F479545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 760 | 437 | 738 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0101280|Ga0466963_0101280_608_1438 |
| Length | 276 |
| Sequence | LRPIHWDAKRSDEAQLSRVDGEMLLLAMHRPCDNAESKAGDDAMITLRRSQERGYADHGWLRSFHSFSFAGYYDPAHMGWGNLRVINEDRIAPGAGFGKHGHRDMEIISYVLEGELAHQDSMGNVKGIPPGDVQRMSAGTGVVHSEFNHAKGETTHFLQIWIEPNVTGIAPSYEQKTIPADDKRGKLRLVASTDGRQGSVTIHADANVYAGLFDGAETAHIALDPRRKGYVHLIRGSLDVNGRSLAAGDAALLEDESSITLSNGKDAEALVFDLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 5 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 6 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 11 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 12 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 13 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 14 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 15 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 16 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 17 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 18 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 19 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 20 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 21 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 22 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 23 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 24 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 31 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 112 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 133 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 134 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 165 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 259 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 263 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 264 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 265 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 273 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 274 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 275 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 278 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 279 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 283 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 286 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 309 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 310 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 311 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 312 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 313 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 316 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 319 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 371 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 372 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 399 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 400 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 405 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 410 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 411 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 422 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 425 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 426 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 427 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 428 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 429 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 430 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 431 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 437 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.45 |
| Metatranscriptomes | 0.79 |
| Isolates | 2.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.47 |
| Nodule | 0.53 |
| Rhizoplane | 1.97 |
| Rhizosphere | 77.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000008 | 3300002704 | Bacteria | 236146 |
| 2 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 3 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 4 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 5 | JGI25150J39212_1028518 | 3300002774 | Bacteria | 790 |
| 6 | JGI25159J45721_1001868 | 3300002987 | Bacteria | 8416 |
| 7 | JGI25159J45721_1002408 | 3300002987 | Bacteria | 7114 |
| 8 | JGI25151J46595_10003749 | 3300003187 | Bacteria | 8250 |
| 9 | JGI25151J46595_10004501 | 3300003187 | Bacteria | 7364 |
| 10 | rootL2_10142603 | 3300003322 | Bacteria | 6473 |
| 11 | JGI26128J50194_1001075 | 3300003347 | Bacteria | 1683 |
| 12 | JGI25160J50197_1000342 | 3300003354 | Bacteria | 31433 |
| 13 | JGI25160J50197_1016285 | 3300003354 | Bacteria | 2401 |
| 14 | JGI25161J50226_1000259 | 3300003374 | Bacteria | 31433 |
| 15 | Ga0055538_1000019 | 3300003751 | Bacteria | 282365 |
| 16 | Ga0055539_1000024 | 3300003752 | Bacteria | 282365 |
| 17 | Ga0055533_1000032 | 3300003756 | Bacteria | 282365 |
| 18 | Ga0055525_1000041 | 3300003759 | Bacteria | 282365 |
| 19 | Ga0055526_1001483 | 3300003771 | Bacteria | 16653 |
| 20 | Ga0055526_1003973 | 3300003771 | Bacteria | 9110 |
| 21 | Ga0055537_1000102 | 3300003773 | Bacteria | 63809 |
| 22 | Ga0055537_1005851 | 3300003773 | Bacteria | 3219 |
| 23 | Ga0055524_1000093 | 3300003775 | Bacteria | 111953 |
| 24 | Ga0055524_1000606 | 3300003775 | Bacteria | 25747 |
| 25 | Ga0055536_1006611 | 3300003781 | Bacteria | 5351 |
| 26 | Ga0055534_1001043 | 3300003784 | Bacteria | 12113 |
| 27 | Ga0055534_1002793 | 3300003784 | Bacteria | 5830 |
| 28 | Ga0055528_1000696 | 3300003790 | Bacteria | 23933 |
| 29 | Ga0055530_10000891 | 3300003791 | Bacteria | 24561 |
| 30 | Ga0055540_1000089 | 3300003792 | Bacteria | 100214 |
| 31 | Ga0055540_1000196 | 3300003792 | Bacteria | 58476 |
| 32 | Ga0055531_10004653 | 3300003794 | Bacteria | 8237 |
| 33 | Ga0055541_1000018 | 3300003841 | Bacteria | 282365 |
| 34 | Ga0055543_1000527 | 3300004625 | Bacteria | 21646 |
| 35 | Ga0065165_1004504 | 3300005262 | Bacteria | 8562 |
| 36 | Ga0065165_1005633 | 3300005262 | Bacteria | 6928 |
| 37 | Ga0065165_1006014 | 3300005262 | Bacteria | 6540 |
| 38 | Ga0065714_10028103 | 3300005288 | Bacteria | 1035 |
| 39 | Ga0065714_10076714 | 3300005288 | Bacteria | 2762 |
| 40 | Ga0065715_10000585 | 3300005293 | Bacteria | 14517 |
| 41 | Ga0070658_10006296 | 3300005327 | Bacteria | 9614 |
| 42 | Ga0070658_10063873 | 3300005327 | Bacteria | 3002 |
| 43 | Ga0070658_10485685 | 3300005327 | Bacteria | 1066 |
| 44 | Ga0070683_100013440 | 3300005329 | Bacteria | 7140 |
| 45 | Ga0070683_100119856 | 3300005329 | Bacteria | 2485 |
| 46 | Ga0070690_100018254 | 3300005330 | Bacteria | 4234 |
| 47 | Ga0070670_100003183 | 3300005331 | Bacteria | 13549 |
| 48 | Ga0070670_100015364 | 3300005331 | Bacteria | 6574 |
| 49 | Ga0070670_100050796 | 3300005331 | Bacteria | 3563 |
| 50 | Ga0070677_10068946 | 3300005333 | Bacteria | 1482 |
| 51 | Ga0068869_100000205 | 3300005334 | Bacteria | 30762 |
| 52 | Ga0068869_100100872 | 3300005334 | Bacteria | 2183 |
| 53 | Ga0068869_100297452 | 3300005334 | Bacteria | 1302 |
| 54 | Ga0070666_10001671 | 3300005335 | Bacteria | 13535 |
| 55 | Ga0070680_100004745 | 3300005336 | Bacteria | 10233 |
| 56 | Ga0070680_100026210 | 3300005336 | Bacteria | 4662 |
| 57 | Ga0070682_100000180 | 3300005337 | Bacteria | 47178 |
| 58 | Ga0068868_100213446 | 3300005338 | Bacteria | 1614 |
| 59 | Ga0070660_100000321 | 3300005339 | Bacteria | 31730 |
| 60 | Ga0070660_100025968 | 3300005339 | Bacteria | 4358 |
| 61 | Ga0070660_100113763 | 3300005339 | Bacteria | 2155 |
| 62 | Ga0070660_100732330 | 3300005339 | Bacteria | 830 |
| 63 | Ga0070689_100366130 | 3300005340 | Bacteria | 1212 |
| 64 | Ga0070691_10075486 | 3300005341 | Bacteria | 1642 |
| 65 | Ga0070687_100112234 | 3300005343 | Bacteria | 1545 |
| 66 | Ga0070661_100005929 | 3300005344 | Bacteria | 8413 |
| 67 | Ga0070661_100057362 | 3300005344 | Bacteria | 2854 |
| 68 | Ga0070661_100203509 | 3300005344 | Bacteria | 1513 |
| 69 | Ga0070661_100600764 | 3300005344 | Bacteria | 889 |
| 70 | Ga0070692_10002301 | 3300005345 | Bacteria | 7355 |
| 71 | Ga0070668_100007445 | 3300005347 | Bacteria | 8122 |
| 72 | Ga0070669_100148852 | 3300005353 | Bacteria | 1811 |
| 73 | Ga0070675_100008402 | 3300005354 | Bacteria | 8010 |
| 74 | Ga0070675_100269821 | 3300005354 | Bacteria | 1493 |
| 75 | Ga0070675_100615831 | 3300005354 | Bacteria | 985 |
| 76 | Ga0070671_100002283 | 3300005355 | Bacteria | 14795 |
| 77 | Ga0070671_100100449 | 3300005355 | Bacteria | 2427 |
| 78 | Ga0070674_100001737 | 3300005356 | Bacteria | 11801 |
| 79 | Ga0070673_100000414 | 3300005364 | Bacteria | 22528 |
| 80 | Ga0070673_100006199 | 3300005364 | Bacteria | 7757 |
| 81 | Ga0070688_100043076 | 3300005365 | Bacteria | 2779 |
| 82 | Ga0070659_100000881 | 3300005366 | Bacteria | 21948 |
| 83 | Ga0070659_100007664 | 3300005366 | Bacteria | 7850 |
| 84 | Ga0070667_100022534 | 3300005367 | Bacteria | 5222 |
| 85 | Ga0070667_100074164 | 3300005367 | Bacteria | 2902 |
| 86 | Ga0070667_100243904 | 3300005367 | Bacteria | 1605 |
| 87 | Ga0070703_10001102 | 3300005406 | Bacteria | 8382 |
| 88 | Ga0070709_10006612 | 3300005434 | Bacteria | 6325 |
| 89 | Ga0070709_10318978 | 3300005434 | Bacteria | 1140 |
| 90 | Ga0070714_100067425 | 3300005435 | Bacteria | 3085 |
| 91 | Ga0070710_10026855 | 3300005437 | Bacteria | 3065 |
| 92 | Ga0070710_10381774 | 3300005437 | Bacteria | 940 |
| 93 | Ga0070711_100012774 | 3300005439 | Bacteria | 5256 |
| 94 | Ga0070711_100138301 | 3300005439 | Bacteria | 1823 |
| 95 | Ga0070705_100000078 | 3300005440 | Bacteria | 53383 |
| 96 | Ga0070694_100001715 | 3300005444 | Bacteria | 12918 |
| 97 | Ga0070663_100003555 | 3300005455 | Bacteria | 9001 |
| 98 | Ga0070663_100036402 | 3300005455 | Bacteria | 3420 |
| 99 | Ga0070663_100045392 | 3300005455 | Bacteria | 3104 |
| 100 | Ga0070663_100056080 | 3300005455 | Bacteria | 2822 |
| 101 | Ga0070678_100004553 | 3300005456 | Bacteria | 7874 |
| 102 | Ga0070678_100016630 | 3300005456 | Bacteria | 4712 |
| 103 | Ga0070662_100001051 | 3300005457 | Bacteria | 16865 |
| 104 | Ga0070662_100062976 | 3300005457 | Bacteria | 2712 |
| 105 | Ga0070681_10003260 | 3300005458 | Bacteria | 15135 |
| 106 | Ga0070681_10006915 | 3300005458 | Bacteria | 11043 |
| 107 | Ga0070681_10054456 | 3300005458 | Bacteria | 3986 |
| 108 | Ga0070681_10612792 | 3300005458 | Bacteria | 1003 |
| 109 | Ga0068867_100000642 | 3300005459 | Bacteria | 23127 |
| 110 | Ga0068867_100004322 | 3300005459 | Bacteria | 10002 |
| 111 | Ga0068867_100111808 | 3300005459 | Bacteria | 2099 |
| 112 | Ga0068867_100149513 | 3300005459 | Bacteria | 1833 |
| 113 | Ga0070706_100097493 | 3300005467 | Bacteria | 2731 |
| 114 | Ga0070706_100583745 | 3300005467 | Bacteria | 1039 |
| 115 | Ga0070706_100899436 | 3300005467 | Bacteria | 818 |
| 116 | Ga0070707_100407961 | 3300005468 | Bacteria | 1319 |
| 117 | Ga0070699_100100198 | 3300005518 | Bacteria | 2539 |
| 118 | Ga0070699_100221582 | 3300005518 | Bacteria | 1686 |
| 119 | Ga0070679_100000702 | 3300005530 | Bacteria | 28706 |
| 120 | Ga0070679_100024228 | 3300005530 | Bacteria | 5947 |
| 121 | Ga0070684_100001566 | 3300005535 | Bacteria | 16508 |
| 122 | Ga0070697_100093457 | 3300005536 | Bacteria | 2490 |
| 123 | Ga0068853_100000255 | 3300005539 | Bacteria | 37353 |
| 124 | Ga0068853_100005722 | 3300005539 | Bacteria | 9783 |
| 125 | Ga0068853_100012208 | 3300005539 | Bacteria | 6986 |
| 126 | Ga0068853_100181494 | 3300005539 | Bacteria | 1909 |
| 127 | Ga0068853_100610168 | 3300005539 | Bacteria | 1037 |
| 128 | Ga0070672_100006664 | 3300005543 | Bacteria | 7779 |
| 129 | Ga0070672_100013507 | 3300005543 | Bacteria | 5772 |
| 130 | Ga0070672_100111344 | 3300005543 | Bacteria | 2232 |
| 131 | Ga0070695_100001050 | 3300005545 | Bacteria | 15103 |
| 132 | Ga0070695_100001834 | 3300005545 | Bacteria | 11980 |
| 133 | Ga0070696_100034665 | 3300005546 | Bacteria | 3473 |
| 134 | Ga0070693_100000163 | 3300005547 | Bacteria | 30819 |
| 135 | Ga0070693_100000754 | 3300005547 | Bacteria | 14323 |
| 136 | Ga0070693_100027690 | 3300005547 | Bacteria | 3074 |
| 137 | Ga0070665_100001831 | 3300005548 | Bacteria | 24144 |
| 138 | Ga0070665_100024636 | 3300005548 | Bacteria | 6063 |
| 139 | Ga0070704_100008672 | 3300005549 | Bacteria | 6112 |
| 140 | Ga0068855_100003137 | 3300005563 | Bacteria | 20214 |
| 141 | Ga0068855_100004144 | 3300005563 | Bacteria | 17691 |
| 142 | Ga0068855_100054072 | 3300005563 | Bacteria | 4721 |
| 143 | Ga0068855_100203970 | 3300005563 | Bacteria | 2225 |
| 144 | Ga0070664_100006434 | 3300005564 | Bacteria | 9476 |
| 145 | Ga0070664_100008022 | 3300005564 | Bacteria | 8529 |
| 146 | Ga0068857_100040360 | 3300005577 | Bacteria | 4138 |
| 147 | Ga0068854_100000709 | 3300005578 | Bacteria | 19745 |
| 148 | Ga0068854_100003114 | 3300005578 | Bacteria | 10320 |
| 149 | Ga0068854_100011172 | 3300005578 | Bacteria | 5833 |
| 150 | Ga0068854_100203609 | 3300005578 | Bacteria | 1557 |
| 151 | Ga0068856_100011686 | 3300005614 | Bacteria | 8516 |
| 152 | Ga0068856_100018398 | 3300005614 | Bacteria | 6771 |
| 153 | Ga0068856_100019664 | 3300005614 | Bacteria | 6555 |
| 154 | Ga0068856_100394237 | 3300005614 | Bacteria | 1404 |
| 155 | Ga0070702_100196285 | 3300005615 | Bacteria | 1332 |
| 156 | Ga0068852_100003709 | 3300005616 | Bacteria | 10702 |
| 157 | Ga0068852_100165800 | 3300005616 | Bacteria | 2067 |
| 158 | Ga0068852_100181355 | 3300005616 | Bacteria | 1980 |
| 159 | Ga0068859_100010878 | 3300005617 | Bacteria | 9156 |
| 160 | Ga0068859_100032413 | 3300005617 | Bacteria | 5250 |
| 161 | Ga0068859_100269160 | 3300005617 | Bacteria | 1796 |
| 162 | Ga0068864_100009447 | 3300005618 | Bacteria | 8048 |
| 163 | Ga0068864_100043522 | 3300005618 | Bacteria | 3845 |
| 164 | Ga0068864_100158672 | 3300005618 | Bacteria | 2055 |
| 165 | Ga0068864_100196521 | 3300005618 | Bacteria | 1851 |
| 166 | Ga0068864_100859563 | 3300005618 | Unclassified | 894 |
| 167 | Ga0068866_10002311 | 3300005718 | Bacteria | 7896 |
| 168 | Ga0068861_100226500 | 3300005719 | Bacteria | 1583 |
| 169 | Ga0068861_100818218 | 3300005719 | Bacteria | 876 |
| 170 | Ga0068851_10000963 | 3300005834 | Bacteria | 12458 |
| 171 | Ga0068851_10005511 | 3300005834 | Bacteria | 5736 |
| 172 | Ga0068851_10030349 | 3300005834 | Bacteria | 2681 |
| 173 | Ga0068851_10031907 | 3300005834 | Bacteria | 2619 |
| 174 | Ga0068870_10000769 | 3300005840 | Bacteria | 12346 |
| 175 | Ga0068870_10499007 | 3300005840 | Bacteria | 811 |
| 176 | Ga0068863_100003538 | 3300005841 | Bacteria | 15417 |
| 177 | Ga0068863_100034158 | 3300005841 | Bacteria | 4844 |
| 178 | Ga0068863_100160162 | 3300005841 | Bacteria | 2156 |
| 179 | Ga0068858_100006057 | 3300005842 | Bacteria | 11788 |
| 180 | Ga0068860_100009497 | 3300005843 | Bacteria | 9659 |
| 181 | Ga0068860_100017520 | 3300005843 | Bacteria | 6980 |
| 182 | Ga0068860_100037793 | 3300005843 | Bacteria | 4620 |
| 183 | Ga0068860_100051083 | 3300005843 | Bacteria | 3935 |
| 184 | Ga0068862_100001036 | 3300005844 | Bacteria | 26683 |
| 185 | Ga0068862_100098895 | 3300005844 | Bacteria | 2549 |
| 186 | Ga0068862_100203779 | 3300005844 | Bacteria | 1785 |
| 187 | Ga0081539_10051073 | 3300005985 | Bacteria | 2333 |
| 188 | Ga0070716_100077917 | 3300006173 | Bacteria | 1969 |
| 189 | Ga0070712_100049133 | 3300006175 | Bacteria | 2928 |
| 190 | Ga0070712_100940678 | 3300006175 | Bacteria | 746 |
| 191 | Ga0075362_10132739 | 3300006177 | Bacteria | 1185 |
| 192 | Ga0075362_10154208 | 3300006177 | Bacteria | 1103 |
| 193 | Ga0075367_10025914 | 3300006178 | Bacteria | 3319 |
| 194 | Ga0075367_10049042 | 3300006178 | Bacteria | 2489 |
| 195 | Ga0075367_10284136 | 3300006178 | Bacteria | 1040 |
| 196 | Ga0075366_10003459 | 3300006195 | Bacteria | 8335 |
| 197 | Ga0075366_10067100 | 3300006195 | Bacteria | 2134 |
| 198 | Ga0075366_10085271 | 3300006195 | Bacteria | 1889 |
| 199 | Ga0097621_100020664 | 3300006237 | Bacteria | 5077 |
| 200 | Ga0075370_10000726 | 3300006353 | Bacteria | 13103 |
| 201 | Ga0075370_10001753 | 3300006353 | Bacteria | 9669 |
| 202 | Ga0075370_10079724 | 3300006353 | Bacteria | 1881 |
| 203 | Ga0075370_10160842 | 3300006353 | Bacteria | 1318 |
| 204 | Ga0075370_10168532 | 3300006353 | Bacteria | 1287 |
| 205 | Ga0068871_100156297 | 3300006358 | Bacteria | 1947 |
| 206 | Ga0068871_100428970 | 3300006358 | Bacteria | 1182 |
| 207 | Ga0075428_100369594 | 3300006844 | Bacteria | 1538 |
| 208 | Ga0075431_100344011 | 3300006847 | Bacteria | 1500 |
| 209 | Ga0075434_100052781 | 3300006871 | Bacteria | 4040 |
| 210 | Ga0075434_100505625 | 3300006871 | Bacteria | 1229 |
| 211 | Ga0075429_100051315 | 3300006880 | Bacteria | 3589 |
| 212 | Ga0068865_100032504 | 3300006881 | Bacteria | 3486 |
| 213 | Ga0068865_100157495 | 3300006881 | Bacteria | 1729 |
| 214 | Ga0075436_100052221 | 3300006914 | Bacteria | 2821 |
| 215 | Ga0097620_100010879 | 3300006931 | Bacteria | 9156 |
| 216 | Ga0097620_100032411 | 3300006931 | Bacteria | 5250 |
| 217 | Ga0097620_100269178 | 3300006931 | Bacteria | 1796 |
| 218 | Ga0079104_1000970 | 3300006946 | Bacteria | 22460 |
| 219 | Ga0079104_1010113 | 3300006946 | Bacteria | 3135 |
| 220 | Ga0075435_100007737 | 3300007076 | Bacteria | 7681 |
| 221 | Ga0099794_10009804 | 3300007265 | Bacteria | 4044 |
| 222 | Ga0099794_10015415 | 3300007265 | Bacteria | 3373 |
| 223 | Ga0105240_10012204 | 3300009093 | Bacteria | 11882 |
| 224 | Ga0105240_10092977 | 3300009093 | Bacteria | 3682 |
| 225 | Ga0105240_10119142 | 3300009093 | Bacteria | 3180 |
| 226 | Ga0105240_10211547 | 3300009093 | Bacteria | 2266 |
| 227 | Ga0105240_10212393 | 3300009093 | Bacteria | 2260 |
| 228 | Ga0105240_10269429 | 3300009093 | Bacteria | 1961 |
| 229 | Ga0111539_10129855 | 3300009094 | Bacteria | 2951 |
| 230 | Ga0105245_10016167 | 3300009098 | Bacteria | 6502 |
| 231 | Ga0114129_10126434 | 3300009147 | Bacteria | 3514 |
| 232 | Ga0105243_10198138 | 3300009148 | Bacteria | 1759 |
| 233 | Ga0105241_10000415 | 3300009174 | Bacteria | 32268 |
| 234 | Ga0105241_10000746 | 3300009174 | Bacteria | 24758 |
| 235 | Ga0105241_10007582 | 3300009174 | Bacteria | 7978 |
| 236 | Ga0105241_10060181 | 3300009174 | Bacteria | 2921 |
| 237 | Ga0105241_10234661 | 3300009174 | Bacteria | 1548 |
| 238 | Ga0105242_10028027 | 3300009176 | Bacteria | 4481 |
| 239 | Ga0105242_10034642 | 3300009176 | Bacteria | 4048 |
| 240 | Ga0105248_10106882 | 3300009177 | Bacteria | 3155 |
| 241 | Ga0105248_10425935 | 3300009177 | Bacteria | 1495 |
| 242 | Ga0105237_10014925 | 3300009545 | Bacteria | 8101 |
| 243 | Ga0105249_11208747 | 3300009553 | Bacteria | 827 |
| 244 | Ga0105239_10016788 | 3300010375 | Bacteria | 8092 |
| 245 | Ga0105239_10059396 | 3300010375 | Bacteria | 4197 |
| 246 | Ga0105246_10091377 | 3300011119 | Bacteria | 2194 |
| 247 | Ga0105246_10619932 | 3300011119 | Bacteria | 937 |
| 248 | Ga0157326_1007504 | 3300012513 | Bacteria | 1179 |
| 249 | Ga0157373_10000755 | 3300013100 | Bacteria | 25102 |
| 250 | Ga0157373_10005045 | 3300013100 | Bacteria | 9916 |
| 251 | Ga0157373_10018416 | 3300013100 | Bacteria | 5084 |
| 252 | Ga0157371_10007161 | 3300013102 | Bacteria | 9061 |
| 253 | Ga0157371_10074673 | 3300013102 | Bacteria | 2401 |
| 254 | Ga0157370_10022272 | 3300013104 | Bacteria | 6305 |
| 255 | Ga0157370_10050451 | 3300013104 | Bacteria | 3977 |
| 256 | Ga0157370_10068790 | 3300013104 | Bacteria | 3346 |
| 257 | Ga0157370_10341411 | 3300013104 | Bacteria | 1380 |
| 258 | Ga0157369_10027542 | 3300013105 | Bacteria | 6298 |
| 259 | Ga0157369_10049289 | 3300013105 | Bacteria | 4567 |
| 260 | Ga0157374_10000367 | 3300013296 | Bacteria | 41665 |
| 261 | Ga0157374_10067000 | 3300013296 | Bacteria | 3374 |
| 262 | Ga0157374_10149417 | 3300013296 | Bacteria | 2271 |
| 263 | Ga0157372_10001139 | 3300013307 | Bacteria | 28905 |
| 264 | Ga0157372_10005206 | 3300013307 | Bacteria | 13824 |
| 265 | Ga0157372_10043686 | 3300013307 | Bacteria | 4963 |
| 266 | Ga0157372_10049928 | 3300013307 | Bacteria | 4654 |
| 267 | Ga0157372_10546428 | 3300013307 | Bacteria | 1350 |
| 268 | Ga0157375_10000991 | 3300013308 | Bacteria | 24533 |
| 269 | Ga0157375_10012239 | 3300013308 | Bacteria | 7607 |
| 270 | Ga0157375_10777640 | 3300013308 | Unclassified | 1107 |
| 271 | Ga0163163_10000659 | 3300014325 | Bacteria | 29554 |
| 272 | Ga0163163_10060644 | 3300014325 | Bacteria | 3747 |
| 273 | Ga0163163_10078882 | 3300014325 | Bacteria | 3290 |
| 274 | Ga0157380_10097288 | 3300014326 | Bacteria | 2442 |
| 275 | Ga0157377_10000052 | 3300014745 | Bacteria | 89846 |
| 276 | Ga0157377_10106124 | 3300014745 | Bacteria | 1682 |
| 277 | Ga0157377_10512206 | 3300014745 | Bacteria | 841 |
| 278 | Ga0157379_10183473 | 3300014968 | Bacteria | 1890 |
| 279 | Ga0157376_10002363 | 3300014969 | Bacteria | 12736 |
| 280 | Ga0157376_10097581 | 3300014969 | Bacteria | 2560 |
| 281 | Ga0182006_1001089 | 3300015261 | Bacteria | 17406 |
| 282 | Ga0163161_10048022 | 3300017792 | Bacteria | 3082 |
| 283 | Ga0206356_10080782 | 3300020070 | Bacteria | 1978 |
| 284 | Ga0213872_10000016 | 3300021361 | Bacteria | 180524 |
| 285 | Ga0213872_10004070 | 3300021361 | Bacteria | 7873 |
| 286 | Ga0213872_10012552 | 3300021361 | Bacteria | 3984 |
| 287 | Ga0213874_10003972 | 3300021377 | Bacteria | 3329 |
| 288 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 289 | Ga0209436_104299 | 3300025208 | Bacteria | 3545 |
| 290 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 291 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 292 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 293 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 294 | Ga0207425_1003360 | 3300025245 | Bacteria | 5157 |
| 295 | Ga0207425_1005687 | 3300025245 | Bacteria | 3517 |
| 296 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 297 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 298 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 299 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 300 | Ga0209129_1013818 | 3300025258 | Bacteria | 1753 |
| 301 | Ga0209129_1016874 | 3300025258 | Bacteria | 1451 |
| 302 | Ga0209129_1035648 | 3300025258 | Bacteria | 808 |
| 303 | Ga0209565_1000161 | 3300025263 | Bacteria | 90019 |
| 304 | Ga0209565_1000884 | 3300025263 | Bacteria | 16415 |
| 305 | Ga0209673_1000391 | 3300025273 | Bacteria | 78867 |
| 306 | Ga0209673_1008723 | 3300025273 | Bacteria | 4481 |
| 307 | Ga0209673_1057290 | 3300025273 | Bacteria | 993 |
| 308 | Ga0209130_1000118 | 3300025284 | Bacteria | 129005 |
| 309 | Ga0209130_1000359 | 3300025284 | Bacteria | 52040 |
| 310 | Ga0209675_1000111 | 3300025291 | Bacteria | 114805 |
| 311 | Ga0209675_1000495 | 3300025291 | Bacteria | 29537 |
| 312 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 313 | Ga0209676_1003774 | 3300025292 | Bacteria | 8977 |
| 314 | Ga0209025_1001351 | 3300025294 | Bacteria | 32990 |
| 315 | Ga0209025_1004481 | 3300025294 | Bacteria | 12099 |
| 316 | Ga0209025_1006065 | 3300025294 | Bacteria | 9557 |
| 317 | Ga0209564_1000610 | 3300025295 | Bacteria | 55376 |
| 318 | Ga0209564_1000815 | 3300025295 | Bacteria | 42475 |
| 319 | Ga0209564_1030948 | 3300025295 | Bacteria | 1647 |
| 320 | Ga0209758_1006167 | 3300025297 | Bacteria | 8777 |
| 321 | Ga0209050_1000066 | 3300025298 | Bacteria | 305458 |
| 322 | Ga0209050_1001609 | 3300025298 | Bacteria | 23243 |
| 323 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 324 | Ga0209256_1044726 | 3300025299 | Bacteria | 1104 |
| 325 | Ga0207426_1000197 | 3300025302 | Bacteria | 146366 |
| 326 | Ga0207426_1001157 | 3300025302 | Bacteria | 23696 |
| 327 | Ga0209051_1000044 | 3300025303 | Bacteria | 305458 |
| 328 | Ga0209257_1000082 | 3300025304 | Bacteria | 305458 |
| 329 | Ga0207653_10003877 | 3300025885 | Bacteria | 4702 |
| 330 | Ga0207682_10001173 | 3300025893 | Bacteria | 12153 |
| 331 | Ga0207642_10019484 | 3300025899 | Bacteria | 2628 |
| 332 | Ga0207680_10002438 | 3300025903 | Bacteria | 8673 |
| 333 | Ga0207680_10118350 | 3300025903 | Bacteria | 1729 |
| 334 | Ga0207685_10035540 | 3300025905 | Bacteria | 1819 |
| 335 | Ga0207699_10113857 | 3300025906 | Bacteria | 1739 |
| 336 | Ga0207645_10000170 | 3300025907 | Bacteria | 51882 |
| 337 | Ga0207645_10001033 | 3300025907 | Bacteria | 22978 |
| 338 | Ga0207645_10061863 | 3300025907 | Bacteria | 2391 |
| 339 | Ga0207643_10000051 | 3300025908 | Bacteria | 77737 |
| 340 | Ga0207643_10005125 | 3300025908 | Bacteria | 7011 |
| 341 | Ga0207643_10040757 | 3300025908 | Bacteria | 2615 |
| 342 | Ga0207705_10176135 | 3300025909 | Bacteria | 1612 |
| 343 | Ga0207684_10032385 | 3300025910 | Bacteria | 4445 |
| 344 | Ga0207684_10554503 | 3300025910 | Bacteria | 983 |
| 345 | Ga0207684_10732066 | 3300025910 | Bacteria | 839 |
| 346 | Ga0207654_10018395 | 3300025911 | Bacteria | 3665 |
| 347 | Ga0207654_10030744 | 3300025911 | Bacteria | 2951 |
| 348 | Ga0207654_10116764 | 3300025911 | Bacteria | 1669 |
| 349 | Ga0207707_10000453 | 3300025912 | Bacteria | 42710 |
| 350 | Ga0207707_10008794 | 3300025912 | Bacteria | 8763 |
| 351 | Ga0207707_10011006 | 3300025912 | Bacteria | 7872 |
| 352 | Ga0207707_10013892 | 3300025912 | Bacteria | 7021 |
| 353 | Ga0207695_10010473 | 3300025913 | Bacteria | 11341 |
| 354 | Ga0207695_10419225 | 3300025913 | Bacteria | 1223 |
| 355 | Ga0207671_10021270 | 3300025914 | Bacteria | 4924 |
| 356 | Ga0207693_10002513 | 3300025915 | Bacteria | 15951 |
| 357 | Ga0207663_10011146 | 3300025916 | Bacteria | 4816 |
| 358 | Ga0207663_10162626 | 3300025916 | Bacteria | 1578 |
| 359 | Ga0207660_10000203 | 3300025917 | Bacteria | 38120 |
| 360 | Ga0207660_10007462 | 3300025917 | Bacteria | 7074 |
| 361 | Ga0207662_10056780 | 3300025918 | Bacteria | 2339 |
| 362 | Ga0207657_10000148 | 3300025919 | Bacteria | 71376 |
| 363 | Ga0207657_10000357 | 3300025919 | Bacteria | 48334 |
| 364 | Ga0207657_10079515 | 3300025919 | Bacteria | 2758 |
| 365 | Ga0207657_10116297 | 3300025919 | Bacteria | 2204 |
| 366 | Ga0207649_10000678 | 3300025920 | Bacteria | 22629 |
| 367 | Ga0207649_10012182 | 3300025920 | Bacteria | 4762 |
| 368 | Ga0207649_10013098 | 3300025920 | Bacteria | 4624 |
| 369 | Ga0207649_10066613 | 3300025920 | Bacteria | 2284 |
| 370 | Ga0207649_10178766 | 3300025920 | Bacteria | 1484 |
| 371 | Ga0207652_10000690 | 3300025921 | Bacteria | 32930 |
| 372 | Ga0207652_10007190 | 3300025921 | Bacteria | 8983 |
| 373 | Ga0207646_10605610 | 3300025922 | Bacteria | 983 |
| 374 | Ga0207681_10546600 | 3300025923 | Bacteria | 953 |
| 375 | Ga0207694_10019608 | 3300025924 | Bacteria | 5114 |
| 376 | Ga0207694_10068899 | 3300025924 | Bacteria | 2764 |
| 377 | Ga0207650_10064440 | 3300025925 | Bacteria | 2743 |
| 378 | Ga0207650_10072818 | 3300025925 | Bacteria | 2586 |
| 379 | Ga0207650_10168846 | 3300025925 | Bacteria | 1738 |
| 380 | Ga0207659_10060367 | 3300025926 | Bacteria | 2729 |
| 381 | Ga0207659_10259955 | 3300025926 | Bacteria | 1412 |
| 382 | Ga0207687_10004230 | 3300025927 | Bacteria | 9595 |
| 383 | Ga0207687_10300479 | 3300025927 | Bacteria | 1293 |
| 384 | Ga0207690_10006825 | 3300025932 | Bacteria | 6769 |
| 385 | Ga0207690_10076874 | 3300025932 | Bacteria | 2319 |
| 386 | Ga0207690_10116822 | 3300025932 | Bacteria | 1930 |
| 387 | Ga0207706_10022334 | 3300025933 | Bacteria | 5678 |
| 388 | Ga0207686_10004948 | 3300025934 | Bacteria | 7171 |
| 389 | Ga0207709_10073370 | 3300025935 | Bacteria | 2180 |
| 390 | Ga0207669_10032621 | 3300025937 | Bacteria | 2927 |
| 391 | Ga0207669_10170721 | 3300025937 | Bacteria | 1547 |
| 392 | Ga0207669_10320671 | 3300025937 | Bacteria | 1186 |
| 393 | Ga0207704_10102105 | 3300025938 | Bacteria | 1915 |
| 394 | Ga0207665_10098428 | 3300025939 | Bacteria | 2038 |
| 395 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 396 | Ga0207691_10015193 | 3300025940 | Bacteria | 7325 |
| 397 | Ga0207691_10123425 | 3300025940 | Bacteria | 2292 |
| 398 | Ga0207691_10185420 | 3300025940 | Bacteria | 1817 |
| 399 | Ga0207711_10402296 | 3300025941 | Bacteria | 1272 |
| 400 | Ga0207689_10000296 | 3300025942 | Bacteria | 45380 |
| 401 | Ga0207689_10305819 | 3300025942 | Bacteria | 1318 |
| 402 | Ga0207661_10029191 | 3300025944 | Bacteria | 4233 |
| 403 | Ga0207661_10067004 | 3300025944 | Bacteria | 2918 |
| 404 | Ga0207661_10315535 | 3300025944 | Bacteria | 1404 |
| 405 | Ga0207679_10000233 | 3300025945 | Bacteria | 42806 |
| 406 | Ga0207679_10005432 | 3300025945 | Bacteria | 7982 |
| 407 | Ga0207667_10001806 | 3300025949 | Bacteria | 26953 |
| 408 | Ga0207667_10002455 | 3300025949 | Bacteria | 23178 |
| 409 | Ga0207667_10040920 | 3300025949 | Bacteria | 4932 |
| 410 | Ga0207667_10043513 | 3300025949 | Bacteria | 4765 |
| 411 | Ga0207667_10163275 | 3300025949 | Bacteria | 2290 |
| 412 | Ga0207667_10165462 | 3300025949 | Bacteria | 2274 |
| 413 | Ga0207651_10026513 | 3300025960 | Bacteria | 3622 |
| 414 | Ga0207651_10306489 | 3300025960 | Bacteria | 1322 |
| 415 | Ga0207668_10013784 | 3300025972 | Bacteria | 4988 |
| 416 | Ga0207640_10008493 | 3300025981 | Bacteria | 5706 |
| 417 | Ga0207640_10017603 | 3300025981 | Bacteria | 4184 |
| 418 | Ga0207658_10020008 | 3300025986 | Bacteria | 4632 |
| 419 | Ga0207658_10352861 | 3300025986 | Bacteria | 1281 |
| 420 | Ga0207703_10026631 | 3300026035 | Bacteria | 4553 |
| 421 | Ga0207703_10064105 | 3300026035 | Bacteria | 3015 |
| 422 | Ga0207703_10639942 | 3300026035 | Bacteria | 1008 |
| 423 | Ga0207639_10001326 | 3300026041 | Bacteria | 16740 |
| 424 | Ga0207639_10005406 | 3300026041 | Bacteria | 8640 |
| 425 | Ga0207639_10337620 | 3300026041 | Bacteria | 1342 |
| 426 | Ga0207678_10000214 | 3300026067 | Bacteria | 51419 |
| 427 | Ga0207678_10003431 | 3300026067 | Bacteria | 14281 |
| 428 | Ga0207678_10054639 | 3300026067 | Bacteria | 3440 |
| 429 | Ga0207678_10103322 | 3300026067 | Bacteria | 2432 |
| 430 | Ga0207678_10171130 | 3300026067 | Bacteria | 1854 |
| 431 | Ga0207708_10339658 | 3300026075 | Bacteria | 1230 |
| 432 | Ga0207702_10001254 | 3300026078 | Bacteria | 25608 |
| 433 | Ga0207702_10018586 | 3300026078 | Bacteria | 5750 |
| 434 | Ga0207702_10064868 | 3300026078 | Bacteria | 3126 |
| 435 | Ga0207702_10643810 | 3300026078 | Bacteria | 1042 |
| 436 | Ga0207702_10704946 | 3300026078 | Bacteria | 995 |
| 437 | Ga0207641_10029865 | 3300026088 | Bacteria | 4509 |
| 438 | Ga0207641_10164161 | 3300026088 | Bacteria | 2021 |
| 439 | Ga0207641_10537997 | 3300026088 | Bacteria | 1138 |
| 440 | Ga0207641_10745058 | 3300026088 | Bacteria | 967 |
| 441 | Ga0207648_10001074 | 3300026089 | Bacteria | 30606 |
| 442 | Ga0207648_10004394 | 3300026089 | Bacteria | 14487 |
| 443 | Ga0207648_10016091 | 3300026089 | Bacteria | 6851 |
| 444 | Ga0207648_10022282 | 3300026089 | Bacteria | 5691 |
| 445 | Ga0207648_10171082 | 3300026089 | Bacteria | 1920 |
| 446 | Ga0207648_10219500 | 3300026089 | Bacteria | 1689 |
| 447 | Ga0207676_10002144 | 3300026095 | Bacteria | 14263 |
| 448 | Ga0207676_10002162 | 3300026095 | Bacteria | 14186 |
| 449 | Ga0207676_10123826 | 3300026095 | Bacteria | 2185 |
| 450 | Ga0207676_10255471 | 3300026095 | Bacteria | 1579 |
| 451 | Ga0207676_10735282 | 3300026095 | Unclassified | 958 |
| 452 | Ga0207674_10000312 | 3300026116 | Bacteria | 61824 |
| 453 | Ga0207674_10000836 | 3300026116 | Bacteria | 40167 |
| 454 | Ga0207674_10050212 | 3300026116 | Bacteria | 4262 |
| 455 | Ga0207674_10271124 | 3300026116 | Bacteria | 1645 |
| 456 | Ga0207675_100179851 | 3300026118 | Bacteria | 2025 |
| 457 | Ga0207675_100196626 | 3300026118 | Bacteria | 1935 |
| 458 | Ga0207683_10000853 | 3300026121 | Bacteria | 27981 |
| 459 | Ga0207683_10019137 | 3300026121 | Bacteria | 5844 |
| 460 | Ga0207698_10000387 | 3300026142 | Bacteria | 25394 |
| 461 | Ga0207698_10003568 | 3300026142 | Bacteria | 9386 |
| 462 | Ga0207698_10051282 | 3300026142 | Bacteria | 3154 |
| 463 | Ga0207698_10229165 | 3300026142 | Bacteria | 1685 |
| 464 | Ga0209281_1000993 | 3300027111 | Bacteria | 22417 |
| 465 | Ga0209996_1003277 | 3300027395 | Bacteria | 2028 |
| 466 | Ga0209995_1005220 | 3300027471 | Bacteria | 2087 |
| 467 | Ga0209968_1004026 | 3300027526 | Bacteria | 2206 |
| 468 | Ga0209999_1014337 | 3300027543 | Bacteria | 1440 |
| 469 | Ga0209970_1002103 | 3300027614 | Bacteria | 3415 |
| 470 | Ga0209983_1005427 | 3300027665 | Bacteria | 2641 |
| 471 | Ga0209588_1005062 | 3300027671 | Bacteria | 3755 |
| 472 | Ga0209971_1047136 | 3300027682 | Bacteria | 1040 |
| 473 | Ga0209966_1000006 | 3300027695 | Bacteria | 102095 |
| 474 | Ga0209998_10004415 | 3300027717 | Bacteria | 2990 |
| 475 | Ga0209974_10007390 | 3300027876 | Bacteria | 3786 |
| 476 | Ga0207428_10083126 | 3300027907 | Bacteria | 2498 |
| 477 | Ga0207428_10359126 | 3300027907 | Bacteria | 1071 |
| 478 | Ga0268266_10006477 | 3300028379 | Bacteria | 10715 |
| 479 | Ga0268266_10008840 | 3300028379 | Bacteria | 8919 |
| 480 | Ga0268266_10442110 | 3300028379 | Bacteria | 1235 |
| 481 | Ga0268265_10007291 | 3300028380 | Bacteria | 7469 |
| 482 | Ga0268265_10198550 | 3300028380 | Bacteria | 1738 |
| 483 | Ga0268265_10289484 | 3300028380 | Bacteria | 1470 |
| 484 | Ga0268264_10003910 | 3300028381 | Bacteria | 12758 |
| 485 | Ga0268264_10011656 | 3300028381 | Bacteria | 7250 |
| 486 | Ga0268264_10194216 | 3300028381 | Bacteria | 1852 |
| 487 | Ga0265337_1016980 | 3300028556 | Bacteria | 2342 |
| 488 | Ga0265326_10009471 | 3300028558 | Bacteria | 2913 |
| 489 | Ga0265323_10005281 | 3300028653 | Bacteria | 5490 |
| 490 | Ga0265336_10031580 | 3300028666 | Bacteria | 1645 |
| 491 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 492 | Ga0307515_10002860 | 3300028794 | Bacteria | 36720 |
| 493 | Ga0307515_10004730 | 3300028794 | Bacteria | 27885 |
| 494 | Ga0307515_10114546 | 3300028794 | Bacteria | 3115 |
| 495 | Ga0265338_10036401 | 3300028800 | Bacteria | 4711 |
| 496 | Ga0265330_10001807 | 3300031235 | Bacteria | 12007 |
| 497 | Ga0265330_10053113 | 3300031235 | Bacteria | 1774 |
| 498 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 499 | Ga0265332_10006958 | 3300031238 | Bacteria | 5124 |
| 500 | Ga0265340_10010296 | 3300031247 | Bacteria | 5003 |
| 501 | Ga0307513_10000017 | 3300031456 | Bacteria | 282386 |
| 502 | Ga0307513_10000021 | 3300031456 | Bacteria | 228078 |
| 503 | Ga0307513_10012920 | 3300031456 | Bacteria | 10270 |
| 504 | Ga0307513_10020368 | 3300031456 | Bacteria | 7869 |
| 505 | Ga0307513_10094414 | 3300031456 | Bacteria | 3036 |
| 506 | Ga0307513_10358370 | 3300031456 | Bacteria | 1204 |
| 507 | Ga0307509_10001516 | 3300031507 | Bacteria | 39162 |
| 508 | Ga0307509_10233057 | 3300031507 | Bacteria | 1642 |
| 509 | Ga0307508_10006236 | 3300031616 | Bacteria | 11235 |
| 510 | Ga0307514_10000225 | 3300031649 | Bacteria | 151002 |
| 511 | Ga0265314_10000008 | 3300031711 | Bacteria | 485166 |
| 512 | Ga0265314_10003341 | 3300031711 | Bacteria | 15622 |
| 513 | Ga0265342_10004246 | 3300031712 | Bacteria | 11353 |
| 514 | Ga0307516_10000386 | 3300031730 | Bacteria | 57562 |
| 515 | Ga0307516_10158118 | 3300031730 | Bacteria | 2019 |
| 516 | Ga0307413_10175796 | 3300031824 | Bacteria | 1521 |
| 517 | Ga0307410_10489998 | 3300031852 | Bacteria | 1010 |
| 518 | Ga0307406_10027094 | 3300031901 | Bacteria | 3449 |
| 519 | Ga0307411_10266996 | 3300032005 | Bacteria | 1355 |
| 520 | Ga0307507_10124333 | 3300033179 | Bacteria | 2049 |
| 521 | Ga0307510_10001034 | 3300033180 | Bacteria | 29497 |
| 522 | Ga0373936_0030132 | 3300035113 | Bacteria | 2140 |
| 523 | Ga0373939_0026096 | 3300035114 | Bacteria | 1644 |
| 524 | Ga0373941_0033512 | 3300035115 | Bacteria | 1544 |
| 525 | Ga0373945_0020619 | 3300035116 | Bacteria | 2258 |
| 526 | Ga0373954_0001721 | 3300035118 | Bacteria | 8959 |
| 527 | Ga0373960_0039518 | 3300035121 | Bacteria | 1357 |
| 528 | Ga0373943_0016261 | 3300035170 | Bacteria | 3390 |
| 529 | Ga0373946_0008118 | 3300035171 | Bacteria | 3855 |
| 530 | Ga0373946_0257646 | 3300035171 | Bacteria | 853 |
| 531 | Ga0373961_0039552 | 3300035241 | Bacteria | 1355 |
| 532 | Ga0316574_0097230 | 3300035398 | Bacteria | 1882 |
| 533 | Ga0373931_0336288 | 3300035691 | Bacteria | 942 |
| 534 | Ga0373931_0509948 | 3300035691 | Bacteria | 777 |
| 535 | Ga0373935_0229368 | 3300035692 | Bacteria | 1292 |
| 536 | Ga0373933_0095271 | 3300035724 | Bacteria | 1841 |
| 537 | Ga0373937_0008585 | 3300036401 | Bacteria | 8873 |
| 538 | Ga0373937_0057721 | 3300036401 | Bacteria | 3566 |
| 539 | Ga0373937_0120460 | 3300036401 | Bacteria | 2445 |
| 540 | Ga0373925_0000590 | 3300037068 | Bacteria | 34985 |
| 541 | Ga0373925_0084873 | 3300037068 | Bacteria | 2413 |
| 542 | Ga0395899_0090357 | 3300037312 | Bacteria | 2220 |
| 543 | Ga0395899_0107827 | 3300037312 | Bacteria | 2004 |
| 544 | Ga0395900_0144518 | 3300037418 | Bacteria | 2433 |
| 545 | Ga0395900_0166167 | 3300037418 | Bacteria | 2249 |
| 546 | Ga0395900_0284319 | 3300037418 | Bacteria | 1645 |
| 547 | Ga0395905_0006594 | 3300037471 | Bacteria | 11649 |
| 548 | Ga0395905_0077695 | 3300037471 | Bacteria | 3110 |
| 549 | Ga0395905_0164659 | 3300037471 | Bacteria | 2083 |
| 550 | Ga0395905_0277013 | 3300037471 | Bacteria | 1563 |
| 551 | Ga0395901_0156880 | 3300038443 | Bacteria | 2390 |
| 552 | Ga0395901_0328300 | 3300038443 | Bacteria | 1582 |
| 553 | Ga0436365_1078319 | 3300039437 | Bacteria | 2057 |
| 554 | Ga0436361_0181224 | 3300039447 | Bacteria | 8489 |
| 555 | Ga0436361_0376061 | 3300039447 | Bacteria | 200571 |
| 556 | Ga0436361_0902439 | 3300039447 | Bacteria | 94295 |
| 557 | Ga0436363_1718963 | 3300039450 | Bacteria | 12069 |
| 558 | Ga0451789_1034659 | 3300041443 | Bacteria | 1119 |
| 559 | Ga0451800_1561068 | 3300041459 | Bacteria | 1848 |
| 560 | Ga0451807_1197568 | 3300041486 | Bacteria | 882 |
| 561 | Ga0439455_0100503 | 3300042012 | Bacteria | 799 |
| 562 | Ga0439459_0000390 | 3300042438 | Bacteria | 5486 |
| 563 | Ga0450918_000032 | 3300042531 | Bacteria | 28506 |
| 564 | Ga0451577_0007371 | 3300042876 | Bacteria | 10799 |
| 565 | Ga0451577_0021405 | 3300042876 | Bacteria | 5918 |
| 566 | Ga0451577_0074187 | 3300042876 | Bacteria | 3035 |
| 567 | Ga0451577_0165977 | 3300042876 | Bacteria | 1989 |
| 568 | Ga0451577_0193695 | 3300042876 | Bacteria | 1834 |
| 569 | Ga0451577_0263812 | 3300042876 | Bacteria | 1560 |
| 570 | Ga0453683_0141637 | 3300044673 | Bacteria | 1518 |
| 571 | Ga0466963_0101280 | 3300044694 | Bacteria | 1972 |
| 572 | Ga0466963_0199946 | 3300044694 | Bacteria | 1398 |
| 573 | Ga0453684_0039271 | 3300044712 | Bacteria | 6453 |
| 574 | Ga0453684_0082776 | 3300044712 | Bacteria | 3996 |
| 575 | Ga0453684_0358473 | 3300044712 | Bacteria | 1642 |
| 576 | Ga0466960_0045148 | 3300044901 | Bacteria | 2103 |
| 577 | Ga0466960_0083844 | 3300044901 | Bacteria | 1612 |
| 578 | Ga0466959_0019220 | 3300045049 | Bacteria | 5023 |
| 579 | Ga0451576_0017398 | 3300045051 | Bacteria | 7904 |
| 580 | Ga0451576_0028309 | 3300045051 | Bacteria | 6004 |
| 581 | Ga0451576_0038659 | 3300045051 | Bacteria | 5050 |
| 582 | Ga0451576_0526943 | 3300045051 | Bacteria | 1241 |
| 583 | Ga0495629_0020987 | 3300046459 | Bacteria | 4662 |
| 584 | Ga0495629_0259162 | 3300046459 | Bacteria | 1195 |
| 585 | Ga0495651_0122525 | 3300046462 | Bacteria | 1908 |
| 586 | Ga0495653_0028328 | 3300046463 | Bacteria | 4479 |
| 587 | Ga0495653_0166984 | 3300046463 | Bacteria | 1522 |
| 588 | Ga0495580_0037203 | 3300046472 | Bacteria | 3494 |
| 589 | Ga0495580_0042110 | 3300046472 | Bacteria | 3255 |
| 590 | Ga0495580_0155371 | 3300046472 | Bacteria | 1584 |
| 591 | Ga0495639_0011279 | 3300046475 | Bacteria | 3850 |
| 592 | Ga0495639_0135150 | 3300046475 | Bacteria | 1183 |
| 593 | Ga0495664_0298182 | 3300046477 | Bacteria | 973 |
| 594 | Ga0495585_0000221 | 3300046492 | Bacteria | 59316 |
| 595 | Ga0495594_0008790 | 3300046499 | Bacteria | 5208 |
| 596 | Ga0495596_0002792 | 3300046500 | Bacteria | 9151 |
| 597 | Ga0495583_0000423 | 3300046506 | Bacteria | 63964 |
| 598 | Ga0495583_0012616 | 3300046506 | Bacteria | 4769 |
| 599 | Ga0495583_0096010 | 3300046506 | Bacteria | 1270 |
| 600 | Ga0495606_0043881 | 3300046507 | Bacteria | 2977 |
| 601 | Ga0495608_0020687 | 3300046511 | Bacteria | 4521 |
| 602 | Ga0495628_0142105 | 3300046516 | Bacteria | 1832 |
| 603 | Ga0495631_0001877 | 3300046518 | Bacteria | 12390 |
| 604 | Ga0495643_0005705 | 3300046522 | Bacteria | 8335 |
| 605 | Ga0495643_0010037 | 3300046522 | Bacteria | 5843 |
| 606 | Ga0495644_0000126 | 3300046523 | Bacteria | 36677 |
| 607 | Ga0495663_0007041 | 3300046525 | Bacteria | 3105 |
| 608 | Ga0495642_0009846 | 3300046528 | Bacteria | 3661 |
| 609 | Ga0495665_0026312 | 3300046531 | Bacteria | 3124 |
| 610 | Ga0495640_0227531 | 3300046533 | Bacteria | 1174 |
| 611 | Ga0495586_0036380 | 3300046535 | Bacteria | 2643 |
| 612 | Ga0495609_0012392 | 3300046538 | Bacteria | 4044 |
| 613 | Ga0495621_0022745 | 3300046539 | Bacteria | 2081 |
| 614 | Ga0495621_0033099 | 3300046539 | Bacteria | 1780 |
| 615 | Ga0495597_0019148 | 3300046542 | Bacteria | 3206 |
| 616 | Ga0495622_0133718 | 3300046557 | Bacteria | 1128 |
| 617 | Ga0495667_0045705 | 3300046559 | Bacteria | 2898 |
| 618 | Ga0495656_0146225 | 3300046615 | Bacteria | 1138 |
| 619 | Ga0495625_0198158 | 3300046660 | Bacteria | 1327 |
| 620 | Ga0495635_0021814 | 3300046663 | Bacteria | 4463 |
| 621 | Ga0495635_0283366 | 3300046663 | Bacteria | 1113 |
| 622 | Ga0495661_0056627 | 3300046665 | Bacteria | 2344 |
| 623 | Ga0495657_0207846 | 3300046675 | Bacteria | 1191 |
| 624 | Ga0495647_0007674 | 3300046681 | Bacteria | 3623 |
| 625 | Ga0495658_0013030 | 3300046683 | Bacteria | 4226 |
| 626 | Ga0495613_0030943 | 3300046689 | Bacteria | 3975 |
| 627 | Ga0495670_0199514 | 3300046691 | Bacteria | 1059 |
| 628 | Ga0495589_0065104 | 3300046794 | Bacteria | 1787 |
| 629 | Ga0495600_0133460 | 3300046809 | Bacteria | 1613 |
| 630 | Ga0495581_0002485 | 3300047315 | Bacteria | 10441 |
| 631 | Ga0495604_0173342 | 3300047317 | Bacteria | 1515 |
| 632 | Ga0495636_0009263 | 3300047318 | Bacteria | 3876 |
| 633 | Ga0495636_0059269 | 3300047318 | Bacteria | 1615 |
| 634 | Ga0495676_0048251 | 3300047321 | Bacteria | 3435 |
| 635 | Ga0495680_0026364 | 3300047322 | Bacteria | 4792 |
| 636 | Ga0495687_012369 | 3300047443 | Bacteria | 4517 |
| 637 | Ga0495677_0157428 | 3300047445 | Bacteria | 876 |
| 638 | Ga0495685_001412 | 3300047447 | Bacteria | 7340 |
| 639 | Ga0495673_0044987 | 3300047469 | Bacteria | 1965 |
| 640 | Ga0495684_0043266 | 3300047471 | Bacteria | 3448 |
| 641 | Ga0495684_0081087 | 3300047471 | Bacteria | 2462 |
| 642 | Ga0495686_0000159 | 3300047472 | Bacteria | 129374 |
| 643 | Ga0495602_0011216 | 3300048088 | Bacteria | 9267 |
| 644 | Ga0496102_0061118 | 3300048905 | Bacteria | 3447 |
| 645 | Ga0496102_0165727 | 3300048905 | Bacteria | 2079 |
| 646 | Ga0496102_0194392 | 3300048905 | Bacteria | 1912 |
| 647 | Ga0496104_0388826 | 3300048907 | Bacteria | 1307 |
| 648 | Ga0496104_0529421 | 3300048907 | Bacteria | 1089 |
| 649 | Ga0496106_0018631 | 3300048909 | Bacteria | 5138 |
| 650 | Ga0496107_0463492 | 3300048910 | Bacteria | 941 |
| 651 | Ga0496109_0070025 | 3300048912 | Bacteria | 3218 |
| 652 | Ga0496110_0075929 | 3300048913 | Bacteria | 2987 |
| 653 | Ga0496112_0110109 | 3300048915 | Bacteria | 2724 |
| 654 | Ga0496114_0048179 | 3300048917 | Bacteria | 3545 |
| 655 | Ga0496115_0124484 | 3300048918 | Bacteria | 2123 |
| 656 | Ga0501308_003257 | 3300049128 | Bacteria | 1494 |
| 657 | Ga0501307_024941 | 3300049162 | Bacteria | 800 |
| 658 | Ga0495682_0001373 | 3300049460 | Bacteria | 13326 |
| 659 | Ga0501319_010878 | 3300049535 | Bacteria | 729 |
| 660 | Ga0501320_011576 | 3300049536 | Bacteria | 916 |
| 661 | Ga0501325_003764 | 3300049541 | Bacteria | 1125 |
| 662 | Ga0501032_0186741 | 3300049569 | Bacteria | 1356 |
| 663 | Ga0501034_0000188 | 3300049571 | Bacteria | 115935 |
| 664 | Ga0501034_0101726 | 3300049571 | Bacteria | 2867 |
| 665 | Ga0501034_0178519 | 3300049571 | Bacteria | 2089 |
| 666 | Ga0501036_0038713 | 3300049572 | Bacteria | 4036 |
| 667 | Ga0501037_0110141 | 3300049573 | Bacteria | 1984 |
| 668 | Ga0501040_0002233 | 3300049576 | Bacteria | 12477 |
| 669 | Ga0501046_0214432 | 3300049580 | Bacteria | 1428 |
| 670 | Ga0501047_0129578 | 3300049581 | Bacteria | 2403 |
| 671 | Ga0501047_0185572 | 3300049581 | Bacteria | 1945 |
| 672 | Ga0501048_0039419 | 3300049582 | Bacteria | 3389 |
| 673 | Ga0501048_0093669 | 3300049582 | Bacteria | 2119 |
| 674 | Ga0501069_0343462 | 3300049585 | Bacteria | 879 |
| 675 | Ga0501071_0043530 | 3300049587 | Bacteria | 3219 |
| 676 | Ga0501072_0006430 | 3300049588 | Bacteria | 8953 |
| 677 | Ga0501072_0128287 | 3300049588 | Bacteria | 2021 |
| 678 | Ga0501073_0407773 | 3300049589 | Bacteria | 939 |
| 679 | Ga0501074_0044204 | 3300049590 | Bacteria | 3225 |
| 680 | Ga0501075_0000739 | 3300049591 | Bacteria | 20297 |
| 681 | Ga0501075_0009894 | 3300049591 | Bacteria | 6683 |
| 682 | Ga0501075_0403638 | 3300049591 | Bacteria | 1042 |
| 683 | Ga0501076_0001064 | 3300049592 | Bacteria | 18031 |
| 684 | Ga0501198_000058 | 3300049649 | Bacteria | 31939 |
| 685 | Ga0501222_000066 | 3300049662 | Bacteria | 32105 |
| 686 | Ga0501249_010174 | 3300049679 | Bacteria | 1964 |
| 687 | Ga0501079_0040293 | 3300049741 | Bacteria | 3602 |
| 688 | Ga0501080_0002824 | 3300049742 | Bacteria | 15268 |
| 689 | Ga0501081_0001893 | 3300049743 | Bacteria | 12994 |
| 690 | Ga0501081_0310317 | 3300049743 | Bacteria | 1158 |
| 691 | Ga0501266_000629 | 3300049763 | Bacteria | 4593 |
| 692 | Ga0501045_0016289 | 3300049824 | Bacteria | 5278 |
| 693 | Ga0501045_0021163 | 3300049824 | Bacteria | 4650 |
| 694 | nmdc:mga03683_145738_c1 | 3300050489 | Bacteria | 1066 |
| 695 | nmdc:mga03683_52218_c1 | 3300050489 | Bacteria | 1708 |
| 696 | nmdc:mga03683_58200_c1 | 3300050489 | Bacteria | 1628 |
| 697 | nmdc:mga00v17_13946_c1 | 3300050491 | Bacteria | 4473 |
| 698 | nmdc:mga0yw44_103235_c1 | 3300050492 | Bacteria | 1818 |
| 699 | nmdc:mga0yw44_22523_c1 | 3300050492 | Bacteria | 3535 |
| 700 | nmdc:mga0yw44_288738_c1 | 3300050492 | Bacteria | 1097 |
| 701 | nmdc:mga0k408_18775_c1 | 3300050493 | Bacteria | 3861 |
| 702 | nmdc:mga0k408_25881_c1 | 3300050493 | Bacteria | 3325 |
| 703 | nmdc:mga0k408_29098_c1 | 3300050493 | Bacteria | 3143 |
| 704 | nmdc:mga0k408_30193_c1 | 3300050493 | Bacteria | 3089 |
| 705 | nmdc:mga06z11_175211_c1 | 3300050494 | Bacteria | 1234 |
| 706 | nmdc:mga07m45_1123_c1 | 3300050496 | Bacteria | 12008 |
| 707 | nmdc:mga07m45_153534_c1 | 3300050496 | Bacteria | 1335 |
| 708 | nmdc:mga07m45_173563_c1 | 3300050496 | Bacteria | 1253 |
| 709 | nmdc:mga07m45_570_c1 | 3300050496 | Bacteria | 15667 |
| 710 | nmdc:mga05p37_148368_c1 | 3300050507 | Bacteria | 2870 |
| 711 | nmdc:mga05p37_293961_c1 | 3300050507 | Bacteria | 1933 |
| 712 | nmdc:mga09592_320479_c1 | 3300050508 | Bacteria | 1343 |
| 713 | nmdc:mga06r32_111993_c1 | 3300050510 | Bacteria | 2686 |
| 714 | nmdc:mga08y16_103046_c1 | 3300050511 | Bacteria | 2971 |
| 715 | nmdc:mga08y16_234476_c1 | 3300050511 | Bacteria | 1898 |
| 716 | nmdc:mga08y16_505392_c1 | 3300050511 | Bacteria | 1227 |
| 717 | nmdc:mga0n895_793723_c1 | 3300050512 | Bacteria | 938 |
| 718 | nmdc:mga0a205_20483_c1 | 3300050515 | Bacteria | 6241 |
| 719 | Ga0495595_0072978 | 3300053084 | Bacteria | 1625 |
| 720 | Ga0495595_0196376 | 3300053084 | Bacteria | 1004 |
| 721 | Ga0495619_0005573 | 3300053085 | Bacteria | 7984 |
| 722 | Ga0500644_0001943 | 3300053088 | Bacteria | 5277 |
| 723 | Ga0500651_0012255 | 3300053093 | Bacteria | 5198 |
| 724 | Ga0500641_0071149 | 3300053096 | Bacteria | 1464 |
| 725 | Ga0500572_026875 | 3300053111 | Bacteria | 1572 |
| 726 | Ga0500593_000343 | 3300053117 | Bacteria | 18732 |
| 727 | Ga0500595_000293 | 3300053119 | Bacteria | 32908 |
| 728 | Ga0500607_073737 | 3300053121 | Bacteria | 1756 |
| 729 | Ga0500608_079507 | 3300053122 | Bacteria | 1549 |
| 730 | Ga0500614_001975 | 3300053123 | Bacteria | 4702 |
| 731 | Ga0500559_0001438 | 3300053136 | Bacteria | 13507 |
| 732 | Ga0500559_0005250 | 3300053136 | Bacteria | 5972 |
| 733 | Ga0500619_012431 | 3300053154 | Bacteria | 2225 |
| 734 | Ga0500645_000214 | 3300053730 | Bacteria | 44143 |
| 735 | Ga0501084_0081031 | 3300054114 | Bacteria | 2722 |
| 736 | Ga0590071_010055 | 3300059421 | Bacteria | 2215 |
| 737 | Ga0501082_0002239 | 3300060353 | Bacteria | 16916 |
| 738 | Ga0530510_0000539 | 3300061734 | Bacteria | 24276 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0214432 | Ga0501046_0214432_400_1050 | 214 |
| 2 | 3300044712 | Ga0453684_0039271 | Ga0453684_0039271_299_1021 | 222 |
| 3 | 3300021361 | Ga0213872_10004070 | Ga0213872_100040704 | 223 |
| 4 | 3300039447 | Ga0436361_0902439 | Ga0436361_0902439_86921_87625 | 223 |
| 5 | iso_pu_bacteria | 8018150411 | 8018154877 | 226 |
| 6 | 3300005288 | Ga0065714_10076714 | Ga0065714_100767142 | 228 |
| 7 | 3300005293 | Ga0065715_10000585 | Ga0065715_100005857 | 228 |
| 8 | 3300005365 | Ga0070688_100043076 | Ga0070688_1000430763 | 228 |
| 9 | 3300005617 | Ga0068859_100032413 | Ga0068859_1000324135 | 228 |
| 10 | 3300005618 | Ga0068864_100196521 | Ga0068864_1001965213 | 228 |
| 11 | 3300006931 | Ga0097620_100032411 | Ga0097620_1000324113 | 228 |
| 12 | 3300014326 | Ga0157380_10097288 | Ga0157380_100972883 | 228 |
| 13 | 3300014745 | Ga0157377_10512206 | Ga0157377_105122062 | 228 |
| 14 | 3300046506 | Ga0495583_0012616 | Ga0495583_0012616_2609_3310 | 228 |
| 15 | 3300046691 | Ga0495670_0199514 | Ga0495670_0199514_76_777 | 228 |
| 16 | 3300047318 | Ga0495636_0009263 | Ga0495636_0009263_1609_2310 | 228 |
| 17 | 3300048905 | Ga0496102_0061118 | Ga0496102_0061118_50_751 | 228 |
| 18 | 3300049569 | Ga0501032_0186741 | Ga0501032_0186741_600_1292 | 228 |
| 19 | 3300049571 | Ga0501034_0101726 | Ga0501034_0101726_465_1157 | 228 |
| 20 | 3300049581 | Ga0501047_0129578 | Ga0501047_0129578_1209_1901 | 228 |
| 21 | 3300049582 | Ga0501048_0093669 | Ga0501048_0093669_1066_1758 | 228 |
| 22 | 3300049585 | Ga0501069_0343462 | Ga0501069_0343462_72_764 | 228 |
| 23 | iso_pu_bacteria | 2588253510 | 2588294976 | 228 |
| 24 | iso_pu_bacteria | 2643221558 | 2643813986 | 228 |
| 25 | iso_pu_bacteria | 2904584206 | 2904585370 | 228 |
| 26 | iso_pu_bacteria | 2904589729 | 2904593719 | 228 |
| 27 | iso_pu_bacteria | 2904601388 | 2904604135 | 228 |
| 28 | iso_pu_bacteria | 2919079590 | 2919081637 | 228 |
| 29 | iso_pu_bacteria | 8005658619 | 8005661959 | 228 |
| 30 | iso_pu_bacteria | 2511231002 | 2511246216 | 229 |
| 31 | iso_pu_bacteria | 2547132374 | 2548497304 | 229 |
| 32 | iso_pu_bacteria | 2643221570 | 2643865689 | 229 |
| 33 | iso_pu_bacteria | 2643221596 | 2643992983 | 229 |
| 34 | iso_pu_bacteria | 2643221644 | 2644246065 | 229 |
| 35 | iso_pu_bacteria | 2643221652 | 2644294433 | 229 |
| 36 | iso_pu_bacteria | 2643221660 | 2644338978 | 229 |
| 37 | iso_pu_bacteria | 2643221717 | 2644647631 | 229 |
| 38 | iso_pu_bacteria | 2842718218 | 2842719179 | 229 |
| 39 | iso_pu_bacteria | 2894023352 | 2894025685 | 229 |
| 40 | iso_pu_bacteria | 2919704043 | 2919704447 | 229 |
| 41 | iso_pu_bacteria | 2974320154 | 2974323678 | 229 |
| 42 | iso_pu_bacteria | 2990710928 | 2990712594 | 229 |
| 43 | 3300005343 | Ga0070687_100112234 | Ga0070687_1001122341 | 230 |
| 44 | 3300005353 | Ga0070669_100148852 | Ga0070669_1001488523 | 230 |
| 45 | 3300005618 | Ga0068864_100859563 | Ga0068864_1008595632 | 230 |
| 46 | 3300006844 | Ga0075428_100369594 | Ga0075428_1003695942 | 230 |
| 47 | 3300009174 | Ga0105241_10234661 | Ga0105241_102346612 | 230 |
| 48 | 3300009553 | Ga0105249_11208747 | Ga0105249_112087471 | 230 |
| 49 | 3300013308 | Ga0157375_10777640 | Ga0157375_107776402 | 230 |
| 50 | 3300025918 | Ga0207662_10056780 | Ga0207662_100567803 | 230 |
| 51 | 3300025923 | Ga0207681_10546600 | Ga0207681_105466001 | 230 |
| 52 | 3300026035 | Ga0207703_10064105 | Ga0207703_100641052 | 230 |
| 53 | 3300026095 | Ga0207676_10735282 | Ga0207676_107352822 | 230 |
| 54 | 3300028379 | Ga0268266_10442110 | Ga0268266_104421102 | 230 |
| 55 | 3300035114 | Ga0373939_0026096 | Ga0373939_0026096_282_992 | 230 |
| 56 | 3300048905 | Ga0496102_0194392 | Ga0496102_0194392_483_1193 | 230 |
| 57 | 3300048907 | Ga0496104_0388826 | Ga0496104_0388826_18_728 | 230 |
| 58 | 3300003751 | Ga0055538_1000019 | Ga0055538_1000019106 | 231 |
| 59 | 3300003752 | Ga0055539_1000024 | Ga0055539_1000024185 | 231 |
| 60 | 3300003756 | Ga0055533_1000032 | Ga0055533_1000032106 | 231 |
| 61 | 3300003759 | Ga0055525_1000041 | Ga0055525_1000041106 | 231 |
| 62 | 3300003841 | Ga0055541_1000018 | Ga0055541_1000018185 | 231 |
| 63 | 3300005327 | Ga0070658_10485685 | Ga0070658_104856851 | 231 |
| 64 | 3300005329 | Ga0070683_100119856 | Ga0070683_1001198562 | 231 |
| 65 | 3300005330 | Ga0070690_100018254 | Ga0070690_1000182542 | 231 |
| 66 | 3300005331 | Ga0070670_100003183 | Ga0070670_10000318313 | 231 |
| 67 | 3300005333 | Ga0070677_10068946 | Ga0070677_100689461 | 231 |
| 68 | 3300005334 | Ga0068869_100000205 | Ga0068869_10000020525 | 231 |
| 69 | 3300005334 | Ga0068869_100297452 | Ga0068869_1002974522 | 231 |
| 70 | 3300005335 | Ga0070666_10001671 | Ga0070666_100016719 | 231 |
| 71 | 3300005336 | Ga0070680_100004745 | Ga0070680_1000047455 | 231 |
| 72 | 3300005337 | Ga0070682_100000180 | Ga0070682_10000018010 | 231 |
| 73 | 3300005338 | Ga0068868_100213446 | Ga0068868_1002134462 | 231 |
| 74 | 3300005339 | Ga0070660_100000321 | Ga0070660_1000003215 | 231 |
| 75 | 3300005339 | Ga0070660_100732330 | Ga0070660_1007323301 | 231 |
| 76 | 3300005341 | Ga0070691_10075486 | Ga0070691_100754862 | 231 |
| 77 | 3300005344 | Ga0070661_100600764 | Ga0070661_1006007641 | 231 |
| 78 | 3300005345 | Ga0070692_10002301 | Ga0070692_100023012 | 231 |
| 79 | 3300005347 | Ga0070668_100007445 | Ga0070668_1000074453 | 231 |
| 80 | 3300005354 | Ga0070675_100008402 | Ga0070675_1000084024 | 231 |
| 81 | 3300005355 | Ga0070671_100002283 | Ga0070671_10000228315 | 231 |
| 82 | 3300005355 | Ga0070671_100100449 | Ga0070671_1001004491 | 231 |
| 83 | 3300005356 | Ga0070674_100001737 | Ga0070674_10000173712 | 231 |
| 84 | 3300005364 | Ga0070673_100000414 | Ga0070673_10000041417 | 231 |
| 85 | 3300005364 | Ga0070673_100006199 | Ga0070673_1000061993 | 231 |
| 86 | 3300005366 | Ga0070659_100000881 | Ga0070659_1000008818 | 231 |
| 87 | 3300005367 | Ga0070667_100022534 | Ga0070667_1000225343 | 231 |
| 88 | 3300005367 | Ga0070667_100074164 | Ga0070667_1000741643 | 231 |
| 89 | 3300005367 | Ga0070667_100243904 | Ga0070667_1002439041 | 231 |
| 90 | 3300005406 | Ga0070703_10001102 | Ga0070703_100011028 | 231 |
| 91 | 3300005437 | Ga0070710_10026855 | Ga0070710_100268553 | 231 |
| 92 | 3300005439 | Ga0070711_100012774 | Ga0070711_1000127743 | 231 |
| 93 | 3300005440 | Ga0070705_100000078 | Ga0070705_10000007831 | 231 |
| 94 | 3300005444 | Ga0070694_100001715 | Ga0070694_1000017155 | 231 |
| 95 | 3300005455 | Ga0070663_100036402 | Ga0070663_1000364022 | 231 |
| 96 | 3300005455 | Ga0070663_100045392 | Ga0070663_1000453922 | 231 |
| 97 | 3300005455 | Ga0070663_100056080 | Ga0070663_1000560802 | 231 |
| 98 | 3300005456 | Ga0070678_100004553 | Ga0070678_10000455310 | 231 |
| 99 | 3300005456 | Ga0070678_100016630 | Ga0070678_1000166303 | 231 |
| 100 | 3300005457 | Ga0070662_100001051 | Ga0070662_1000010512 | 231 |
| 101 | 3300005457 | Ga0070662_100062976 | Ga0070662_1000629763 | 231 |
| 102 | 3300005458 | Ga0070681_10006915 | Ga0070681_100069154 | 231 |
| 103 | 3300005459 | Ga0068867_100004322 | Ga0068867_1000043223 | 231 |
| 104 | 3300005459 | Ga0068867_100111808 | Ga0068867_1001118082 | 231 |
| 105 | 3300005467 | Ga0070706_100583745 | Ga0070706_1005837452 | 231 |
| 106 | 3300005467 | Ga0070706_100899436 | Ga0070706_1008994361 | 231 |
| 107 | 3300005468 | Ga0070707_100407961 | Ga0070707_1004079612 | 231 |
| 108 | 3300005518 | Ga0070699_100100198 | Ga0070699_1001001983 | 231 |
| 109 | 3300005518 | Ga0070699_100221582 | Ga0070699_1002215822 | 231 |
| 110 | 3300005530 | Ga0070679_100000702 | Ga0070679_10000070213 | 231 |
| 111 | 3300005536 | Ga0070697_100093457 | Ga0070697_1000934572 | 231 |
| 112 | 3300005539 | Ga0068853_100000255 | Ga0068853_1000002559 | 231 |
| 113 | 3300005539 | Ga0068853_100005722 | Ga0068853_10000572212 | 231 |
| 114 | 3300005543 | Ga0070672_100006664 | Ga0070672_1000066649 | 231 |
| 115 | 3300005543 | Ga0070672_100013507 | Ga0070672_1000135076 | 231 |
| 116 | 3300005545 | Ga0070695_100001050 | Ga0070695_1000010505 | 231 |
| 117 | 3300005545 | Ga0070695_100001834 | Ga0070695_1000018342 | 231 |
| 118 | 3300005546 | Ga0070696_100034665 | Ga0070696_1000346653 | 231 |
| 119 | 3300005547 | Ga0070693_100000163 | Ga0070693_10000016315 | 231 |
| 120 | 3300005547 | Ga0070693_100000754 | Ga0070693_10000075411 | 231 |
| 121 | 3300005549 | Ga0070704_100008672 | Ga0070704_1000086721 | 231 |
| 122 | 3300005563 | Ga0068855_100003137 | Ga0068855_1000031378 | 231 |
| 123 | 3300005564 | Ga0070664_100008022 | Ga0070664_1000080224 | 231 |
| 124 | 3300005578 | Ga0068854_100000709 | Ga0068854_10000070914 | 231 |
| 125 | 3300005614 | Ga0068856_100018398 | Ga0068856_1000183985 | 231 |
| 126 | 3300005615 | Ga0070702_100196285 | Ga0070702_1001962852 | 231 |
| 127 | 3300005616 | Ga0068852_100003709 | Ga0068852_1000037097 | 231 |
| 128 | 3300005616 | Ga0068852_100181355 | Ga0068852_1001813552 | 231 |
| 129 | 3300005617 | Ga0068859_100010878 | Ga0068859_1000108782 | 231 |
| 130 | 3300005617 | Ga0068859_100269160 | Ga0068859_1002691602 | 231 |
| 131 | 3300005618 | Ga0068864_100009447 | Ga0068864_1000094472 | 231 |
| 132 | 3300005718 | Ga0068866_10002311 | Ga0068866_100023114 | 231 |
| 133 | 3300005719 | Ga0068861_100226500 | Ga0068861_1002265002 | 231 |
| 134 | 3300005834 | Ga0068851_10000963 | Ga0068851_100009633 | 231 |
| 135 | 3300005834 | Ga0068851_10031907 | Ga0068851_100319074 | 231 |
| 136 | 3300005840 | Ga0068870_10000769 | Ga0068870_100007698 | 231 |
| 137 | 3300005841 | Ga0068863_100003538 | Ga0068863_1000035389 | 231 |
| 138 | 3300005841 | Ga0068863_100034158 | Ga0068863_1000341582 | 231 |
| 139 | 3300005842 | Ga0068858_100006057 | Ga0068858_1000060575 | 231 |
| 140 | 3300005843 | Ga0068860_100009497 | Ga0068860_1000094974 | 231 |
| 141 | 3300005843 | Ga0068860_100017520 | Ga0068860_1000175204 | 231 |
| 142 | 3300005843 | Ga0068860_100037793 | Ga0068860_1000377932 | 231 |
| 143 | 3300005844 | Ga0068862_100001036 | Ga0068862_10000103619 | 231 |
| 144 | 3300005985 | Ga0081539_10051073 | Ga0081539_100510732 | 231 |
| 145 | 3300006173 | Ga0070716_100077917 | Ga0070716_1000779172 | 231 |
| 146 | 3300006175 | Ga0070712_100049133 | Ga0070712_1000491332 | 231 |
| 147 | 3300006175 | Ga0070712_100940678 | Ga0070712_1009406781 | 231 |
| 148 | 3300006237 | Ga0097621_100020664 | Ga0097621_1000206644 | 231 |
| 149 | 3300006358 | Ga0068871_100156297 | Ga0068871_1001562972 | 231 |
| 150 | 3300006871 | Ga0075434_100052781 | Ga0075434_1000527814 | 231 |
| 151 | 3300006871 | Ga0075434_100505625 | Ga0075434_1005056251 | 231 |
| 152 | 3300006881 | Ga0068865_100032504 | Ga0068865_1000325043 | 231 |
| 153 | 3300006881 | Ga0068865_100157495 | Ga0068865_1001574952 | 231 |
| 154 | 3300006931 | Ga0097620_100010879 | Ga0097620_1000108798 | 231 |
| 155 | 3300006931 | Ga0097620_100269178 | Ga0097620_1002691782 | 231 |
| 156 | 3300007076 | Ga0075435_100007737 | Ga0075435_1000077372 | 231 |
| 157 | 3300007265 | Ga0099794_10009804 | Ga0099794_100098042 | 231 |
| 158 | 3300007265 | Ga0099794_10015415 | Ga0099794_100154151 | 231 |
| 159 | 3300009094 | Ga0111539_10129855 | Ga0111539_101298552 | 231 |
| 160 | 3300009098 | Ga0105245_10016167 | Ga0105245_100161674 | 231 |
| 161 | 3300009147 | Ga0114129_10126434 | Ga0114129_101264342 | 231 |
| 162 | 3300009174 | Ga0105241_10000746 | Ga0105241_1000074626 | 231 |
| 163 | 3300009174 | Ga0105241_10007582 | Ga0105241_100075824 | 231 |
| 164 | 3300009176 | Ga0105242_10028027 | Ga0105242_100280273 | 231 |
| 165 | 3300009176 | Ga0105242_10034642 | Ga0105242_100346425 | 231 |
| 166 | 3300009177 | Ga0105248_10106882 | Ga0105248_101068822 | 231 |
| 167 | 3300010375 | Ga0105239_10059396 | Ga0105239_100593964 | 231 |
| 168 | 3300011119 | Ga0105246_10091377 | Ga0105246_100913773 | 231 |
| 169 | 3300013100 | Ga0157373_10000755 | Ga0157373_1000075512 | 231 |
| 170 | 3300013102 | Ga0157371_10074673 | Ga0157371_100746733 | 231 |
| 171 | 3300013105 | Ga0157369_10027542 | Ga0157369_100275425 | 231 |
| 172 | 3300013296 | Ga0157374_10000367 | Ga0157374_1000036718 | 231 |
| 173 | 3300013296 | Ga0157374_10067000 | Ga0157374_100670005 | 231 |
| 174 | 3300013307 | Ga0157372_10001139 | Ga0157372_1000113916 | 231 |
| 175 | 3300013308 | Ga0157375_10000991 | Ga0157375_100009919 | 231 |
| 176 | 3300013308 | Ga0157375_10012239 | Ga0157375_100122393 | 231 |
| 177 | 3300014325 | Ga0163163_10000659 | Ga0163163_1000065925 | 231 |
| 178 | 3300014325 | Ga0163163_10060644 | Ga0163163_100606443 | 231 |
| 179 | 3300014325 | Ga0163163_10078882 | Ga0163163_100788824 | 231 |
| 180 | 3300014745 | Ga0157377_10106124 | Ga0157377_101061242 | 231 |
| 181 | 3300014969 | Ga0157376_10097581 | Ga0157376_100975813 | 231 |
| 182 | 3300017792 | Ga0163161_10048022 | Ga0163161_100480224 | 231 |
| 183 | 3300020070 | Ga0206356_10080782 | Ga0206356_100807822 | 231 |
| 184 | 3300021377 | Ga0213874_10003972 | Ga0213874_100039724 | 231 |
| 185 | 3300025885 | Ga0207653_10003877 | Ga0207653_100038772 | 231 |
| 186 | 3300025893 | Ga0207682_10001173 | Ga0207682_1000117314 | 231 |
| 187 | 3300025899 | Ga0207642_10019484 | Ga0207642_100194841 | 231 |
| 188 | 3300025903 | Ga0207680_10002438 | Ga0207680_100024383 | 231 |
| 189 | 3300025903 | Ga0207680_10118350 | Ga0207680_101183502 | 231 |
| 190 | 3300025905 | Ga0207685_10035540 | Ga0207685_100355402 | 231 |
| 191 | 3300025907 | Ga0207645_10000170 | Ga0207645_1000017021 | 231 |
| 192 | 3300025907 | Ga0207645_10001033 | Ga0207645_1000103315 | 231 |
| 193 | 3300025908 | Ga0207643_10000051 | Ga0207643_1000005130 | 231 |
| 194 | 3300025908 | Ga0207643_10005125 | Ga0207643_100051258 | 231 |
| 195 | 3300025910 | Ga0207684_10554503 | Ga0207684_105545031 | 231 |
| 196 | 3300025910 | Ga0207684_10732066 | Ga0207684_107320661 | 231 |
| 197 | 3300025911 | Ga0207654_10018395 | Ga0207654_100183954 | 231 |
| 198 | 3300025911 | Ga0207654_10116764 | Ga0207654_101167643 | 231 |
| 199 | 3300025912 | Ga0207707_10000453 | Ga0207707_1000045328 | 231 |
| 200 | 3300025915 | Ga0207693_10002513 | Ga0207693_1000251313 | 231 |
| 201 | 3300025916 | Ga0207663_10011146 | Ga0207663_100111464 | 231 |
| 202 | 3300025917 | Ga0207660_10000203 | Ga0207660_1000020319 | 231 |
| 203 | 3300025919 | Ga0207657_10000357 | Ga0207657_100003574 | 231 |
| 204 | 3300025920 | Ga0207649_10000678 | Ga0207649_100006785 | 231 |
| 205 | 3300025921 | Ga0207652_10000690 | Ga0207652_100006908 | 231 |
| 206 | 3300025922 | Ga0207646_10605610 | Ga0207646_106056102 | 231 |
| 207 | 3300025925 | Ga0207650_10064440 | Ga0207650_100644402 | 231 |
| 208 | 3300025927 | Ga0207687_10004230 | Ga0207687_100042303 | 231 |
| 209 | 3300025927 | Ga0207687_10300479 | Ga0207687_103004792 | 231 |
| 210 | 3300025932 | Ga0207690_10006825 | Ga0207690_100068252 | 231 |
| 211 | 3300025933 | Ga0207706_10022334 | Ga0207706_100223344 | 231 |
| 212 | 3300025934 | Ga0207686_10004948 | Ga0207686_100049484 | 231 |
| 213 | 3300025937 | Ga0207669_10032621 | Ga0207669_100326213 | 231 |
| 214 | 3300025937 | Ga0207669_10170721 | Ga0207669_101707211 | 231 |
| 215 | 3300025938 | Ga0207704_10102105 | Ga0207704_101021052 | 231 |
| 216 | 3300025939 | Ga0207665_10098428 | Ga0207665_100984282 | 231 |
| 217 | 3300025940 | Ga0207691_10000006 | Ga0207691_1000000646 | 231 |
| 218 | 3300025940 | Ga0207691_10015193 | Ga0207691_100151933 | 231 |
| 219 | 3300025941 | Ga0207711_10402296 | Ga0207711_104022961 | 231 |
| 220 | 3300025942 | Ga0207689_10000296 | Ga0207689_1000029624 | 231 |
| 221 | 3300025944 | Ga0207661_10315535 | Ga0207661_103155352 | 231 |
| 222 | 3300025945 | Ga0207679_10000233 | Ga0207679_1000023331 | 231 |
| 223 | 3300025949 | Ga0207667_10001806 | Ga0207667_100018065 | 231 |
| 224 | 3300025960 | Ga0207651_10026513 | Ga0207651_100265133 | 231 |
| 225 | 3300025960 | Ga0207651_10306489 | Ga0207651_103064892 | 231 |
| 226 | 3300025972 | Ga0207668_10013784 | Ga0207668_100137846 | 231 |
| 227 | 3300025981 | Ga0207640_10008493 | Ga0207640_100084934 | 231 |
| 228 | 3300025986 | Ga0207658_10020008 | Ga0207658_100200085 | 231 |
| 229 | 3300025986 | Ga0207658_10352861 | Ga0207658_103528611 | 231 |
| 230 | 3300026035 | Ga0207703_10026631 | Ga0207703_100266315 | 231 |
| 231 | 3300026035 | Ga0207703_10639942 | Ga0207703_106399422 | 231 |
| 232 | 3300026041 | Ga0207639_10001326 | Ga0207639_100013265 | 231 |
| 233 | 3300026041 | Ga0207639_10005406 | Ga0207639_100054062 | 231 |
| 234 | 3300026067 | Ga0207678_10003431 | Ga0207678_100034312 | 231 |
| 235 | 3300026067 | Ga0207678_10054639 | Ga0207678_100546392 | 231 |
| 236 | 3300026067 | Ga0207678_10103322 | Ga0207678_101033222 | 231 |
| 237 | 3300026075 | Ga0207708_10339658 | Ga0207708_103396582 | 231 |
| 238 | 3300026078 | Ga0207702_10001254 | Ga0207702_1000125423 | 231 |
| 239 | 3300026088 | Ga0207641_10029865 | Ga0207641_100298656 | 231 |
| 240 | 3300026088 | Ga0207641_10164161 | Ga0207641_101641612 | 231 |
| 241 | 3300026089 | Ga0207648_10004394 | Ga0207648_1000439412 | 231 |
| 242 | 3300026089 | Ga0207648_10016091 | Ga0207648_100160912 | 231 |
| 243 | 3300026089 | Ga0207648_10022282 | Ga0207648_100222824 | 231 |
| 244 | 3300026089 | Ga0207648_10219500 | Ga0207648_102195003 | 231 |
| 245 | 3300026095 | Ga0207676_10002144 | Ga0207676_1000214416 | 231 |
| 246 | 3300026095 | Ga0207676_10002162 | Ga0207676_100021624 | 231 |
| 247 | 3300026095 | Ga0207676_10255471 | Ga0207676_102554711 | 231 |
| 248 | 3300026116 | Ga0207674_10000836 | Ga0207674_1000083627 | 231 |
| 249 | 3300026118 | Ga0207675_100179851 | Ga0207675_1001798514 | 231 |
| 250 | 3300026118 | Ga0207675_100196626 | Ga0207675_1001966263 | 231 |
| 251 | 3300026121 | Ga0207683_10000853 | Ga0207683_100008537 | 231 |
| 252 | 3300026121 | Ga0207683_10019137 | Ga0207683_100191375 | 231 |
| 253 | 3300026142 | Ga0207698_10003568 | Ga0207698_100035682 | 231 |
| 254 | 3300026142 | Ga0207698_10051282 | Ga0207698_100512823 | 231 |
| 255 | 3300027671 | Ga0209588_1005062 | Ga0209588_10050624 | 231 |
| 256 | 3300028379 | Ga0268266_10006477 | Ga0268266_100064778 | 231 |
| 257 | 3300028380 | Ga0268265_10007291 | Ga0268265_100072916 | 231 |
| 258 | 3300028381 | Ga0268264_10003910 | Ga0268264_100039107 | 231 |
| 259 | 3300028381 | Ga0268264_10011656 | Ga0268264_100116562 | 231 |
| 260 | 3300028556 | Ga0265337_1016980 | Ga0265337_10169802 | 231 |
| 261 | 3300028558 | Ga0265326_10009471 | Ga0265326_100094713 | 231 |
| 262 | 3300028653 | Ga0265323_10005281 | Ga0265323_100052814 | 231 |
| 263 | 3300028666 | Ga0265336_10031580 | Ga0265336_100315801 | 231 |
| 264 | 3300028800 | Ga0265338_10036401 | Ga0265338_100364015 | 231 |
| 265 | 3300031235 | Ga0265330_10001807 | Ga0265330_100018072 | 231 |
| 266 | 3300031247 | Ga0265340_10010296 | Ga0265340_100102964 | 231 |
| 267 | 3300031616 | Ga0307508_10006236 | Ga0307508_1000623612 | 231 |
| 268 | 3300031711 | Ga0265314_10000008 | Ga0265314_10000008206 | 231 |
| 269 | 3300031712 | Ga0265342_10004246 | Ga0265342_100042466 | 231 |
| 270 | 3300031730 | Ga0307516_10158118 | Ga0307516_101581184 | 231 |
| 271 | 3300033179 | Ga0307507_10124333 | Ga0307507_101243332 | 231 |
| 272 | 3300035113 | Ga0373936_0030132 | Ga0373936_0030132_560_1261 | 231 |
| 273 | 3300035115 | Ga0373941_0033512 | Ga0373941_0033512_772_1470 | 231 |
| 274 | 3300035116 | Ga0373945_0020619 | Ga0373945_0020619_939_1640 | 231 |
| 275 | 3300035118 | Ga0373954_0001721 | Ga0373954_0001721_5327_6028 | 231 |
| 276 | 3300035121 | Ga0373960_0039518 | Ga0373960_0039518_47_745 | 231 |
| 277 | 3300035170 | Ga0373943_0016261 | Ga0373943_0016261_649_1350 | 231 |
| 278 | 3300035171 | Ga0373946_0008118 | Ga0373946_0008118_2524_3225 | 231 |
| 279 | 3300035241 | Ga0373961_0039552 | Ga0373961_0039552_642_1340 | 231 |
| 280 | 3300035691 | Ga0373931_0336288 | Ga0373931_0336288_49_747 | 231 |
| 281 | 3300035691 | Ga0373931_0509948 | Ga0373931_0509948_57_758 | 231 |
| 282 | 3300035692 | Ga0373935_0229368 | Ga0373935_0229368_382_1083 | 231 |
| 283 | 3300035724 | Ga0373933_0095271 | Ga0373933_0095271_361_1059 | 231 |
| 284 | 3300036401 | Ga0373937_0008585 | Ga0373937_0008585_84_785 | 231 |
| 285 | 3300036401 | Ga0373937_0057721 | Ga0373937_0057721_1861_2562 | 231 |
| 286 | 3300037068 | Ga0373925_0000590 | Ga0373925_0000590_33024_33725 | 231 |
| 287 | 3300037068 | Ga0373925_0084873 | Ga0373925_0084873_697_1398 | 231 |
| 288 | 3300037471 | Ga0395905_0006594 | Ga0395905_0006594_2911_3609 | 231 |
| 289 | 3300039450 | Ga0436363_1718963 | Ga0436363_1718963_9204_9902 | 231 |
| 290 | 3300042438 | Ga0439459_0000390 | Ga0439459_0000390_1668_2366 | 231 |
| 291 | 3300042876 | Ga0451577_0007371 | Ga0451577_0007371_8177_8875 | 231 |
| 292 | 3300042876 | Ga0451577_0021405 | Ga0451577_0021405_669_1373 | 231 |
| 293 | 3300042876 | Ga0451577_0074187 | Ga0451577_0074187_1899_2597 | 231 |
| 294 | 3300044712 | Ga0453684_0082776 | Ga0453684_0082776_1284_1988 | 231 |
| 295 | 3300044712 | Ga0453684_0358473 | Ga0453684_0358473_284_982 | 231 |
| 296 | 3300045051 | Ga0451576_0017398 | Ga0451576_0017398_926_1624 | 231 |
| 297 | 3300045051 | Ga0451576_0028309 | Ga0451576_0028309_25_723 | 231 |
| 298 | 3300045051 | Ga0451576_0038659 | Ga0451576_0038659_1244_1942 | 231 |
| 299 | 3300046459 | Ga0495629_0259162 | Ga0495629_0259162_454_1155 | 231 |
| 300 | 3300046462 | Ga0495651_0122525 | Ga0495651_0122525_899_1600 | 231 |
| 301 | 3300046463 | Ga0495653_0028328 | Ga0495653_0028328_323_1024 | 231 |
| 302 | 3300046463 | Ga0495653_0166984 | Ga0495653_0166984_580_1278 | 231 |
| 303 | 3300046472 | Ga0495580_0037203 | Ga0495580_0037203_124_825 | 231 |
| 304 | 3300046472 | Ga0495580_0155371 | Ga0495580_0155371_61_762 | 231 |
| 305 | 3300046475 | Ga0495639_0011279 | Ga0495639_0011279_1965_2666 | 231 |
| 306 | 3300046477 | Ga0495664_0298182 | Ga0495664_0298182_253_954 | 231 |
| 307 | 3300046499 | Ga0495594_0008790 | Ga0495594_0008790_2930_3631 | 231 |
| 308 | 3300046507 | Ga0495606_0043881 | Ga0495606_0043881_2003_2701 | 231 |
| 309 | 3300046511 | Ga0495608_0020687 | Ga0495608_0020687_2736_3437 | 231 |
| 310 | 3300046522 | Ga0495643_0005705 | Ga0495643_0005705_2242_2940 | 231 |
| 311 | 3300046528 | Ga0495642_0009846 | Ga0495642_0009846_168_866 | 231 |
| 312 | 3300046531 | Ga0495665_0026312 | Ga0495665_0026312_604_1305 | 231 |
| 313 | 3300046535 | Ga0495586_0036380 | Ga0495586_0036380_481_1182 | 231 |
| 314 | 3300046542 | Ga0495597_0019148 | Ga0495597_0019148_2421_3119 | 231 |
| 315 | 3300046559 | Ga0495667_0045705 | Ga0495667_0045705_1216_1917 | 231 |
| 316 | 3300046663 | Ga0495635_0021814 | Ga0495635_0021814_2503_3204 | 231 |
| 317 | 3300046663 | Ga0495635_0283366 | Ga0495635_0283366_313_1014 | 231 |
| 318 | 3300046665 | Ga0495661_0056627 | Ga0495661_0056627_1548_2246 | 231 |
| 319 | 3300046675 | Ga0495657_0207846 | Ga0495657_0207846_88_789 | 231 |
| 320 | 3300046689 | Ga0495613_0030943 | Ga0495613_0030943_3254_3955 | 231 |
| 321 | 3300046809 | Ga0495600_0133460 | Ga0495600_0133460_368_1069 | 231 |
| 322 | 3300047315 | Ga0495581_0002485 | Ga0495581_0002485_5947_6648 | 231 |
| 323 | 3300047317 | Ga0495604_0173342 | Ga0495604_0173342_72_773 | 231 |
| 324 | 3300047322 | Ga0495680_0026364 | Ga0495680_0026364_1064_1765 | 231 |
| 325 | 3300047443 | Ga0495687_012369 | Ga0495687_012369_1514_2212 | 231 |
| 326 | 3300047471 | Ga0495684_0081087 | Ga0495684_0081087_371_1072 | 231 |
| 327 | 3300048088 | Ga0495602_0011216 | Ga0495602_0011216_5808_6506 | 231 |
| 328 | 3300048905 | Ga0496102_0165727 | Ga0496102_0165727_146_844 | 231 |
| 329 | 3300048907 | Ga0496104_0529421 | Ga0496104_0529421_358_1059 | 231 |
| 330 | 3300048909 | Ga0496106_0018631 | Ga0496106_0018631_3649_4347 | 231 |
| 331 | 3300048910 | Ga0496107_0463492 | Ga0496107_0463492_221_919 | 231 |
| 332 | 3300048912 | Ga0496109_0070025 | Ga0496109_0070025_875_1576 | 231 |
| 333 | 3300048913 | Ga0496110_0075929 | Ga0496110_0075929_1526_2227 | 231 |
| 334 | 3300048915 | Ga0496112_0110109 | Ga0496112_0110109_421_1119 | 231 |
| 335 | 3300048917 | Ga0496114_0048179 | Ga0496114_0048179_1083_1784 | 231 |
| 336 | 3300049571 | Ga0501034_0000188 | Ga0501034_0000188_70485_71183 | 231 |
| 337 | 3300049581 | Ga0501047_0185572 | Ga0501047_0185572_14_712 | 231 |
| 338 | 3300049591 | Ga0501075_0403638 | Ga0501075_0403638_44_742 | 231 |
| 339 | 3300050507 | nmdc:mga05p37_148368_c1 | nmdc:mga05p37_148368_c1_175_873 | 231 |
| 340 | 3300050507 | nmdc:mga05p37_293961_c1 | nmdc:mga05p37_293961_c1_868_1566 | 231 |
| 341 | 3300050511 | nmdc:mga08y16_103046_c1 | nmdc:mga08y16_103046_c1_2003_2701 | 231 |
| 342 | 3300050512 | nmdc:mga0n895_793723_c1 | nmdc:mga0n895_793723_c1_60_758 | 231 |
| 343 | 3300050515 | nmdc:mga0a205_20483_c1 | nmdc:mga0a205_20483_c1_5155_5853 | 231 |
| 344 | 3300053084 | Ga0495595_0196376 | Ga0495595_0196376_178_879 | 231 |
| 345 | 3300053085 | Ga0495619_0005573 | Ga0495619_0005573_6220_6921 | 231 |
| 346 | 3300053111 | Ga0500572_026875 | Ga0500572_026875_77_775 | 231 |
| 347 | 3300053119 | Ga0500595_000293 | Ga0500595_000293_20471_21169 | 231 |
| 348 | 3300053121 | Ga0500607_073737 | Ga0500607_073737_527_1225 | 231 |
| 349 | 3300053122 | Ga0500608_079507 | Ga0500608_079507_810_1508 | 231 |
| 350 | 3300053123 | Ga0500614_001975 | Ga0500614_001975_3119_3817 | 231 |
| 351 | 3300053136 | Ga0500559_0005250 | Ga0500559_0005250_1051_1749 | 231 |
| 352 | 3300053154 | Ga0500619_012431 | Ga0500619_012431_888_1586 | 231 |
| 353 | 3300003775 | Ga0055524_1000606 | Ga0055524_10006065 | 232 |
| 354 | 3300003784 | Ga0055534_1001043 | Ga0055534_100104310 | 232 |
| 355 | 3300005262 | Ga0065165_1004504 | Ga0065165_10045044 | 232 |
| 356 | 3300005334 | Ga0068869_100100872 | Ga0068869_1001008722 | 232 |
| 357 | 3300005340 | Ga0070689_100366130 | Ga0070689_1003661302 | 232 |
| 358 | 3300005543 | Ga0070672_100111344 | Ga0070672_1001113442 | 232 |
| 359 | 3300005548 | Ga0070665_100001831 | Ga0070665_10000183112 | 232 |
| 360 | 3300005844 | Ga0068862_100098895 | Ga0068862_1000988953 | 232 |
| 361 | 3300006178 | Ga0075367_10049042 | Ga0075367_100490422 | 232 |
| 362 | 3300006195 | Ga0075366_10003459 | Ga0075366_100034596 | 232 |
| 363 | 3300006353 | Ga0075370_10000726 | Ga0075370_1000072611 | 232 |
| 364 | 3300006353 | Ga0075370_10001753 | Ga0075370_100017536 | 232 |
| 365 | 3300006358 | Ga0068871_100428970 | Ga0068871_1004289702 | 232 |
| 366 | 3300009093 | Ga0105240_10092977 | Ga0105240_100929773 | 232 |
| 367 | 3300009093 | Ga0105240_10212393 | Ga0105240_102123932 | 232 |
| 368 | 3300009148 | Ga0105243_10198138 | Ga0105243_101981383 | 232 |
| 369 | 3300014968 | Ga0157379_10183473 | Ga0157379_101834732 | 232 |
| 370 | 3300015261 | Ga0182006_1001089 | Ga0182006_10010894 | 232 |
| 371 | 3300021361 | Ga0213872_10012552 | Ga0213872_100125522 | 232 |
| 372 | 3300025224 | Ga0209784_100009 | Ga0209784_100009252 | 232 |
| 373 | 3300025225 | Ga0209566_100007 | Ga0209566_100007252 | 232 |
| 374 | 3300025226 | Ga0209674_100018 | Ga0209674_100018252 | 232 |
| 375 | 3300025230 | Ga0209563_100020 | Ga0209563_100020252 | 232 |
| 376 | 3300025253 | Ga0209677_100010 | Ga0209677_100010252 | 232 |
| 377 | 3300025273 | Ga0209673_1008723 | Ga0209673_10087235 | 232 |
| 378 | 3300025920 | Ga0207649_10066613 | Ga0207649_100666133 | 232 |
| 379 | 3300025940 | Ga0207691_10185420 | Ga0207691_101854203 | 232 |
| 380 | 3300025942 | Ga0207689_10305819 | Ga0207689_103058192 | 232 |
| 381 | 3300026089 | Ga0207648_10171082 | Ga0207648_101710822 | 232 |
| 382 | 3300027682 | Ga0209971_1047136 | Ga0209971_10471362 | 232 |
| 383 | 3300028379 | Ga0268266_10008840 | Ga0268266_100088404 | 232 |
| 384 | 3300028380 | Ga0268265_10198550 | Ga0268265_101985503 | 232 |
| 385 | 3300031235 | Ga0265330_10053113 | Ga0265330_100531133 | 232 |
| 386 | 3300031238 | Ga0265332_10006958 | Ga0265332_100069581 | 232 |
| 387 | 3300031711 | Ga0265314_10003341 | Ga0265314_100033416 | 232 |
| 388 | 3300031852 | Ga0307410_10489998 | Ga0307410_104899982 | 232 |
| 389 | 3300033180 | Ga0307510_10001034 | Ga0307510_1000103416 | 232 |
| 390 | 3300035171 | Ga0373946_0257646 | Ga0373946_0257646_67_810 | 232 |
| 391 | 3300035398 | Ga0316574_0097230 | Ga0316574_0097230_292_996 | 232 |
| 392 | 3300036401 | Ga0373937_0120460 | Ga0373937_0120460_1597_2340 | 232 |
| 393 | 3300039447 | Ga0436361_0181224 | Ga0436361_0181224_988_1689 | 232 |
| 394 | 3300042012 | Ga0439455_0100503 | Ga0439455_0100503_18_737 | 232 |
| 395 | 3300042876 | Ga0451577_0193695 | Ga0451577_0193695_49_747 | 232 |
| 396 | 3300045049 | Ga0466959_0019220 | Ga0466959_0019220_498_1199 | 232 |
| 397 | 3300046459 | Ga0495629_0020987 | Ga0495629_0020987_1609_2352 | 232 |
| 398 | 3300046472 | Ga0495580_0042110 | Ga0495580_0042110_1941_2657 | 232 |
| 399 | 3300046516 | Ga0495628_0142105 | Ga0495628_0142105_705_1448 | 232 |
| 400 | 3300046523 | Ga0495644_0000126 | Ga0495644_0000126_6784_7482 | 232 |
| 401 | 3300046681 | Ga0495647_0007674 | Ga0495647_0007674_1682_2425 | 232 |
| 402 | 3300046683 | Ga0495658_0013030 | Ga0495658_0013030_782_1525 | 232 |
| 403 | 3300047447 | Ga0495685_001412 | Ga0495685_001412_1591_2289 | 232 |
| 404 | 3300047471 | Ga0495684_0043266 | Ga0495684_0043266_1330_2073 | 232 |
| 405 | 3300047472 | Ga0495686_0000159 | Ga0495686_0000159_16348_17049 | 232 |
| 406 | 3300049460 | Ga0495682_0001373 | Ga0495682_0001373_5828_6526 | 232 |
| 407 | 3300049572 | Ga0501036_0038713 | Ga0501036_0038713_2990_3688 | 232 |
| 408 | 3300049573 | Ga0501037_0110141 | Ga0501037_0110141_1145_1843 | 232 |
| 409 | 3300049576 | Ga0501040_0002233 | Ga0501040_0002233_5704_6402 | 232 |
| 410 | 3300049582 | Ga0501048_0039419 | Ga0501048_0039419_2143_2841 | 232 |
| 411 | 3300049587 | Ga0501071_0043530 | Ga0501071_0043530_1655_2353 | 232 |
| 412 | 3300049588 | Ga0501072_0006430 | Ga0501072_0006430_7907_8605 | 232 |
| 413 | 3300049588 | Ga0501072_0128287 | Ga0501072_0128287_941_1717 | 232 |
| 414 | 3300049589 | Ga0501073_0407773 | Ga0501073_0407773_136_834 | 232 |
| 415 | 3300049590 | Ga0501074_0044204 | Ga0501074_0044204_2280_2978 | 232 |
| 416 | 3300049591 | Ga0501075_0000739 | Ga0501075_0000739_13565_14263 | 232 |
| 417 | 3300049591 | Ga0501075_0009894 | Ga0501075_0009894_816_1592 | 232 |
| 418 | 3300049592 | Ga0501076_0001064 | Ga0501076_0001064_6574_7272 | 232 |
| 419 | 3300049741 | Ga0501079_0040293 | Ga0501079_0040293_1871_2569 | 232 |
| 420 | 3300049742 | Ga0501080_0002824 | Ga0501080_0002824_8486_9184 | 232 |
| 421 | 3300049743 | Ga0501081_0001893 | Ga0501081_0001893_11602_12300 | 232 |
| 422 | 3300049743 | Ga0501081_0310317 | Ga0501081_0310317_72_848 | 232 |
| 423 | 3300049824 | Ga0501045_0016289 | Ga0501045_0016289_1527_2303 | 232 |
| 424 | 3300049824 | Ga0501045_0021163 | Ga0501045_0021163_1916_2614 | 232 |
| 425 | 3300050493 | nmdc:mga0k408_18775_c1 | nmdc:mga0k408_18775_c1_1846_2568 | 232 |
| 426 | 3300050493 | nmdc:mga0k408_29098_c1 | nmdc:mga0k408_29098_c1_1816_2535 | 232 |
| 427 | 3300050494 | nmdc:mga06z11_175211_c1 | nmdc:mga06z11_175211_c1_36_755 | 232 |
| 428 | 3300050496 | nmdc:mga07m45_1123_c1 | nmdc:mga07m45_1123_c1_9212_9931 | 232 |
| 429 | 3300050496 | nmdc:mga07m45_570_c1 | nmdc:mga07m45_570_c1_9869_10588 | 232 |
| 430 | 3300053084 | Ga0495595_0072978 | Ga0495595_0072978_775_1518 | 232 |
| 431 | 3300053088 | Ga0500644_0001943 | Ga0500644_0001943_3577_4275 | 232 |
| 432 | 3300053730 | Ga0500645_000214 | Ga0500645_000214_28866_29564 | 232 |
| 433 | 3300060353 | Ga0501082_0002239 | Ga0501082_0002239_5195_5893 | 232 |
| 434 | 3300061734 | Ga0530510_0000539 | Ga0530510_0000539_16384_17082 | 232 |
| 435 | 3300002704 | JGI25155J39150_1000008 | JGI25155J39150_1000008207 | 233 |
| 436 | 3300002705 | JGI25156J39149_1000002 | JGI25156J39149_100000247 | 233 |
| 437 | 3300002738 | JGI25154J39366_1000010 | JGI25154J39366_1000010270 | 233 |
| 438 | 3300002741 | JGI25157J39369_1000001 | JGI25157J39369_100000168 | 233 |
| 439 | 3300002774 | JGI25150J39212_1028518 | JGI25150J39212_10285181 | 233 |
| 440 | 3300002987 | JGI25159J45721_1001868 | JGI25159J45721_10018684 | 233 |
| 441 | 3300002987 | JGI25159J45721_1002408 | JGI25159J45721_10024082 | 233 |
| 442 | 3300003187 | JGI25151J46595_10003749 | JGI25151J46595_100037498 | 233 |
| 443 | 3300003187 | JGI25151J46595_10004501 | JGI25151J46595_100045013 | 233 |
| 444 | 3300003322 | rootL2_10142603 | rootL2_101426032 | 233 |
| 445 | 3300003347 | JGI26128J50194_1001075 | JGI26128J50194_10010752 | 233 |
| 446 | 3300003354 | JGI25160J50197_1000342 | JGI25160J50197_10003428 | 233 |
| 447 | 3300003354 | JGI25160J50197_1016285 | JGI25160J50197_10162852 | 233 |
| 448 | 3300003374 | JGI25161J50226_1000259 | JGI25161J50226_10002598 | 233 |
| 449 | 3300003771 | Ga0055526_1001483 | Ga0055526_10014839 | 233 |
| 450 | 3300003771 | Ga0055526_1003973 | Ga0055526_10039734 | 233 |
| 451 | 3300003773 | Ga0055537_1000102 | Ga0055537_100010211 | 233 |
| 452 | 3300003773 | Ga0055537_1005851 | Ga0055537_10058513 | 233 |
| 453 | 3300003775 | Ga0055524_1000093 | Ga0055524_100009361 | 233 |
| 454 | 3300003781 | Ga0055536_1006611 | Ga0055536_10066116 | 233 |
| 455 | 3300003784 | Ga0055534_1002793 | Ga0055534_10027932 | 233 |
| 456 | 3300003790 | Ga0055528_1000696 | Ga0055528_100069611 | 233 |
| 457 | 3300003791 | Ga0055530_10000891 | Ga0055530_100008919 | 233 |
| 458 | 3300003792 | Ga0055540_1000089 | Ga0055540_100008987 | 233 |
| 459 | 3300003792 | Ga0055540_1000196 | Ga0055540_10001963 | 233 |
| 460 | 3300003794 | Ga0055531_10004653 | Ga0055531_100046539 | 233 |
| 461 | 3300004625 | Ga0055543_1000527 | Ga0055543_100052716 | 233 |
| 462 | 3300005262 | Ga0065165_1005633 | Ga0065165_10056332 | 233 |
| 463 | 3300005262 | Ga0065165_1006014 | Ga0065165_10060142 | 233 |
| 464 | 3300005288 | Ga0065714_10028103 | Ga0065714_100281031 | 233 |
| 465 | 3300005327 | Ga0070658_10006296 | Ga0070658_100062963 | 233 |
| 466 | 3300005327 | Ga0070658_10063873 | Ga0070658_100638732 | 233 |
| 467 | 3300005329 | Ga0070683_100013440 | Ga0070683_1000134407 | 233 |
| 468 | 3300005331 | Ga0070670_100015364 | Ga0070670_1000153646 | 233 |
| 469 | 3300005331 | Ga0070670_100050796 | Ga0070670_1000507964 | 233 |
| 470 | 3300005336 | Ga0070680_100026210 | Ga0070680_1000262102 | 233 |
| 471 | 3300005339 | Ga0070660_100025968 | Ga0070660_1000259685 | 233 |
| 472 | 3300005339 | Ga0070660_100113763 | Ga0070660_1001137632 | 233 |
| 473 | 3300005344 | Ga0070661_100005929 | Ga0070661_1000059292 | 233 |
| 474 | 3300005344 | Ga0070661_100057362 | Ga0070661_1000573623 | 233 |
| 475 | 3300005344 | Ga0070661_100203509 | Ga0070661_1002035092 | 233 |
| 476 | 3300005354 | Ga0070675_100269821 | Ga0070675_1002698212 | 233 |
| 477 | 3300005354 | Ga0070675_100615831 | Ga0070675_1006158311 | 233 |
| 478 | 3300005366 | Ga0070659_100007664 | Ga0070659_1000076643 | 233 |
| 479 | 3300005434 | Ga0070709_10006612 | Ga0070709_100066127 | 233 |
| 480 | 3300005434 | Ga0070709_10318978 | Ga0070709_103189781 | 233 |
| 481 | 3300005435 | Ga0070714_100067425 | Ga0070714_1000674252 | 233 |
| 482 | 3300005437 | Ga0070710_10381774 | Ga0070710_103817742 | 233 |
| 483 | 3300005439 | Ga0070711_100138301 | Ga0070711_1001383012 | 233 |
| 484 | 3300005455 | Ga0070663_100003555 | Ga0070663_1000035554 | 233 |
| 485 | 3300005458 | Ga0070681_10003260 | Ga0070681_100032604 | 233 |
| 486 | 3300005458 | Ga0070681_10054456 | Ga0070681_100544562 | 233 |
| 487 | 3300005458 | Ga0070681_10612792 | Ga0070681_106127921 | 233 |
| 488 | 3300005459 | Ga0068867_100000642 | Ga0068867_1000006423 | 233 |
| 489 | 3300005459 | Ga0068867_100149513 | Ga0068867_1001495133 | 233 |
| 490 | 3300005467 | Ga0070706_100097493 | Ga0070706_1000974933 | 233 |
| 491 | 3300005530 | Ga0070679_100024228 | Ga0070679_1000242283 | 233 |
| 492 | 3300005535 | Ga0070684_100001566 | Ga0070684_1000015669 | 233 |
| 493 | 3300005539 | Ga0068853_100012208 | Ga0068853_1000122086 | 233 |
| 494 | 3300005539 | Ga0068853_100181494 | Ga0068853_1001814942 | 233 |
| 495 | 3300005539 | Ga0068853_100610168 | Ga0068853_1006101681 | 233 |
| 496 | 3300005547 | Ga0070693_100027690 | Ga0070693_1000276903 | 233 |
| 497 | 3300005548 | Ga0070665_100024636 | Ga0070665_1000246364 | 233 |
| 498 | 3300005563 | Ga0068855_100004144 | Ga0068855_10000414410 | 233 |
| 499 | 3300005563 | Ga0068855_100054072 | Ga0068855_1000540722 | 233 |
| 500 | 3300005563 | Ga0068855_100203970 | Ga0068855_1002039703 | 233 |
| 501 | 3300005564 | Ga0070664_100006434 | Ga0070664_1000064349 | 233 |
| 502 | 3300005577 | Ga0068857_100040360 | Ga0068857_1000403606 | 233 |
| 503 | 3300005578 | Ga0068854_100003114 | Ga0068854_1000031141 | 233 |
| 504 | 3300005578 | Ga0068854_100011172 | Ga0068854_1000111725 | 233 |
| 505 | 3300005578 | Ga0068854_100203609 | Ga0068854_1002036092 | 233 |
| 506 | 3300005614 | Ga0068856_100011686 | Ga0068856_1000116867 | 233 |
| 507 | 3300005614 | Ga0068856_100019664 | Ga0068856_1000196643 | 233 |
| 508 | 3300005614 | Ga0068856_100394237 | Ga0068856_1003942372 | 233 |
| 509 | 3300005616 | Ga0068852_100165800 | Ga0068852_1001658002 | 233 |
| 510 | 3300005618 | Ga0068864_100043522 | Ga0068864_1000435224 | 233 |
| 511 | 3300005618 | Ga0068864_100158672 | Ga0068864_1001586721 | 233 |
| 512 | 3300005719 | Ga0068861_100818218 | Ga0068861_1008182182 | 233 |
| 513 | 3300005834 | Ga0068851_10005511 | Ga0068851_100055117 | 233 |
| 514 | 3300005834 | Ga0068851_10030349 | Ga0068851_100303493 | 233 |
| 515 | 3300005840 | Ga0068870_10499007 | Ga0068870_104990071 | 233 |
| 516 | 3300005841 | Ga0068863_100160162 | Ga0068863_1001601621 | 233 |
| 517 | 3300005843 | Ga0068860_100051083 | Ga0068860_1000510834 | 233 |
| 518 | 3300005844 | Ga0068862_100203779 | Ga0068862_1002037792 | 233 |
| 519 | 3300006177 | Ga0075362_10132739 | Ga0075362_101327393 | 233 |
| 520 | 3300006177 | Ga0075362_10154208 | Ga0075362_101542082 | 233 |
| 521 | 3300006178 | Ga0075367_10025914 | Ga0075367_100259145 | 233 |
| 522 | 3300006178 | Ga0075367_10284136 | Ga0075367_102841361 | 233 |
| 523 | 3300006195 | Ga0075366_10067100 | Ga0075366_100671003 | 233 |
| 524 | 3300006195 | Ga0075366_10085271 | Ga0075366_100852712 | 233 |
| 525 | 3300006353 | Ga0075370_10079724 | Ga0075370_100797242 | 233 |
| 526 | 3300006353 | Ga0075370_10160842 | Ga0075370_101608422 | 233 |
| 527 | 3300006353 | Ga0075370_10168532 | Ga0075370_101685322 | 233 |
| 528 | 3300006847 | Ga0075431_100344011 | Ga0075431_1003440112 | 233 |
| 529 | 3300006880 | Ga0075429_100051315 | Ga0075429_1000513154 | 233 |
| 530 | 3300006914 | Ga0075436_100052221 | Ga0075436_1000522215 | 233 |
| 531 | 3300006946 | Ga0079104_1000970 | Ga0079104_100097022 | 233 |
| 532 | 3300006946 | Ga0079104_1010113 | Ga0079104_10101133 | 233 |
| 533 | 3300009093 | Ga0105240_10012204 | Ga0105240_100122048 | 233 |
| 534 | 3300009093 | Ga0105240_10119142 | Ga0105240_101191422 | 233 |
| 535 | 3300009093 | Ga0105240_10211547 | Ga0105240_102115473 | 233 |
| 536 | 3300009093 | Ga0105240_10269429 | Ga0105240_102694292 | 233 |
| 537 | 3300009174 | Ga0105241_10000415 | Ga0105241_1000041521 | 233 |
| 538 | 3300009174 | Ga0105241_10060181 | Ga0105241_100601813 | 233 |
| 539 | 3300009177 | Ga0105248_10425935 | Ga0105248_104259351 | 233 |
| 540 | 3300009545 | Ga0105237_10014925 | Ga0105237_100149259 | 233 |
| 541 | 3300010375 | Ga0105239_10016788 | Ga0105239_100167889 | 233 |
| 542 | 3300011119 | Ga0105246_10619932 | Ga0105246_106199321 | 233 |
| 543 | 3300012513 | Ga0157326_1007504 | Ga0157326_10075042 | 233 |
| 544 | 3300013100 | Ga0157373_10005045 | Ga0157373_100050453 | 233 |
| 545 | 3300013100 | Ga0157373_10018416 | Ga0157373_100184165 | 233 |
| 546 | 3300013102 | Ga0157371_10007161 | Ga0157371_100071617 | 233 |
| 547 | 3300013104 | Ga0157370_10022272 | Ga0157370_100222726 | 233 |
| 548 | 3300013104 | Ga0157370_10050451 | Ga0157370_100504512 | 233 |
| 549 | 3300013104 | Ga0157370_10068790 | Ga0157370_100687905 | 233 |
| 550 | 3300013104 | Ga0157370_10341411 | Ga0157370_103414111 | 233 |
| 551 | 3300013105 | Ga0157369_10049289 | Ga0157369_100492893 | 233 |
| 552 | 3300013296 | Ga0157374_10149417 | Ga0157374_101494172 | 233 |
| 553 | 3300013307 | Ga0157372_10005206 | Ga0157372_1000520614 | 233 |
| 554 | 3300013307 | Ga0157372_10043686 | Ga0157372_100436864 | 233 |
| 555 | 3300013307 | Ga0157372_10049928 | Ga0157372_100499284 | 233 |
| 556 | 3300013307 | Ga0157372_10546428 | Ga0157372_105464282 | 233 |
| 557 | 3300014745 | Ga0157377_10000052 | Ga0157377_1000005222 | 233 |
| 558 | 3300014969 | Ga0157376_10002363 | Ga0157376_100023637 | 233 |
| 559 | 3300021361 | Ga0213872_10000016 | Ga0213872_1000001699 | 233 |
| 560 | 3300025206 | Ga0209435_100001 | Ga0209435_1000011248 | 233 |
| 561 | 3300025208 | Ga0209436_104299 | Ga0209436_1042995 | 233 |
| 562 | 3300025245 | Ga0207425_1003360 | Ga0207425_10033606 | 233 |
| 563 | 3300025245 | Ga0207425_1005687 | Ga0207425_10056874 | 233 |
| 564 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011617 | 233 |
| 565 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001270 | 233 |
| 566 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011248 | 233 |
| 567 | 3300025258 | Ga0209129_1013818 | Ga0209129_10138181 | 233 |
| 568 | 3300025258 | Ga0209129_1016874 | Ga0209129_10168741 | 233 |
| 569 | 3300025258 | Ga0209129_1035648 | Ga0209129_10356481 | 233 |
| 570 | 3300025263 | Ga0209565_1000161 | Ga0209565_100016173 | 233 |
| 571 | 3300025263 | Ga0209565_1000884 | Ga0209565_10008847 | 233 |
| 572 | 3300025273 | Ga0209673_1000391 | Ga0209673_100039148 | 233 |
| 573 | 3300025273 | Ga0209673_1057290 | Ga0209673_10572902 | 233 |
| 574 | 3300025284 | Ga0209130_1000118 | Ga0209130_100011834 | 233 |
| 575 | 3300025284 | Ga0209130_1000359 | Ga0209130_100035944 | 233 |
| 576 | 3300025291 | Ga0209675_1000111 | Ga0209675_1000111101 | 233 |
| 577 | 3300025291 | Ga0209675_1000495 | Ga0209675_100049511 | 233 |
| 578 | 3300025292 | Ga0209676_1000054 | Ga0209676_100005488 | 233 |
| 579 | 3300025292 | Ga0209676_1003774 | Ga0209676_100377410 | 233 |
| 580 | 3300025294 | Ga0209025_1001351 | Ga0209025_100135118 | 233 |
| 581 | 3300025294 | Ga0209025_1004481 | Ga0209025_10044816 | 233 |
| 582 | 3300025294 | Ga0209025_1006065 | Ga0209025_10060652 | 233 |
| 583 | 3300025295 | Ga0209564_1000610 | Ga0209564_100061023 | 233 |
| 584 | 3300025295 | Ga0209564_1000815 | Ga0209564_100081525 | 233 |
| 585 | 3300025295 | Ga0209564_1030948 | Ga0209564_10309483 | 233 |
| 586 | 3300025297 | Ga0209758_1006167 | Ga0209758_10061675 | 233 |
| 587 | 3300025298 | Ga0209050_1000066 | Ga0209050_100006688 | 233 |
| 588 | 3300025298 | Ga0209050_1001609 | Ga0209050_10016098 | 233 |
| 589 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031361 | 233 |
| 590 | 3300025299 | Ga0209256_1044726 | Ga0209256_10447262 | 233 |
| 591 | 3300025302 | Ga0207426_1000197 | Ga0207426_100019754 | 233 |
| 592 | 3300025302 | Ga0207426_1001157 | Ga0207426_100115712 | 233 |
| 593 | 3300025303 | Ga0209051_1000044 | Ga0209051_100004488 | 233 |
| 594 | 3300025304 | Ga0209257_1000082 | Ga0209257_100008288 | 233 |
| 595 | 3300025906 | Ga0207699_10113857 | Ga0207699_101138571 | 233 |
| 596 | 3300025907 | Ga0207645_10061863 | Ga0207645_100618633 | 233 |
| 597 | 3300025908 | Ga0207643_10040757 | Ga0207643_100407571 | 233 |
| 598 | 3300025909 | Ga0207705_10176135 | Ga0207705_101761352 | 233 |
| 599 | 3300025910 | Ga0207684_10032385 | Ga0207684_100323852 | 233 |
| 600 | 3300025911 | Ga0207654_10030744 | Ga0207654_100307444 | 233 |
| 601 | 3300025912 | Ga0207707_10008794 | Ga0207707_100087947 | 233 |
| 602 | 3300025912 | Ga0207707_10011006 | Ga0207707_100110064 | 233 |
| 603 | 3300025912 | Ga0207707_10013892 | Ga0207707_100138927 | 233 |
| 604 | 3300025913 | Ga0207695_10010473 | Ga0207695_100104731 | 233 |
| 605 | 3300025913 | Ga0207695_10419225 | Ga0207695_104192251 | 233 |
| 606 | 3300025914 | Ga0207671_10021270 | Ga0207671_100212703 | 233 |
| 607 | 3300025916 | Ga0207663_10162626 | Ga0207663_101626262 | 233 |
| 608 | 3300025917 | Ga0207660_10007462 | Ga0207660_100074622 | 233 |
| 609 | 3300025919 | Ga0207657_10000148 | Ga0207657_1000014842 | 233 |
| 610 | 3300025919 | Ga0207657_10079515 | Ga0207657_100795153 | 233 |
| 611 | 3300025919 | Ga0207657_10116297 | Ga0207657_101162972 | 233 |
| 612 | 3300025920 | Ga0207649_10012182 | Ga0207649_100121824 | 233 |
| 613 | 3300025920 | Ga0207649_10013098 | Ga0207649_100130984 | 233 |
| 614 | 3300025920 | Ga0207649_10178766 | Ga0207649_101787662 | 233 |
| 615 | 3300025921 | Ga0207652_10007190 | Ga0207652_1000719010 | 233 |
| 616 | 3300025924 | Ga0207694_10019608 | Ga0207694_100196083 | 233 |
| 617 | 3300025924 | Ga0207694_10068899 | Ga0207694_100688993 | 233 |
| 618 | 3300025925 | Ga0207650_10072818 | Ga0207650_100728182 | 233 |
| 619 | 3300025925 | Ga0207650_10168846 | Ga0207650_101688462 | 233 |
| 620 | 3300025926 | Ga0207659_10060367 | Ga0207659_100603672 | 233 |
| 621 | 3300025926 | Ga0207659_10259955 | Ga0207659_102599552 | 233 |
| 622 | 3300025932 | Ga0207690_10076874 | Ga0207690_100768742 | 233 |
| 623 | 3300025932 | Ga0207690_10116822 | Ga0207690_101168222 | 233 |
| 624 | 3300025935 | Ga0207709_10073370 | Ga0207709_100733703 | 233 |
| 625 | 3300025937 | Ga0207669_10320671 | Ga0207669_103206712 | 233 |
| 626 | 3300025940 | Ga0207691_10123425 | Ga0207691_101234252 | 233 |
| 627 | 3300025944 | Ga0207661_10029191 | Ga0207661_100291912 | 233 |
| 628 | 3300025944 | Ga0207661_10067004 | Ga0207661_100670044 | 233 |
| 629 | 3300025945 | Ga0207679_10005432 | Ga0207679_100054323 | 233 |
| 630 | 3300025949 | Ga0207667_10002455 | Ga0207667_1000245513 | 233 |
| 631 | 3300025949 | Ga0207667_10040920 | Ga0207667_100409203 | 233 |
| 632 | 3300025949 | Ga0207667_10043513 | Ga0207667_100435133 | 233 |
| 633 | 3300025949 | Ga0207667_10163275 | Ga0207667_101632752 | 233 |
| 634 | 3300025949 | Ga0207667_10165462 | Ga0207667_101654623 | 233 |
| 635 | 3300025981 | Ga0207640_10017603 | Ga0207640_100176034 | 233 |
| 636 | 3300026041 | Ga0207639_10337620 | Ga0207639_103376202 | 233 |
| 637 | 3300026067 | Ga0207678_10000214 | Ga0207678_1000021441 | 233 |
| 638 | 3300026067 | Ga0207678_10171130 | Ga0207678_101711301 | 233 |
| 639 | 3300026078 | Ga0207702_10018586 | Ga0207702_100185863 | 233 |
| 640 | 3300026078 | Ga0207702_10064868 | Ga0207702_100648683 | 233 |
| 641 | 3300026078 | Ga0207702_10643810 | Ga0207702_106438102 | 233 |
| 642 | 3300026078 | Ga0207702_10704946 | Ga0207702_107049461 | 233 |
| 643 | 3300026088 | Ga0207641_10537997 | Ga0207641_105379971 | 233 |
| 644 | 3300026088 | Ga0207641_10745058 | Ga0207641_107450581 | 233 |
| 645 | 3300026089 | Ga0207648_10001074 | Ga0207648_1000107414 | 233 |
| 646 | 3300026095 | Ga0207676_10123826 | Ga0207676_101238264 | 233 |
| 647 | 3300026116 | Ga0207674_10000312 | Ga0207674_1000031229 | 233 |
| 648 | 3300026116 | Ga0207674_10050212 | Ga0207674_100502122 | 233 |
| 649 | 3300026116 | Ga0207674_10271124 | Ga0207674_102711242 | 233 |
| 650 | 3300026142 | Ga0207698_10000387 | Ga0207698_1000038710 | 233 |
| 651 | 3300026142 | Ga0207698_10229165 | Ga0207698_102291652 | 233 |
| 652 | 3300027111 | Ga0209281_1000993 | Ga0209281_100099322 | 233 |
| 653 | 3300027395 | Ga0209996_1003277 | Ga0209996_10032772 | 233 |
| 654 | 3300027471 | Ga0209995_1005220 | Ga0209995_10052202 | 233 |
| 655 | 3300027526 | Ga0209968_1004026 | Ga0209968_10040261 | 233 |
| 656 | 3300027543 | Ga0209999_1014337 | Ga0209999_10143371 | 233 |
| 657 | 3300027614 | Ga0209970_1002103 | Ga0209970_10021032 | 233 |
| 658 | 3300027665 | Ga0209983_1005427 | Ga0209983_10054272 | 233 |
| 659 | 3300027695 | Ga0209966_1000006 | Ga0209966_100000626 | 233 |
| 660 | 3300027717 | Ga0209998_10004415 | Ga0209998_100044153 | 233 |
| 661 | 3300027876 | Ga0209974_10007390 | Ga0209974_100073904 | 233 |
| 662 | 3300027907 | Ga0207428_10083126 | Ga0207428_100831263 | 233 |
| 663 | 3300027907 | Ga0207428_10359126 | Ga0207428_103591261 | 233 |
| 664 | 3300028380 | Ga0268265_10289484 | Ga0268265_102894842 | 233 |
| 665 | 3300028381 | Ga0268264_10194216 | Ga0268264_101942162 | 233 |
| 666 | 3300028794 | Ga0307515_10000028 | Ga0307515_10000028203 | 233 |
| 667 | 3300028794 | Ga0307515_10002860 | Ga0307515_1000286036 | 233 |
| 668 | 3300028794 | Ga0307515_10004730 | Ga0307515_100047305 | 233 |
| 669 | 3300028794 | Ga0307515_10114546 | Ga0307515_101145462 | 233 |
| 670 | 3300031238 | Ga0265332_10000003 | Ga0265332_1000000372 | 233 |
| 671 | 3300031456 | Ga0307513_10000017 | Ga0307513_10000017269 | 233 |
| 672 | 3300031456 | Ga0307513_10000021 | Ga0307513_10000021200 | 233 |
| 673 | 3300031456 | Ga0307513_10012920 | Ga0307513_1001292010 | 233 |
| 674 | 3300031456 | Ga0307513_10020368 | Ga0307513_100203682 | 233 |
| 675 | 3300031456 | Ga0307513_10094414 | Ga0307513_100944141 | 233 |
| 676 | 3300031456 | Ga0307513_10358370 | Ga0307513_103583702 | 233 |
| 677 | 3300031507 | Ga0307509_10001516 | Ga0307509_1000151615 | 233 |
| 678 | 3300031507 | Ga0307509_10233057 | Ga0307509_102330572 | 233 |
| 679 | 3300031649 | Ga0307514_10000225 | Ga0307514_1000022595 | 233 |
| 680 | 3300031730 | Ga0307516_10000386 | Ga0307516_100003863 | 233 |
| 681 | 3300031824 | Ga0307413_10175796 | Ga0307413_101757962 | 233 |
| 682 | 3300031901 | Ga0307406_10027094 | Ga0307406_100270943 | 233 |
| 683 | 3300032005 | Ga0307411_10266996 | Ga0307411_102669962 | 233 |
| 684 | 3300037312 | Ga0395899_0090357 | Ga0395899_0090357_1215_1919 | 233 |
| 685 | 3300037312 | Ga0395899_0107827 | Ga0395899_0107827_1022_1726 | 233 |
| 686 | 3300037418 | Ga0395900_0144518 | Ga0395900_0144518_1667_2371 | 233 |
| 687 | 3300037418 | Ga0395900_0166167 | Ga0395900_0166167_105_806 | 233 |
| 688 | 3300037418 | Ga0395900_0284319 | Ga0395900_0284319_704_1405 | 233 |
| 689 | 3300037471 | Ga0395905_0077695 | Ga0395905_0077695_1732_2433 | 233 |
| 690 | 3300037471 | Ga0395905_0164659 | Ga0395905_0164659_1216_1920 | 233 |
| 691 | 3300037471 | Ga0395905_0277013 | Ga0395905_0277013_549_1250 | 233 |
| 692 | 3300038443 | Ga0395901_0156880 | Ga0395901_0156880_1223_1927 | 233 |
| 693 | 3300038443 | Ga0395901_0328300 | Ga0395901_0328300_813_1517 | 233 |
| 694 | 3300039437 | Ga0436365_1078319 | Ga0436365_1078319_459_1160 | 233 |
| 695 | 3300039447 | Ga0436361_0376061 | Ga0436361_0376061_126804_127505 | 233 |
| 696 | 3300041443 | Ga0451789_1034659 | Ga0451789_1034659_225_926 | 233 |
| 697 | 3300041459 | Ga0451800_1561068 | Ga0451800_1561068_363_1094 | 233 |
| 698 | 3300041486 | Ga0451807_1197568 | Ga0451807_1197568_18_794 | 233 |
| 699 | 3300042531 | Ga0450918_000032 | Ga0450918_000032_6385_7086 | 233 |
| 700 | 3300042876 | Ga0451577_0165977 | Ga0451577_0165977_852_1553 | 233 |
| 701 | 3300042876 | Ga0451577_0263812 | Ga0451577_0263812_646_1347 | 233 |
| 702 | 3300044673 | Ga0453683_0141637 | Ga0453683_0141637_260_961 | 233 |
| 703 | 3300044694 | Ga0466963_0101280 | Ga0466963_0101280_608_1438 | 233 |
| 704 | 3300044694 | Ga0466963_0199946 | Ga0466963_0199946_152_856 | 233 |
| 705 | 3300044901 | Ga0466960_0045148 | Ga0466960_0045148_519_1223 | 233 |
| 706 | 3300044901 | Ga0466960_0083844 | Ga0466960_0083844_729_1430 | 233 |
| 707 | 3300045051 | Ga0451576_0526943 | Ga0451576_0526943_421_1122 | 233 |
| 708 | 3300046475 | Ga0495639_0135150 | Ga0495639_0135150_455_1162 | 233 |
| 709 | 3300046492 | Ga0495585_0000221 | Ga0495585_0000221_10699_11400 | 233 |
| 710 | 3300046500 | Ga0495596_0002792 | Ga0495596_0002792_6040_6741 | 233 |
| 711 | 3300046506 | Ga0495583_0000423 | Ga0495583_0000423_17070_17771 | 233 |
| 712 | 3300046506 | Ga0495583_0000423 | Ga0495583_0000423_47135_47836 | 233 |
| 713 | 3300046506 | Ga0495583_0096010 | Ga0495583_0096010_276_977 | 233 |
| 714 | 3300046518 | Ga0495631_0001877 | Ga0495631_0001877_4827_5528 | 233 |
| 715 | 3300046522 | Ga0495643_0010037 | Ga0495643_0010037_2202_2903 | 233 |
| 716 | 3300046525 | Ga0495663_0007041 | Ga0495663_0007041_1015_1716 | 233 |
| 717 | 3300046533 | Ga0495640_0227531 | Ga0495640_0227531_88_789 | 233 |
| 718 | 3300046538 | Ga0495609_0012392 | Ga0495609_0012392_1753_2454 | 233 |
| 719 | 3300046539 | Ga0495621_0022745 | Ga0495621_0022745_483_1184 | 233 |
| 720 | 3300046539 | Ga0495621_0033099 | Ga0495621_0033099_1029_1730 | 233 |
| 721 | 3300046557 | Ga0495622_0133718 | Ga0495622_0133718_50_751 | 233 |
| 722 | 3300046615 | Ga0495656_0146225 | Ga0495656_0146225_331_1032 | 233 |
| 723 | 3300046660 | Ga0495625_0198158 | Ga0495625_0198158_513_1214 | 233 |
| 724 | 3300046794 | Ga0495589_0065104 | Ga0495589_0065104_690_1391 | 233 |
| 725 | 3300047318 | Ga0495636_0059269 | Ga0495636_0059269_390_1091 | 233 |
| 726 | 3300047321 | Ga0495676_0048251 | Ga0495676_0048251_2051_2752 | 233 |
| 727 | 3300047445 | Ga0495677_0157428 | Ga0495677_0157428_50_751 | 233 |
| 728 | 3300047469 | Ga0495673_0044987 | Ga0495673_0044987_508_1209 | 233 |
| 729 | 3300048918 | Ga0496115_0124484 | Ga0496115_0124484_377_1111 | 233 |
| 730 | 3300049128 | Ga0501308_003257 | Ga0501308_003257_740_1444 | 233 |
| 731 | 3300049162 | Ga0501307_024941 | Ga0501307_024941_13_717 | 233 |
| 732 | 3300049535 | Ga0501319_010878 | Ga0501319_010878_11_715 | 233 |
| 733 | 3300049536 | Ga0501320_011576 | Ga0501320_011576_198_902 | 233 |
| 734 | 3300049541 | Ga0501325_003764 | Ga0501325_003764_400_1101 | 233 |
| 735 | 3300049571 | Ga0501034_0178519 | Ga0501034_0178519_282_992 | 233 |
| 736 | 3300049649 | Ga0501198_000058 | Ga0501198_000058_13672_14373 | 233 |
| 737 | 3300049662 | Ga0501222_000066 | Ga0501222_000066_13813_14514 | 233 |
| 738 | 3300049679 | Ga0501249_010174 | Ga0501249_010174_1101_1802 | 233 |
| 739 | 3300049763 | Ga0501266_000629 | Ga0501266_000629_3180_3884 | 233 |
| 740 | 3300050489 | nmdc:mga03683_145738_c1 | nmdc:mga03683_145738_c1_190_921 | 233 |
| 741 | 3300050489 | nmdc:mga03683_52218_c1 | nmdc:mga03683_52218_c1_554_1255 | 233 |
| 742 | 3300050489 | nmdc:mga03683_58200_c1 | nmdc:mga03683_58200_c1_699_1421 | 233 |
| 743 | 3300050491 | nmdc:mga00v17_13946_c1 | nmdc:mga00v17_13946_c1_2900_3601 | 233 |
| 744 | 3300050492 | nmdc:mga0yw44_103235_c1 | nmdc:mga0yw44_103235_c1_1004_1708 | 233 |
| 745 | 3300050492 | nmdc:mga0yw44_22523_c1 | nmdc:mga0yw44_22523_c1_212_913 | 233 |
| 746 | 3300050492 | nmdc:mga0yw44_288738_c1 | nmdc:mga0yw44_288738_c1_383_1087 | 233 |
| 747 | 3300050493 | nmdc:mga0k408_25881_c1 | nmdc:mga0k408_25881_c1_2021_2743 | 233 |
| 748 | 3300050493 | nmdc:mga0k408_30193_c1 | nmdc:mga0k408_30193_c1_1741_2442 | 233 |
| 749 | 3300050496 | nmdc:mga07m45_153534_c1 | nmdc:mga07m45_153534_c1_106_807 | 233 |
| 750 | 3300050496 | nmdc:mga07m45_173563_c1 | nmdc:mga07m45_173563_c1_67_768 | 233 |
| 751 | 3300050508 | nmdc:mga09592_320479_c1 | nmdc:mga09592_320479_c1_613_1317 | 233 |
| 752 | 3300050510 | nmdc:mga06r32_111993_c1 | nmdc:mga06r32_111993_c1_1333_2037 | 233 |
| 753 | 3300050511 | nmdc:mga08y16_234476_c1 | nmdc:mga08y16_234476_c1_188_892 | 233 |
| 754 | 3300050511 | nmdc:mga08y16_505392_c1 | nmdc:mga08y16_505392_c1_489_1211 | 233 |
| 755 | 3300053093 | Ga0500651_0012255 | Ga0500651_0012255_570_1271 | 233 |
| 756 | 3300053096 | Ga0500641_0071149 | Ga0500641_0071149_418_1119 | 233 |
| 757 | 3300053117 | Ga0500593_000343 | Ga0500593_000343_7335_8036 | 233 |
| 758 | 3300053136 | Ga0500559_0001438 | Ga0500559_0001438_7422_8123 | 233 |
| 759 | 3300054114 | Ga0501084_0081031 | Ga0501084_0081031_583_1284 | 233 |
| 760 | 3300059421 | Ga0590071_010055 | Ga0590071_010055_539_1276 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9732 | 1 | 233 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9702 | 1 | 233 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9619 | 1 | 233 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9569 | 1 | 233 |
| 2b8m-assembly1.cif.gz_A-2 | crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution | 0.8885 | 39 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9868 | 11 | 135 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9847 | 13 | 131 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9787 | 11 | 135 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9686 | 13 | 131 | 2.60.120.10 |
| af_F1QLW3_37_119_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9588 | 40 | 120 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y1J1V3-F1-model_v4 | deleted | 0.9995 | 1 | 233 |
|
| AF-A0A0K8NZF1-F1-model_v4 | Pirin | 0.9983 | 1 | 233 |
GO:0046872
|
| AF-A0A258LRN3-F1-model_v4 | Quercetin 2,3-dioxygenase | 0.9976 | 52 | 233 |
GO:0046872
GO:0051213 |
| AF-A0A850QIQ9-F1-model_v4 | Pirin family protein | 0.9969 | 1 | 233 |
GO:0046872
|
| AF-A0A354XYT3-F1-model_v4 | Pirin N-terminal domain-containing protein | 0.9967 | 5 | 136 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar