 nmdc:mga0a205_192934_c1 3300050515 Bacteria 1929
743 Ga0495619_0130460 3300053085 Bacteria 1727
744 Ga0500566_0191145 3300053094 Bacteria 1042
745 Ga0500556_0000235 3300053104 Bacteria 44892
746 Ga0500593_174714 3300053117 Bacteria 805
747 Ga0500595_224490 3300053119 Bacteria 516
748 Ga0500652_000010 3300053131 Bacteria 162810
749 Ga0500636_0036082 3300053177 Bacteria 2926
750 Ga0500645_039809 3300053730 Bacteria 1392
751 Ga0501084_0353223 3300054114 Bacteria 1242
752 Ga0501084_0719255 3300054114 Bacteria 842
753 Ga0590077_042359 3300059426 Bacteria 1014
754 Ga0501082_0018160 3300060353 Bacteria 6057
755 Ga0530510_0081765 3300061734 Bacteria 2352
756 2511388588 2511231027 Bacteria 5013807
757 2715499287 2713897090 Bacteria 3353799
758 2842876037 2842871566 Bacteria 4827117
759 2928525753 2928521798 Bacteria 4960112
760 2954012160 2954011201 Bacteria 4762601
761 8002289243 8002285264 Bacteria 6717907
762 Ga0070687_100029929
763 SwRhRL3b_contig_3036283
764 JGI24746J21847_1070769
765 JGI24737J22298_10011586
766 JGI26128J50194_1011394
767 JGI26145J50221_1001316
768 Ga0065714_10339184
769 Ga0065715_10026351
770 Ga0065707_10083648
771 Ga0070676_10001301
772 Ga0070676_10019899
773 Ga0070683_100009578
774 Ga0070683_100025787
775 Ga0070690_100001503
776 Ga0070690_100039507
777 Ga0070670_100000392
778 Ga0070670_100795920
779 Ga0068869_100017308
780 Ga0068869_100178390
781 Ga0070666_10004812
782 Ga0070666_10024420
783 Ga0070666_10084373
784 Ga0070680_100001254
785 Ga0070680_100144922
786 Ga0070680_100474009
787 Ga0070680_101201742
788 Ga0070682_100008286
789 Ga0070682_100042808
790 Ga0070682_100097852
791 Ga0068868_100000631
792 Ga0068868_100010455
793 Ga0068868_100085270
794 Ga0068868_100441531
795 Ga0070660_100000949
796 Ga0070660_100034186
797 Ga0070689_100000913
798 Ga0070689_100048898
799 Ga0070691_10003443
800 Ga0070687_100043367
801 Ga0070687_100045001
802 Ga0070687_100167666
803 Ga0070687_100192339
804 Ga0070661_100001397
805 Ga0070661_100046636
806 Ga0070692_10011714
807 Ga0070692_10945831
808 Ga0070668_100000519
809 Ga0070668_100003430
810 Ga0070668_100275440
811 Ga0070669_100000301
812 Ga0070669_100260113
813 Ga0070675_100005318
814 Ga0070675_100073469
815 Ga0070671_100009501
816 Ga0070671_100022515
817 Ga0070671_100512846
818 Ga0070674_100000326
819 Ga0070673_100003391
820 Ga0070673_100082204
821 Ga0070673_100096357
822 Ga0070688_100043150
823 Ga0070688_100147817
824 Ga0070688_100517901
825 Ga0070659_100004252
826 Ga0070659_100090920
827 Ga0070667_100004733
828 Ga0070667_100026175
829 Ga0070667_100052399
830 Ga0070667_100280986
831 Ga0070703_10119272
832 Ga0070709_10011042
833 Ga0070709_10065312
834 Ga0070709_10207205
835 Ga0070709_10305987
836 Ga0070714_100152311
837 Ga0070714_100185372
838 Ga0070714_100947178
839 Ga0070714_102240698
840 Ga0070713_100000876
841 Ga0070713_100110456
842 Ga0070713_100132488
843 Ga0070713_100147676
844 Ga0070710_10057455
845 Ga0070701_10290456
846 Ga0070701_10769062
847 Ga0070711_100106113
848 Ga0070711_100137391
849 Ga0070711_100225063
850 Ga0070711_100255644
851 Ga0070705_100019477
852 Ga0070705_100576392
853 Ga0070705_101930170
854 Ga0070700_100001235
855 Ga0070694_100002303
856 Ga0070694_100066088
857 Ga0070694_100327380
858 Ga0070708_100157715
859 Ga0070708_100259005
860 Ga0070708_100262278
861 Ga0070663_100010560
862 Ga0070663_100031236
863 Ga0070663_100382200
864 Ga0070663_101367454
865 Ga0070678_100001651
866 Ga0070678_100061067
867 Ga0070678_101484876
868 Ga0070678_101824874
869 Ga0070662_100004692
870 Ga0070662_100190315
871 Ga0070662_100712149
872 Ga0070681_10001107
873 Ga0070681_10026349
874 Ga0070681_10154093
875 Ga0070681_10385054
876 Ga0068867_100000390
877 Ga0068867_100013788
878 Ga0070685_10967156
879 Ga0070706_100104323
880 Ga0070706_100282067
881 Ga0070706_101679179
882 Ga0070707_100019684
883 Ga0070707_100046295
884 Ga0070707_100997559
885 Ga0070698_100007655
886 Ga0070698_100074939
887 Ga0070698_100217504
888 Ga0070699_100017443
889 Ga0070699_101242802
890 Ga0070679_100009642
891 Ga0070679_100175944
892 Ga0070679_100316286
893 Ga0070679_100508297
894 Ga0070684_100002340
895 Ga0070684_100014102
896 Ga0070697_100053352
897 Ga0070697_100254819
898 Ga0070697_100558184
899 Ga0068853_100020421
900 Ga0068853_100545403
901 Ga0068853_100927731
902 Ga0070672_100002559
903 Ga0070672_100010108
904 Ga0070672_101525355
905 Ga0070686_100009691
906 Ga0070686_100025301
907 Ga0070686_100060892
908 Ga0070686_100293676
909 Ga0070695_100002278
910 Ga0070695_100026296
911 Ga0070695_100217353
912 Ga0070696_100000652
913 Ga0070696_100025256
914 Ga0070696_100353472
915 Ga0070693_100007814
916 Ga0070693_100082322
917 Ga0070693_100379375
918 Ga0070665_100032890
919 Ga0070704_101193178
920 Ga0070704_101423493
921 Ga0068855_100419764
922 Ga0068855_100665443
923 Ga0068855_101291269
924 Ga0068855_102334177
925 Ga0070664_100000174
926 Ga0070664_100001439
927 Ga0070664_100016225
928 Ga0070664_100066009
929 Ga0070664_100503003
930 Ga0068857_100163919
931 Ga0068854_100005368
932 Ga0068854_100035640
933 Ga0068856_100005248
934 Ga0068856_100481866
935 Ga0068856_101324904
936 Ga0070702_100052699
937 Ga0070702_100258220
938 Ga0068852_100005689
939 Ga0068852_100450456
940 Ga0068859_100004708
941 Ga0068859_100018293
942 Ga0068859_100057797
943 Ga0068859_100176282
944 Ga0068859_101672798
945 Ga0068864_100001076
946 Ga0068864_100012658
947 Ga0068864_100078303
948 Ga0068864_100213562
949 Ga0068864_100787697
950 Ga0068864_100885695
951 Ga0068866_10911846
952 Ga0068861_100047607
953 Ga0068861_100152984
954 Ga0068851_10007324
955 Ga0068851_10383060
956 Ga0068870_10003265
957 Ga0068863_100005556
958 Ga0068863_100010887
959 Ga0068863_100091739
960 Ga0068863_100148856
961 Ga0068858_100097007
962 Ga0068858_100140057
963 Ga0068858_100302247
964 Ga0068860_100006372
965 Ga0068860_100009618
966 Ga0068860_100011083
967 Ga0068860_100054490
968 Ga0068860_100188735
969 Ga0068862_100007868
970 Ga0068862_100073565
971 Ga0068862_100344056
972 Ga0081538_10008034
973 Ga0070717_10024463
974 Ga0070717_10031327
975 Ga0070717_10098074
976 Ga0070717_10255455
977 Ga0070717_10393414
978 Ga0070717_10652982
979 Ga0075432_10002165
980 Ga0075432_10126119
981 Ga0070716_100000237
982 Ga0070716_100038082
983 Ga0070716_100108584
984 Ga0070716_100240202
985 Ga0070716_100409853
986 Ga0070716_100535311
987 Ga0070716_100702306
988 Ga0070712_100000551
989 Ga0070712_101640498
990 Ga0097621_100013930
991 Ga0097621_100028044
992 Ga0097621_100036220
993 Ga0097621_100711635
994 Ga0075370_10069468
995 Ga0068871_100012995
996 Ga0068871_100031475
997 Ga0068871_100045649
998 Ga0068871_100568177
999 Ga0068871_100699394
1000 Ga0075428_100088121
1001 Ga0075428_100104020
1002 Ga0075428_100108429
1003 Ga0075428_100170044
1004 Ga0075428_100614107
1005 Ga0075430_100000359
1006 Ga0075430_100031657
1007 Ga0075431_100002707
1008 Ga0075431_100164504
1009 Ga0075431_100660245
1010 Ga0075433_10010417
1011 Ga0075433_10129938
1012 Ga0075434_100042133
1013 Ga0075434_100333559
1014 Ga0075434_100787839
1015 Ga0075434_101109395
1016 Ga0075434_102380084
1017 Ga0075429_100012398
1018 Ga0075429_100430930
1019 Ga0068865_100000814
1020 Ga0068865_100011443
1021 Ga0068865_100100419
1022 Ga0068865_100137809
1023 Ga0075436_100008572
1024 Ga0075436_100031200
1025 Ga0075436_100103475
1026 Ga0075436_100125523
1027 Ga0075436_100339381
1028 Ga0075436_100816736
1029 Ga0097620_100004708
1030 Ga0097620_100018293
1031 Ga0097620_100057796
1032 Ga0097620_100176287
1033 Ga0097620_101672900
1034 Ga0075435_100036739
1035 Ga0075435_100068086
1036 Ga0075435_100216878
1037 Ga0075435_100232870
1038 Ga0075435_100722498
1039 Ga0099794_10021462
1040 Ga0099794_10188683
1041 Ga0099795_10025978
1042 Ga0099795_10073307
1043 Ga0105250_10551674
1044 Ga0105240_10071358
1045 Ga0105240_10500002
1046 Ga0111539_10002311
1047 Ga0111539_10038086
1048 Ga0111539_10197185
1049 Ga0111539_10212964
1050 Ga0105245_10013372
1051 Ga0105245_10056397
1052 Ga0105245_10882395
1053 Ga0105247_10187871
1054 Ga0105247_11244491
1055 Ga0114129_10009429
1056 Ga0114129_11363257
1057 Ga0114129_11638592
1058 Ga0105243_10001619
1059 Ga0105243_10249662
1060 Ga0105241_10008069
1061 Ga0105241_10029341
1062 Ga0105241_10805934
1063 Ga0105242_10000263
1064 Ga0105242_10006066
1065 Ga0105248_10000525
1066 Ga0105248_10011037
1067 Ga0105248_10573055
1068 Ga0105248_11548792
1069 Ga0105248_12069987
1070 Ga0105248_12232697
1071 Ga0105237_10026026
1072 Ga0105237_10065300
1073 Ga0105237_10217389
1074 Ga0105237_10225202
1075 Ga0105238_10048154
1076 Ga0105238_10197787
1077 Ga0105249_10003059
1078 Ga0105249_10003275
1079 Ga0105249_10125334
1080 Ga0105249_10821353
1081 Ga0099796_10035437
1082 Ga0105239_10043178
1083 Ga0105239_10061439
1084 Ga0105239_10185334
1085 Ga0105246_10000015
1086 Ga0105246_10036384
1087 Ga0157373_10007558
1088 Ga0157373_10070137
1089 Ga0157373_10403657
1090 Ga0157373_10736792
1091 Ga0157371_10087982
1092 Ga0157369_10021326
1093 Ga0157369_12023238
1094 Ga0157369_12203318
1095 Ga0157374_10007404
1096 Ga0157374_10018993
1097 Ga0157374_10237871
1098 Ga0157374_11022486
1099 Ga0157378_10008019
1100 Ga0157378_10013271
1101 Ga0157378_11994870
1102 Ga0163162_10003645
1103 Ga0163162_10014138
1104 Ga0163162_10089117
1105 Ga0163162_10177097
1106 Ga0163162_10248514
1107 Ga0163162_12480743
1108 Ga0157372_10015288
1109 Ga0157372_10035918
1110 Ga0157372_10077167
1111 Ga0157372_11885088
1112 Ga0157372_12284827
1113 Ga0157372_13369654
1114 Ga0157375_10001271
1115 Ga0157375_10017979
1116 Ga0157375_10045383
1117 Ga0157375_10295408
1118 Ga0157375_11031830
1119 Ga0163163_10035239
1120 Ga0163163_10080789
1121 Ga0163163_10171434
1122 Ga0163163_10323881
1123 Ga0157380_10012825
1124 Ga0157380_10059376
1125 Ga0157380_10819334
1126 Ga0157377_10147136
1127 Ga0157377_11266181
1128 Ga0157379_10028421
1129 Ga0157379_10063918
1130 Ga0157379_10088836
1131 Ga0157376_10000017
1132 Ga0157376_10001074
1133 Ga0157376_10084150
1134 Ga0157376_10121942
1135 Ga0157376_10782666
1136 Ga0182005_1047628
1137 Ga0163161_10067609
1138 Ga0213874_10020058
1139 Ga0213876_10001389
1140 Ga0228598_1032691
1141 Ga0209233_1028566
1142 Ga0207656_10005362
1143 Ga0207692_10122485
1144 Ga0207692_11177170
1145 Ga0207642_10179402
1146 Ga0207710_10102408
1147 Ga0207688_10023792
1148 Ga0207688_10441925
1149 Ga0207680_10004311
1150 Ga0207680_10026856
1151 Ga0207680_10097074
1152 Ga0207647_10033302
1153 Ga0207647_10120976
1154 Ga0207699_10006592
1155 Ga0207699_10033211
1156 Ga0207699_10483933
1157 Ga0207699_10888460
1158 Ga0207645_10000032
1159 Ga0207645_10012777
1160 Ga0207645_11223963
1161 Ga0207643_10004833
1162 Ga0207684_10145023
1163 Ga0207684_10684121
1164 Ga0207654_10004038
1165 Ga0207654_10005024
1166 Ga0207707_10009993
1167 Ga0207707_10016144
1168 Ga0207707_10035451
1169 Ga0207707_10725370
1170 Ga0207707_10732753
1171 Ga0207695_10010784
1172 Ga0207695_10686277
1173 Ga0207695_11351349
1174 Ga0207671_10047281
1175 Ga0207671_11042570
1176 Ga0207693_10005205
1177 Ga0207693_10596822
1178 Ga0207693_10944025
1179 Ga0207663_10049918
1180 Ga0207663_10297022
1181 Ga0207663_10298936
1182 Ga0207663_10498872
1183 Ga0207660_10030509
1184 Ga0207660_10054769
1185 Ga0207660_10413101
1186 Ga0207660_10672913
1187 Ga0207662_10020491
1188 Ga0207662_10082489
1189 Ga0207662_10085087
1190 Ga0207657_10001078
1191 Ga0207657_10001179
1192 Ga0207649_10004656
1193 Ga0207652_10179880
1194 Ga0207652_10203441
1195 Ga0207652_10257578
1196 Ga0207646_10006231
1197 Ga0207646_10044299
1198 Ga0207646_10434518
1199 Ga0207681_10310586
1200 Ga0207681_10355466
1201 Ga0207694_10012267
1202 Ga0207650_10005499
1203 Ga0207659_10001944
1204 Ga0207659_10003062
1205 Ga0207687_10002689
1206 Ga0207687_10020393
1207 Ga0207700_10002088
1208 Ga0207700_10034420
1209 Ga0207700_10362929
1210 Ga0207700_10931860
1211 Ga0207664_10000029
1212 Ga0207664_10171898
1213 Ga0207664_10206631
1214 Ga0207664_10275946
1215 Ga0207664_11107987
1216 Ga0207644_10097781
1217 Ga0207690_10001499
1218 Ga0207690_10334722
1219 Ga0207706_10000100
1220 Ga0207706_10000507
1221 Ga0207706_10609993
1222 Ga0207686_10004154
1223 Ga0207686_10037971
1224 Ga0207686_10062140
1225 Ga0207709_10018277
1226 Ga0207709_10190889
1227 Ga0207709_10437726
1228 Ga0207670_10005319
1229 Ga0207669_10001776
1230 Ga0207704_10001431
1231 Ga0207704_10089521
1232 Ga0207704_10659929
1233 Ga0207665_10018207
1234 Ga0207665_10050687
1235 Ga0207665_10054792
1236 Ga0207665_10057340
1237 Ga0207665_10071660
1238 Ga0207665_10733220
1239 Ga0207665_10958136
1240 Ga0207691_10000100
1241 Ga0207691_10091034
1242 Ga0207711_10002705
1243 Ga0207711_10003638
1244 Ga0207689_10001064
1245 Ga0207689_10190517
1246 Ga0207661_10069694
1247 Ga0207661_10097222
1248 Ga0207679_10006745
1249 Ga0207679_10025036
1250 Ga0207679_10047993
1251 Ga0207679_11097489
1252 Ga0207667_10003960
1253 Ga0207667_10032235
1254 Ga0207667_10528400
1255 Ga0207667_10939392
1256 Ga0207651_10022185
1257 Ga0207651_10039181
1258 Ga0207712_10006475
1259 Ga0207712_11251663
1260 Ga0207668_10001786
1261 Ga0207668_10247591
1262 Ga0207640_10007863
1263 Ga0207640_10009773
1264 Ga0207658_10084515
1265 Ga0207677_10007648
1266 Ga0207677_10094347
1267 Ga0207677_10702500
1268 Ga0207703_10303714
1269 Ga0207703_10652701
1270 Ga0207703_10715150
1271 Ga0207639_10089287
1272 Ga0207639_10837008
1273 Ga0207639_11535610
1274 Ga0207678_10004899
1275 Ga0207678_10028864
1276 Ga0207678_10688343
1277 Ga0207708_10000051
1278 Ga0207708_10027667
1279 Ga0207702_10007472
1280 Ga0207702_10078716
1281 Ga0207641_10057096
1282 Ga0207648_10000034
1283 Ga0207648_10029962
1284 Ga0207676_10030506
1285 Ga0207676_10073430
1286 Ga0207676_10964251
1287 Ga0207674_10101985
1288 Ga0207674_10144118
1289 Ga0207675_100121560
1290 Ga0207675_100210878
1291 Ga0207675_101432054
1292 Ga0207683_10000013
1293 Ga0207683_10852638
1294 Ga0207698_10032480
1295 Ga0207698_10054306
1296 Ga0209973_1000418
1297 Ga0209969_1000033
1298 Ga0209967_1000004
1299 Ga0209981_1001745
1300 Ga0209996_1000720
1301 Ga0209984_1000097
1302 Ga0210000_1000026
1303 Ga0209995_1000050
1304 Ga0209968_1000001
1305 Ga0209999_1000102
1306 Ga0209970_1000032
1307 Ga0210002_1000185
1308 Ga0209983_1000142
1309 Ga0209588_1027997
1310 Ga0209588_1062710
1311 Ga0209588_1212148
1312 Ga0209971_1000046
1313 Ga0209966_1000002
1314 Ga0209998_10000011
1315 Ga0209974_10000038
1316 Ga0207428_10000337
1317 Ga0207428_10233123
1318 Ga0207428_10290586
1319 Ga0268266_10030043
1320 Ga0268265_10746959
1321 Ga0268264_10033264
1322 Ga0268264_10073609
1323 Ga0268264_10208979
1324 Ga0268264_11547523
1325 Ga0268264_11881020
1326 Ga0265319_1079513
1327 Ga0265334_10016568
1328 Ga0265323_10028435
1329 Ga0265338_10005487
1330 Ga0265338_10007013
1331 Ga0265338_10223229
1332 Ga0265770_1024852
1333 Ga0265760_10002098
1334 Ga0265325_10004087
1335 Ga0265340_10038047
1336 Ga0265339_10037987
1337 Ga0265339_10046693
1338 Ga0265316_10420902
1339 Ga0307408_100198452
1340 Ga0265313_10000305
1341 Ga0265313_10010621
1342 Ga0265314_10009049
1343 Ga0307405_11144331
1344 Ga0373930_0009034
1345 Ga0373934_0044725
1346 Ga0373944_0016899
1347 Ga0373952_0099989
1348 Ga0373952_0228987
1349 Ga0373923_0025136
1350 Ga0373932_0144842
1351 Ga0373936_0007653
1352 Ga0373941_0004758
1353 Ga0373945_0000644
1354 Ga0373953_0070282
1355 Ga0373954_0059392
1356 Ga0373956_0075167
1357 Ga0373957_0044981
1358 Ga0373960_0256019
1359 Ga0373943_0000107
1360 Ga0373946_0003824
1361 Ga0373942_0030753
1362 Ga0373961_0158842
1363 Ga0373962_0075623
1364 Ga0373924_0081032
1365 Ga0373924_0315765
1366 Ga0373931_0002239
1367 Ga0373931_0048423
1368 Ga0373935_0000588
1369 Ga0373927_0000070
1370 Ga0373933_0034531
1371 Ga0373947_0000202
1372 Ga0373947_0589703
1373 Ga0373937_0083219
1374 Ga0373937_1503508
1375 Ga0373925_0001143
1376 Ga0373925_1352525
1377 Ga0395899_0099766
1378 Ga0395900_1666392
1379 Ga0395905_0078563
1380 Ga0395901_0012858
1381 Ga0242420_085483
1382 Ga0436365_0265044
1383 Ga0436365_0416654
1384 Ga0436360_1354953
1385 Ga0436363_0894046
1386 Ga0436362_0408064
1387 Ga0451787_445637
1388 Ga0450890_013862
1389 Ga0439435_0262688
1390 Ga0439464_0039981
1391 Ga0439460_0024955
1392 Ga0451577_0994819
1393 Ga0453684_0107637
1394 Ga0453684_2483231
1395 Ga0451576_0019085
1396 Ga0451576_0097676
1397 Ga0451576_0134369
1398 Ga0451576_1929631
1399 Ga0495653_0115987
1400 Ga0495580_0015084
1401 Ga0495580_0420814
1402 Ga0495662_0376905
1403 Ga0495664_0020194
1404 Ga0495584_0103319
1405 Ga0495630_0156574
1406 Ga0495630_0514175
1407 Ga0495587_0048470
1408 Ga0495634_0837897
1409 Ga0495657_0148201
1410 Ga0495624_0037271
1411 Ga0495581_0288614
1412 Ga0495581_0327482
1413 Ga0495604_0526822
1414 Ga0495636_0104664
1415 Ga0495674_0158123
1416 Ga0495676_0111195
1417 Ga0495680_0295744
1418 Ga0495680_0885617
1419 Ga0495675_0805145
1420 Ga0495602_0470925
1421 Ga0496100_0058547
1422 Ga0496100_0909207
1423 Ga0496102_0052629
1424 Ga0496102_0303074
1425 Ga0496103_0015479
1426 Ga0496104_0232183
1427 Ga0496106_0195492
1428 Ga0496106_0387338
1429 Ga0496112_0012312
1430 Ga0496113_0166107
1431 Ga0496114_0001136
1432 Ga0496115_0004423
1433 Ga0496126_0063178
1434 Ga0501291_018472
1435 Ga0501292_076467
1436 Ga0501298_006283
1437 Ga0501299_009697
1438 Ga0501300_056751
1439 Ga0501031_0301494
1440 Ga0501032_0246699
1441 Ga0501033_0184640
1442 Ga0501033_0927377
1443 Ga0501034_0000869
1444 Ga0501034_0488770
1445 Ga0501036_0027396
1446 Ga0501036_0075416
1447 Ga0501036_0182293
1448 Ga0501038_0019594
1449 Ga0501038_0444295
1450 Ga0501039_1432863
1451 Ga0501039_1438288
1452 Ga0501040_0132708
1453 Ga0501041_0056160
1454 Ga0501042_0171634
1455 Ga0501043_1053730
1456 Ga0501046_0079385
1457 Ga0501046_0808537
1458 Ga0501047_0092123
1459 Ga0501048_0137161
1460 Ga0501048_0830654
1461 Ga0501048_1159771
1462 Ga0501068_0989772
1463 Ga0501071_0449781
1464 Ga0501071_0642295
1465 Ga0501075_0007312
1466 Ga0501076_0398947
1467 Ga0501077_0068233
1468 Ga0501219_026954
1469 Ga0501079_0103030
1470 Ga0501080_0355117
1471 Ga0501081_0022861
1472 Ga0501083_0218583
1473 Ga0501035_0215185
1474 Ga0501035_0420613
1475 Ga0501035_0627071
1476 Ga0501044_0068034
1477 Ga0501045_0023631
1478 Ga0501045_1000876
1479 nmdc:mga07m45_47639_c1
1480 nmdc:mga05p37_16424_c1
1481 nmdc:mga09592_1345736_c1
1482 nmdc:mga0qj67_307682_c1
1483 nmdc:mga0qj67_4_c1
1484 nmdc:mga06r32_212338_c1
1485 nmdc:mga06r32_30228_c1
1486 nmdc:mga06r32_737566_c1
1487 nmdc:mga08y16_17780_c1
1488 nmdc:mga08y16_277955_c1
1489 nmdc:mga08y16_66845_c1
1490 nmdc:mga0n895_2751_c1
1491 nmdc:mga0n895_374545_c1
1492 nmdc:mga0n895_71353_c1
1493 nmdc:mga0rr50_1136_c1
1494 nmdc:mga0rr50_423263_c1
1495 nmdc:mga0rr50_643979_c1
1496 nmdc:mga08x19_138933_c1
1497 nmdc:mga08x19_312204_c1
1498 nmdc:mga08x19_332951_c1
1499 nmdc:mga08x19_43548_c1
1500 nmdc:mga08x19_664740_c1
1501 nmdc:mga08x19_955330_c1
1502 nmdc:mga0a205_171778_c1
1503 nmdc:mga0a205_192934_c1
1504 Ga0495619_0130460
1505 Ga0500566_0191145
1506 Ga0500556_0000235
1507 Ga0500593_174714
1508 Ga0500595_224490
1509 Ga0500652_000010
1510 Ga0500636_0036082
1511 Ga0500645_039809
1512 Ga0501084_0353223
1513 Ga0501084_0719255
1514 Ga0590077_042359
1515 Ga0501082_0018160
1516 Ga0530510_0081765
1517 2511388588
1518 2715499287
1519 2842876037
1520 2928525753
1521 2954012160
1522 8002289243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04342

DMT_6

Putative member of DMT superfamily (DUF486)

29

132

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7225 3 105
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.7097 3 106
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.7027 3 105
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.6955 3 105
7svx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and harmane 0.6887 3 105
ID Description Score Start End Superfamily
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7923 3 105 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7897 4 105 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7818 3 105 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7768 3 105 1.10.3730.20
af_P76169_1_108_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7618 3 105 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A7Y5RDD7-F1-model_v4 DMT family protein 0.983 1 109 GO:0016020
AF-A0A167GD83-F1-model_v4 Transmembrane signal peptide protein 0.9771 2 108 GO:0016020
AF-A0A0U2JDX8-F1-model_v4 DMT family protein 0.9756 1 78 GO:0016020
AF-A0A7C5ZVP1-F1-model_v4 DMT family protein 0.9753 2 108 GO:0016020
AF-A0A844HJM8-F1-model_v4 DMT family protein 0.9748 2 106 GO:0016020

Map