F479545

General Info

Members Datasets Scaffolds Average Seq Length
760 437 738 234

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0101280|Ga0466963_0101280_608_1438
Length 276
Sequence LRPIHWDAKRSDEAQLSRVDGEMLLLAMHRPCDNAESKAGDDAMITLRRSQERGYADHGWLRSFHSFSFAGYYDPAHMGWGNLRVINEDRIAPGAGFGKHGHRDMEIISYVLEGELAHQDSMGNVKGIPPGDVQRMSAGTGVVHSEFNHAKGETTHFLQIWIEPNVTGIAPSYEQKTIPADDKRGKLRLVASTDGRQGSVTIHADANVYAGLFDGAETAHIALDPRRKGYVHLIRGSLDVNGRSLAAGDAALLEDESSITLSNGKDAEALVFDLAA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221558 Rhizobium sp. Root149 Isolate Unclassified
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221596 Acidovorax sp. Root70 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2643221717 Acidovorax sp. Root267 Isolate Unclassified
11 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
12 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
13 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
14 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
15 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
16 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
17 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
18 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
19 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
20 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
31 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
87 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
95 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
96 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
118 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
185 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
247 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
259 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
263 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
264 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
265 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
269 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
274 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
277 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
290 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
291 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
307 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
308 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
309 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
310 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
311 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
325 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
326 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
327 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
335 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
342 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
354 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
364 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
365 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
366 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
380 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
394 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
395 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
396 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
397 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
398 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
399 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
400 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
404 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
405 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
406 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
409 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
410 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
418 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
424 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
425 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
426 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
427 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
428 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
429 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
430 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
437 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0.79
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.47
Nodule 0.53
Rhizoplane 1.97
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000008 3300002704 Bacteria 236146
2 JGI25156J39149_1000002 3300002705 Bacteria 343501
3 JGI25154J39366_1000010 3300002738 Bacteria 297985
4 JGI25157J39369_1000001 3300002741 Bacteria 363277
5 JGI25150J39212_1028518 3300002774 Bacteria 790
6 JGI25159J45721_1001868 3300002987 Bacteria 8416
7 JGI25159J45721_1002408 3300002987 Bacteria 7114
8 JGI25151J46595_10003749 3300003187 Bacteria 8250
9 JGI25151J46595_10004501 3300003187 Bacteria 7364
10 rootL2_10142603 3300003322 Bacteria 6473
11 JGI26128J50194_1001075 3300003347 Bacteria 1683
12 JGI25160J50197_1000342 3300003354 Bacteria 31433
13 JGI25160J50197_1016285 3300003354 Bacteria 2401
14 JGI25161J50226_1000259 3300003374 Bacteria 31433
15 Ga0055538_1000019 3300003751 Bacteria 282365
16 Ga0055539_1000024 3300003752 Bacteria 282365
17 Ga0055533_1000032 3300003756 Bacteria 282365
18 Ga0055525_1000041 3300003759 Bacteria 282365
19 Ga0055526_1001483 3300003771 Bacteria 16653
20 Ga0055526_1003973 3300003771 Bacteria 9110
21 Ga0055537_1000102 3300003773 Bacteria 63809
22 Ga0055537_1005851 3300003773 Bacteria 3219
23 Ga0055524_1000093 3300003775 Bacteria 111953
24 Ga0055524_1000606 3300003775 Bacteria 25747
25 Ga0055536_1006611 3300003781 Bacteria 5351
26 Ga0055534_1001043 3300003784 Bacteria 12113
27 Ga0055534_1002793 3300003784 Bacteria 5830
28 Ga0055528_1000696 3300003790 Bacteria 23933
29 Ga0055530_10000891 3300003791 Bacteria 24561
30 Ga0055540_1000089 3300003792 Bacteria 100214
31 Ga0055540_1000196 3300003792 Bacteria 58476
32 Ga0055531_10004653 3300003794 Bacteria 8237
33 Ga0055541_1000018 3300003841 Bacteria 282365
34 Ga0055543_1000527 3300004625 Bacteria 21646
35 Ga0065165_1004504 3300005262 Bacteria 8562
36 Ga0065165_1005633 3300005262 Bacteria 6928
37 Ga0065165_1006014 3300005262 Bacteria 6540
38 Ga0065714_10028103 3300005288 Bacteria 1035
39 Ga0065714_10076714 3300005288 Bacteria 2762
40 Ga0065715_10000585 3300005293 Bacteria 14517
41 Ga0070658_10006296 3300005327 Bacteria 9614
42 Ga0070658_10063873 3300005327 Bacteria 3002
43 Ga0070658_10485685 3300005327 Bacteria 1066
44 Ga0070683_100013440 3300005329 Bacteria 7140
45 Ga0070683_100119856 3300005329 Bacteria 2485
46 Ga0070690_100018254 3300005330 Bacteria 4234
47 Ga0070670_100003183 3300005331 Bacteria 13549
48 Ga0070670_100015364 3300005331 Bacteria 6574
49 Ga0070670_100050796 3300005331 Bacteria 3563
50 Ga0070677_10068946 3300005333 Bacteria 1482
51 Ga0068869_100000205 3300005334 Bacteria 30762
52 Ga0068869_100100872 3300005334 Bacteria 2183
53 Ga0068869_100297452 3300005334 Bacteria 1302
54 Ga0070666_10001671 3300005335 Bacteria 13535
55 Ga0070680_100004745 3300005336 Bacteria 10233
56 Ga0070680_100026210 3300005336 Bacteria 4662
57 Ga0070682_100000180 3300005337 Bacteria 47178
58 Ga0068868_100213446 3300005338 Bacteria 1614
59 Ga0070660_100000321 3300005339 Bacteria 31730
60 Ga0070660_100025968 3300005339 Bacteria 4358
61 Ga0070660_100113763 3300005339 Bacteria 2155
62 Ga0070660_100732330 3300005339 Bacteria 830
63 Ga0070689_100366130 3300005340 Bacteria 1212
64 Ga0070691_10075486 3300005341 Bacteria 1642
65 Ga0070687_100112234 3300005343 Bacteria 1545
66 Ga0070661_100005929 3300005344 Bacteria 8413
67 Ga0070661_100057362 3300005344 Bacteria 2854
68 Ga0070661_100203509 3300005344 Bacteria 1513
69 Ga0070661_100600764 3300005344 Bacteria 889
70 Ga0070692_10002301 3300005345 Bacteria 7355
71 Ga0070668_100007445 3300005347 Bacteria 8122
72 Ga0070669_100148852 3300005353 Bacteria 1811
73 Ga0070675_100008402 3300005354 Bacteria 8010
74 Ga0070675_100269821 3300005354 Bacteria 1493
75 Ga0070675_100615831 3300005354 Bacteria 985
76 Ga0070671_100002283 3300005355 Bacteria 14795
77 Ga0070671_100100449 3300005355 Bacteria 2427
78 Ga0070674_100001737 3300005356 Bacteria 11801
79 Ga0070673_100000414 3300005364 Bacteria 22528
80 Ga0070673_100006199 3300005364 Bacteria 7757
81 Ga0070688_100043076 3300005365 Bacteria 2779
82 Ga0070659_100000881 3300005366 Bacteria 21948
83 Ga0070659_100007664 3300005366 Bacteria 7850
84 Ga0070667_100022534 3300005367 Bacteria 5222
85 Ga0070667_100074164 3300005367 Bacteria 2902
86 Ga0070667_100243904 3300005367 Bacteria 1605
87 Ga0070703_10001102 3300005406 Bacteria 8382
88 Ga0070709_10006612 3300005434 Bacteria 6325
89 Ga0070709_10318978 3300005434 Bacteria 1140
90 Ga0070714_100067425 3300005435 Bacteria 3085
91 Ga0070710_10026855 3300005437 Bacteria 3065
92 Ga0070710_10381774 3300005437 Bacteria 940
93 Ga0070711_100012774 3300005439 Bacteria 5256
94 Ga0070711_100138301 3300005439 Bacteria 1823
95 Ga0070705_100000078 3300005440 Bacteria 53383
96 Ga0070694_100001715 3300005444 Bacteria 12918
97 Ga0070663_100003555 3300005455 Bacteria 9001
98 Ga0070663_100036402 3300005455 Bacteria 3420
99 Ga0070663_100045392 3300005455 Bacteria 3104
100 Ga0070663_100056080 3300005455 Bacteria 2822
101 Ga0070678_100004553 3300005456 Bacteria 7874
102 Ga0070678_100016630 3300005456 Bacteria 4712
103 Ga0070662_100001051 3300005457 Bacteria 16865
104 Ga0070662_100062976 3300005457 Bacteria 2712
105 Ga0070681_10003260 3300005458 Bacteria 15135
106 Ga0070681_10006915 3300005458 Bacteria 11043
107 Ga0070681_10054456 3300005458 Bacteria 3986
108 Ga0070681_10612792 3300005458 Bacteria 1003
109 Ga0068867_100000642 3300005459 Bacteria 23127
110 Ga0068867_100004322 3300005459 Bacteria 10002
111 Ga0068867_100111808 3300005459 Bacteria 2099
112 Ga0068867_100149513 3300005459 Bacteria 1833
113 Ga0070706_100097493 3300005467 Bacteria 2731
114 Ga0070706_100583745 3300005467 Bacteria 1039
115 Ga0070706_100899436 3300005467 Bacteria 818
116 Ga0070707_100407961 3300005468 Bacteria 1319
117 Ga0070699_100100198 3300005518 Bacteria 2539
118 Ga0070699_100221582 3300005518 Bacteria 1686
119 Ga0070679_100000702 3300005530 Bacteria 28706
120 Ga0070679_100024228 3300005530 Bacteria 5947
121 Ga0070684_100001566 3300005535 Bacteria 16508
122 Ga0070697_100093457 3300005536 Bacteria 2490
123 Ga0068853_100000255 3300005539 Bacteria 37353
124 Ga0068853_100005722 3300005539 Bacteria 9783
125 Ga0068853_100012208 3300005539 Bacteria 6986
126 Ga0068853_100181494 3300005539 Bacteria 1909
127 Ga0068853_100610168 3300005539 Bacteria 1037
128 Ga0070672_100006664 3300005543 Bacteria 7779
129 Ga0070672_100013507 3300005543 Bacteria 5772
130 Ga0070672_100111344 3300005543 Bacteria 2232
131 Ga0070695_100001050 3300005545 Bacteria 15103
132 Ga0070695_100001834 3300005545 Bacteria 11980
133 Ga0070696_100034665 3300005546 Bacteria 3473
134 Ga0070693_100000163 3300005547 Bacteria 30819
135 Ga0070693_100000754 3300005547 Bacteria 14323
136 Ga0070693_100027690 3300005547 Bacteria 3074
137 Ga0070665_100001831 3300005548 Bacteria 24144
138 Ga0070665_100024636 3300005548 Bacteria 6063
139 Ga0070704_100008672 3300005549 Bacteria 6112
140 Ga0068855_100003137 3300005563 Bacteria 20214
141 Ga0068855_100004144 3300005563 Bacteria 17691
142 Ga0068855_100054072 3300005563 Bacteria 4721
143 Ga0068855_100203970 3300005563 Bacteria 2225
144 Ga0070664_100006434 3300005564 Bacteria 9476
145 Ga0070664_100008022 3300005564 Bacteria 8529
146 Ga0068857_100040360 3300005577 Bacteria 4138
147 Ga0068854_100000709 3300005578 Bacteria 19745
148 Ga0068854_100003114 3300005578 Bacteria 10320
149 Ga0068854_100011172 3300005578 Bacteria 5833
150 Ga0068854_100203609 3300005578 Bacteria 1557
151 Ga0068856_100011686 3300005614 Bacteria 8516
152 Ga0068856_100018398 3300005614 Bacteria 6771
153 Ga0068856_100019664 3300005614 Bacteria 6555
154 Ga0068856_100394237 3300005614 Bacteria 1404
155 Ga0070702_100196285 3300005615 Bacteria 1332
156 Ga0068852_100003709 3300005616 Bacteria 10702
157 Ga0068852_100165800 3300005616 Bacteria 2067
158 Ga0068852_100181355 3300005616 Bacteria 1980
159 Ga0068859_100010878 3300005617 Bacteria 9156
160 Ga0068859_100032413 3300005617 Bacteria 5250
161 Ga0068859_100269160 3300005617 Bacteria 1796
162 Ga0068864_100009447 3300005618 Bacteria 8048
163 Ga0068864_100043522 3300005618 Bacteria 3845
164 Ga0068864_100158672 3300005618 Bacteria 2055
165 Ga0068864_100196521 3300005618 Bacteria 1851
166 Ga0068864_100859563 3300005618 Unclassified 894
167 Ga0068866_10002311 3300005718 Bacteria 7896
168 Ga0068861_100226500 3300005719 Bacteria 1583
169 Ga0068861_100818218 3300005719 Bacteria 876
170 Ga0068851_10000963 3300005834 Bacteria 12458
171 Ga0068851_10005511 3300005834 Bacteria 5736
172 Ga0068851_10030349 3300005834 Bacteria 2681
173 Ga0068851_10031907 3300005834 Bacteria 2619
174 Ga0068870_10000769 3300005840 Bacteria 12346
175 Ga0068870_10499007 3300005840 Bacteria 811
176 Ga0068863_100003538 3300005841 Bacteria 15417
177 Ga0068863_100034158 3300005841 Bacteria 4844
178 Ga0068863_100160162 3300005841 Bacteria 2156
179 Ga0068858_100006057 3300005842 Bacteria 11788
180 Ga0068860_100009497 3300005843 Bacteria 9659
181 Ga0068860_100017520 3300005843 Bacteria 6980
182 Ga0068860_100037793 3300005843 Bacteria 4620
183 Ga0068860_100051083 3300005843 Bacteria 3935
184 Ga0068862_100001036 3300005844 Bacteria 26683
185 Ga0068862_100098895 3300005844 Bacteria 2549
186 Ga0068862_100203779 3300005844 Bacteria 1785
187 Ga0081539_10051073 3300005985 Bacteria 2333
188 Ga0070716_100077917 3300006173 Bacteria 1969
189 Ga0070712_100049133 3300006175 Bacteria 2928
190 Ga0070712_100940678 3300006175 Bacteria 746
191 Ga0075362_10132739 3300006177 Bacteria 1185
192 Ga0075362_10154208 3300006177 Bacteria 1103
193 Ga0075367_10025914 3300006178 Bacteria 3319
194 Ga0075367_10049042 3300006178 Bacteria 2489
195 Ga0075367_10284136 3300006178 Bacteria 1040
196 Ga0075366_10003459 3300006195 Bacteria 8335
197 Ga0075366_10067100 3300006195 Bacteria 2134
198 Ga0075366_10085271 3300006195 Bacteria 1889
199 Ga0097621_100020664 3300006237 Bacteria 5077
200 Ga0075370_10000726 3300006353 Bacteria 13103
201 Ga0075370_10001753 3300006353 Bacteria 9669
202 Ga0075370_10079724 3300006353 Bacteria 1881
203 Ga0075370_10160842 3300006353 Bacteria 1318
204 Ga0075370_10168532 3300006353 Bacteria 1287
205 Ga0068871_100156297 3300006358 Bacteria 1947
206 Ga0068871_100428970 3300006358 Bacteria 1182
207 Ga0075428_100369594 3300006844 Bacteria 1538
208 Ga0075431_100344011 3300006847 Bacteria 1500
209 Ga0075434_100052781 3300006871 Bacteria 4040
210 Ga0075434_100505625 3300006871 Bacteria 1229
211 Ga0075429_100051315 3300006880 Bacteria 3589
212 Ga0068865_100032504 3300006881 Bacteria 3486
213 Ga0068865_100157495 3300006881 Bacteria 1729
214 Ga0075436_100052221 3300006914 Bacteria 2821
215 Ga0097620_100010879 3300006931 Bacteria 9156
216 Ga0097620_100032411 3300006931 Bacteria 5250
217 Ga0097620_100269178 3300006931 Bacteria 1796
218 Ga0079104_1000970 3300006946 Bacteria 22460
219 Ga0079104_1010113 3300006946 Bacteria 3135
220 Ga0075435_100007737 3300007076 Bacteria 7681
221 Ga0099794_10009804 3300007265 Bacteria 4044
222 Ga0099794_10015415 3300007265 Bacteria 3373
223 Ga0105240_10012204 3300009093 Bacteria 11882
224 Ga0105240_10092977 3300009093 Bacteria 3682
225 Ga0105240_10119142 3300009093 Bacteria 3180
226 Ga0105240_10211547 3300009093 Bacteria 2266
227 Ga0105240_10212393 3300009093 Bacteria 2260
228 Ga0105240_10269429 3300009093 Bacteria 1961
229 Ga0111539_10129855 3300009094 Bacteria 2951
230 Ga0105245_10016167 3300009098 Bacteria 6502
231 Ga0114129_10126434 3300009147 Bacteria 3514
232 Ga0105243_10198138 3300009148 Bacteria 1759
233 Ga0105241_10000415 3300009174 Bacteria 32268
234 Ga0105241_10000746 3300009174 Bacteria 24758
235 Ga0105241_10007582 3300009174 Bacteria 7978
236 Ga0105241_10060181 3300009174 Bacteria 2921
237 Ga0105241_10234661 3300009174 Bacteria 1548
238 Ga0105242_10028027 3300009176 Bacteria 4481
239 Ga0105242_10034642 3300009176 Bacteria 4048
240 Ga0105248_10106882 3300009177 Bacteria 3155
241 Ga0105248_10425935 3300009177 Bacteria 1495
242 Ga0105237_10014925 3300009545 Bacteria 8101
243 Ga0105249_11208747 3300009553 Bacteria 827
244 Ga0105239_10016788 3300010375 Bacteria 8092
245 Ga0105239_10059396 3300010375 Bacteria 4197
246 Ga0105246_10091377 3300011119 Bacteria 2194
247 Ga0105246_10619932 3300011119 Bacteria 937
248 Ga0157326_1007504 3300012513 Bacteria 1179
249 Ga0157373_10000755 3300013100 Bacteria 25102
250 Ga0157373_10005045 3300013100 Bacteria 9916
251 Ga0157373_10018416 3300013100 Bacteria 5084
252 Ga0157371_10007161 3300013102 Bacteria 9061
253 Ga0157371_10074673 3300013102 Bacteria 2401
254 Ga0157370_10022272 3300013104 Bacteria 6305
255 Ga0157370_10050451 3300013104 Bacteria 3977
256 Ga0157370_10068790 3300013104 Bacteria 3346
257 Ga0157370_10341411 3300013104 Bacteria 1380
258 Ga0157369_10027542 3300013105 Bacteria 6298
259 Ga0157369_10049289 3300013105 Bacteria 4567
260 Ga0157374_10000367 3300013296 Bacteria 41665
261 Ga0157374_10067000 3300013296 Bacteria 3374
262 Ga0157374_10149417 3300013296 Bacteria 2271
263 Ga0157372_10001139 3300013307 Bacteria 28905
264 Ga0157372_10005206 3300013307 Bacteria 13824
265 Ga0157372_10043686 3300013307 Bacteria 4963
266 Ga0157372_10049928 3300013307 Bacteria 4654
267 Ga0157372_10546428 3300013307 Bacteria 1350
268 Ga0157375_10000991 3300013308 Bacteria 24533
269 Ga0157375_10012239 3300013308 Bacteria 7607
270 Ga0157375_10777640 3300013308 Unclassified 1107
271 Ga0163163_10000659 3300014325 Bacteria 29554
272 Ga0163163_10060644 3300014325 Bacteria 3747
273 Ga0163163_10078882 3300014325 Bacteria 3290
274 Ga0157380_10097288 3300014326 Bacteria 2442
275 Ga0157377_10000052 3300014745 Bacteria 89846
276 Ga0157377_10106124 3300014745 Bacteria 1682
277 Ga0157377_10512206 3300014745 Bacteria 841
278 Ga0157379_10183473 3300014968 Bacteria 1890
279 Ga0157376_10002363 3300014969 Bacteria 12736
280 Ga0157376_10097581 3300014969 Bacteria 2560
281 Ga0182006_1001089 3300015261 Bacteria 17406
282 Ga0163161_10048022 3300017792 Bacteria 3082
283 Ga0206356_10080782 3300020070 Bacteria 1978
284 Ga0213872_10000016 3300021361 Bacteria 180524
285 Ga0213872_10004070 3300021361 Bacteria 7873
286 Ga0213872_10012552 3300021361 Bacteria 3984
287 Ga0213874_10003972 3300021377 Bacteria 3329
288 Ga0209435_100001 3300025206 Bacteria 1424171
289 Ga0209436_104299 3300025208 Bacteria 3545
290 Ga0209784_100009 3300025224 Bacteria 688031
291 Ga0209566_100007 3300025225 Bacteria 688031
292 Ga0209674_100018 3300025226 Bacteria 688031
293 Ga0209563_100020 3300025230 Bacteria 688031
294 Ga0207425_1003360 3300025245 Bacteria 5157
295 Ga0207425_1005687 3300025245 Bacteria 3517
296 Ga0209646_1000001 3300025246 Bacteria 3092932
297 Ga0209026_1000001 3300025250 Bacteria 1228671
298 Ga0209677_100010 3300025253 Bacteria 688031
299 Ga0209759_1000001 3300025256 Bacteria 2799452
300 Ga0209129_1013818 3300025258 Bacteria 1753
301 Ga0209129_1016874 3300025258 Bacteria 1451
302 Ga0209129_1035648 3300025258 Bacteria 808
303 Ga0209565_1000161 3300025263 Bacteria 90019
304 Ga0209565_1000884 3300025263 Bacteria 16415
305 Ga0209673_1000391 3300025273 Bacteria 78867
306 Ga0209673_1008723 3300025273 Bacteria 4481
307 Ga0209673_1057290 3300025273 Bacteria 993
308 Ga0209130_1000118 3300025284 Bacteria 129005
309 Ga0209130_1000359 3300025284 Bacteria 52040
310 Ga0209675_1000111 3300025291 Bacteria 114805
311 Ga0209675_1000495 3300025291 Bacteria 29537
312 Ga0209676_1000054 3300025292 Bacteria 365890
313 Ga0209676_1003774 3300025292 Bacteria 8977
314 Ga0209025_1001351 3300025294 Bacteria 32990
315 Ga0209025_1004481 3300025294 Bacteria 12099
316 Ga0209025_1006065 3300025294 Bacteria 9557
317 Ga0209564_1000610 3300025295 Bacteria 55376
318 Ga0209564_1000815 3300025295 Bacteria 42475
319 Ga0209564_1030948 3300025295 Bacteria 1647
320 Ga0209758_1006167 3300025297 Bacteria 8777
321 Ga0209050_1000066 3300025298 Bacteria 305458
322 Ga0209050_1001609 3300025298 Bacteria 23243
323 Ga0209256_1000003 3300025299 Bacteria 1661127
324 Ga0209256_1044726 3300025299 Bacteria 1104
325 Ga0207426_1000197 3300025302 Bacteria 146366
326 Ga0207426_1001157 3300025302 Bacteria 23696
327 Ga0209051_1000044 3300025303 Bacteria 305458
328 Ga0209257_1000082 3300025304 Bacteria 305458
329 Ga0207653_10003877 3300025885 Bacteria 4702
330 Ga0207682_10001173 3300025893 Bacteria 12153
331 Ga0207642_10019484 3300025899 Bacteria 2628
332 Ga0207680_10002438 3300025903 Bacteria 8673
333 Ga0207680_10118350 3300025903 Bacteria 1729
334 Ga0207685_10035540 3300025905 Bacteria 1819
335 Ga0207699_10113857 3300025906 Bacteria 1739
336 Ga0207645_10000170 3300025907 Bacteria 51882
337 Ga0207645_10001033 3300025907 Bacteria 22978
338 Ga0207645_10061863 3300025907 Bacteria 2391
339 Ga0207643_10000051 3300025908 Bacteria 77737
340 Ga0207643_10005125 3300025908 Bacteria 7011
341 Ga0207643_10040757 3300025908 Bacteria 2615
342 Ga0207705_10176135 3300025909 Bacteria 1612
343 Ga0207684_10032385 3300025910 Bacteria 4445
344 Ga0207684_10554503 3300025910 Bacteria 983
345 Ga0207684_10732066 3300025910 Bacteria 839
346 Ga0207654_10018395 3300025911 Bacteria 3665
347 Ga0207654_10030744 3300025911 Bacteria 2951
348 Ga0207654_10116764 3300025911 Bacteria 1669
349 Ga0207707_10000453 3300025912 Bacteria 42710
350 Ga0207707_10008794 3300025912 Bacteria 8763
351 Ga0207707_10011006 3300025912 Bacteria 7872
352 Ga0207707_10013892 3300025912 Bacteria 7021
353 Ga0207695_10010473 3300025913 Bacteria 11341
354 Ga0207695_10419225 3300025913 Bacteria 1223
355 Ga0207671_10021270 3300025914 Bacteria 4924
356 Ga0207693_10002513 3300025915 Bacteria 15951
357 Ga0207663_10011146 3300025916 Bacteria 4816
358 Ga0207663_10162626 3300025916 Bacteria 1578
359 Ga0207660_10000203 3300025917 Bacteria 38120
360 Ga0207660_10007462 3300025917 Bacteria 7074
361 Ga0207662_10056780 3300025918 Bacteria 2339
362 Ga0207657_10000148 3300025919 Bacteria 71376
363 Ga0207657_10000357 3300025919 Bacteria 48334
364 Ga0207657_10079515 3300025919 Bacteria 2758
365 Ga0207657_10116297 3300025919 Bacteria 2204
366 Ga0207649_10000678 3300025920 Bacteria 22629
367 Ga0207649_10012182 3300025920 Bacteria 4762
368 Ga0207649_10013098 3300025920 Bacteria 4624
369 Ga0207649_10066613 3300025920 Bacteria 2284
370 Ga0207649_10178766 3300025920 Bacteria 1484
371 Ga0207652_10000690 3300025921 Bacteria 32930
372 Ga0207652_10007190 3300025921 Bacteria 8983
373 Ga0207646_10605610 3300025922 Bacteria 983
374 Ga0207681_10546600 3300025923 Bacteria 953
375 Ga0207694_10019608 3300025924 Bacteria 5114
376 Ga0207694_10068899 3300025924 Bacteria 2764
377 Ga0207650_10064440 3300025925 Bacteria 2743
378 Ga0207650_10072818 3300025925 Bacteria 2586
379 Ga0207650_10168846 3300025925 Bacteria 1738
380 Ga0207659_10060367 3300025926 Bacteria 2729
381 Ga0207659_10259955 3300025926 Bacteria 1412
382 Ga0207687_10004230 3300025927 Bacteria 9595
383 Ga0207687_10300479 3300025927 Bacteria 1293
384 Ga0207690_10006825 3300025932 Bacteria 6769
385 Ga0207690_10076874 3300025932 Bacteria 2319
386 Ga0207690_10116822 3300025932 Bacteria 1930
387 Ga0207706_10022334 3300025933 Bacteria 5678
388 Ga0207686_10004948 3300025934 Bacteria 7171
389 Ga0207709_10073370 3300025935 Bacteria 2180
390 Ga0207669_10032621 3300025937 Bacteria 2927
391 Ga0207669_10170721 3300025937 Bacteria 1547
392 Ga0207669_10320671 3300025937 Bacteria 1186
393 Ga0207704_10102105 3300025938 Bacteria 1915
394 Ga0207665_10098428 3300025939 Bacteria 2038
395 Ga0207691_10000006 3300025940 Bacteria 161922
396 Ga0207691_10015193 3300025940 Bacteria 7325
397 Ga0207691_10123425 3300025940 Bacteria 2292
398 Ga0207691_10185420 3300025940 Bacteria 1817
399 Ga0207711_10402296 3300025941 Bacteria 1272
400 Ga0207689_10000296 3300025942 Bacteria 45380
401 Ga0207689_10305819 3300025942 Bacteria 1318
402 Ga0207661_10029191 3300025944 Bacteria 4233
403 Ga0207661_10067004 3300025944 Bacteria 2918
404 Ga0207661_10315535 3300025944 Bacteria 1404
405 Ga0207679_10000233 3300025945 Bacteria 42806
406 Ga0207679_10005432 3300025945 Bacteria 7982
407 Ga0207667_10001806 3300025949 Bacteria 26953
408 Ga0207667_10002455 3300025949 Bacteria 23178
409 Ga0207667_10040920 3300025949 Bacteria 4932
410 Ga0207667_10043513 3300025949 Bacteria 4765
411 Ga0207667_10163275 3300025949 Bacteria 2290
412 Ga0207667_10165462 3300025949 Bacteria 2274
413 Ga0207651_10026513 3300025960 Bacteria 3622
414 Ga0207651_10306489 3300025960 Bacteria 1322
415 Ga0207668_10013784 3300025972 Bacteria 4988
416 Ga0207640_10008493 3300025981 Bacteria 5706
417 Ga0207640_10017603 3300025981 Bacteria 4184
418 Ga0207658_10020008 3300025986 Bacteria 4632
419 Ga0207658_10352861 3300025986 Bacteria 1281
420 Ga0207703_10026631 3300026035 Bacteria 4553
421 Ga0207703_10064105 3300026035 Bacteria 3015
422 Ga0207703_10639942 3300026035 Bacteria 1008
423 Ga0207639_10001326 3300026041 Bacteria 16740
424 Ga0207639_10005406 3300026041 Bacteria 8640
425 Ga0207639_10337620 3300026041 Bacteria 1342
426 Ga0207678_10000214 3300026067 Bacteria 51419
427 Ga0207678_10003431 3300026067 Bacteria 14281
428 Ga0207678_10054639 3300026067 Bacteria 3440
429 Ga0207678_10103322 3300026067 Bacteria 2432
430 Ga0207678_10171130 3300026067 Bacteria 1854
431 Ga0207708_10339658 3300026075 Bacteria 1230
432 Ga0207702_10001254 3300026078 Bacteria 25608
433 Ga0207702_10018586 3300026078 Bacteria 5750
434 Ga0207702_10064868 3300026078 Bacteria 3126
435 Ga0207702_10643810 3300026078 Bacteria 1042
436 Ga0207702_10704946 3300026078 Bacteria 995
437 Ga0207641_10029865 3300026088 Bacteria 4509
438 Ga0207641_10164161 3300026088 Bacteria 2021
439 Ga0207641_10537997 3300026088 Bacteria 1138
440 Ga0207641_10745058 3300026088 Bacteria 967
441 Ga0207648_10001074 3300026089 Bacteria 30606
442 Ga0207648_10004394 3300026089 Bacteria 14487
443 Ga0207648_10016091 3300026089 Bacteria 6851
444 Ga0207648_10022282 3300026089 Bacteria 5691
445 Ga0207648_10171082 3300026089 Bacteria 1920
446 Ga0207648_10219500 3300026089 Bacteria 1689
447 Ga0207676_10002144 3300026095 Bacteria 14263
448 Ga0207676_10002162 3300026095 Bacteria 14186
449 Ga0207676_10123826 3300026095 Bacteria 2185
450 Ga0207676_10255471 3300026095 Bacteria 1579
451 Ga0207676_10735282 3300026095 Unclassified 958
452 Ga0207674_10000312 3300026116 Bacteria 61824
453 Ga0207674_10000836 3300026116 Bacteria 40167
454 Ga0207674_10050212 3300026116 Bacteria 4262
455 Ga0207674_10271124 3300026116 Bacteria 1645
456 Ga0207675_100179851 3300026118 Bacteria 2025
457 Ga0207675_100196626 3300026118 Bacteria 1935
458 Ga0207683_10000853 3300026121 Bacteria 27981
459 Ga0207683_10019137 3300026121 Bacteria 5844
460 Ga0207698_10000387 3300026142 Bacteria 25394
461 Ga0207698_10003568 3300026142 Bacteria 9386
462 Ga0207698_10051282 3300026142 Bacteria 3154
463 Ga0207698_10229165 3300026142 Bacteria 1685
464 Ga0209281_1000993 3300027111 Bacteria 22417
465 Ga0209996_1003277 3300027395 Bacteria 2028
466 Ga0209995_1005220 3300027471 Bacteria 2087
467 Ga0209968_1004026 3300027526 Bacteria 2206
468 Ga0209999_1014337 3300027543 Bacteria 1440
469 Ga0209970_1002103 3300027614 Bacteria 3415
470 Ga0209983_1005427 3300027665 Bacteria 2641
471 Ga0209588_1005062 3300027671 Bacteria 3755
472 Ga0209971_1047136 3300027682 Bacteria 1040
473 Ga0209966_1000006 3300027695 Bacteria 102095
474 Ga0209998_10004415 3300027717 Bacteria 2990
475 Ga0209974_10007390 3300027876 Bacteria 3786
476 Ga0207428_10083126 3300027907 Bacteria 2498
477 Ga0207428_10359126 3300027907 Bacteria 1071
478 Ga0268266_10006477 3300028379 Bacteria 10715
479 Ga0268266_10008840 3300028379 Bacteria 8919
480 Ga0268266_10442110 3300028379 Bacteria 1235
481 Ga0268265_10007291 3300028380 Bacteria 7469
482 Ga0268265_10198550 3300028380 Bacteria 1738
483 Ga0268265_10289484 3300028380 Bacteria 1470
484 Ga0268264_10003910 3300028381 Bacteria 12758
485 Ga0268264_10011656 3300028381 Bacteria 7250
486 Ga0268264_10194216 3300028381 Bacteria 1852
487 Ga0265337_1016980 3300028556 Bacteria 2342
488 Ga0265326_10009471 3300028558 Bacteria 2913
489 Ga0265323_10005281 3300028653 Bacteria 5490
490 Ga0265336_10031580 3300028666 Bacteria 1645
491 Ga0307515_10000028 3300028794 Bacteria 368467
492 Ga0307515_10002860 3300028794 Bacteria 36720
493 Ga0307515_10004730 3300028794 Bacteria 27885
494 Ga0307515_10114546 3300028794 Bacteria 3115
495 Ga0265338_10036401 3300028800 Bacteria 4711
496 Ga0265330_10001807 3300031235 Bacteria 12007
497 Ga0265330_10053113 3300031235 Bacteria 1774
498 Ga0265332_10000003 3300031238 Bacteria 482849
499 Ga0265332_10006958 3300031238 Bacteria 5124
500 Ga0265340_10010296 3300031247 Bacteria 5003
501 Ga0307513_10000017 3300031456 Bacteria 282386
502 Ga0307513_10000021 3300031456 Bacteria 228078
503 Ga0307513_10012920 3300031456 Bacteria 10270
504 Ga0307513_10020368 3300031456 Bacteria 7869
505 Ga0307513_10094414 3300031456 Bacteria 3036
506 Ga0307513_10358370 3300031456 Bacteria 1204
507 Ga0307509_10001516 3300031507 Bacteria 39162
508 Ga0307509_10233057 3300031507 Bacteria 1642
509 Ga0307508_10006236 3300031616 Bacteria 11235
510 Ga0307514_10000225 3300031649 Bacteria 151002
511 Ga0265314_10000008 3300031711 Bacteria 485166
512 Ga0265314_10003341 3300031711 Bacteria 15622
513 Ga0265342_10004246 3300031712 Bacteria 11353
514 Ga0307516_10000386 3300031730 Bacteria 57562
515 Ga0307516_10158118 3300031730 Bacteria 2019
516 Ga0307413_10175796 3300031824 Bacteria 1521
517 Ga0307410_10489998 3300031852 Bacteria 1010
518 Ga0307406_10027094 3300031901 Bacteria 3449
519 Ga0307411_10266996 3300032005 Bacteria 1355
520 Ga0307507_10124333 3300033179 Bacteria 2049
521 Ga0307510_10001034 3300033180 Bacteria 29497
522 Ga0373936_0030132 3300035113 Bacteria 2140
523 Ga0373939_0026096 3300035114 Bacteria 1644
524 Ga0373941_0033512 3300035115 Bacteria 1544
525 Ga0373945_0020619 3300035116 Bacteria 2258
526 Ga0373954_0001721 3300035118 Bacteria 8959
527 Ga0373960_0039518 3300035121 Bacteria 1357
528 Ga0373943_0016261 3300035170 Bacteria 3390
529 Ga0373946_0008118 3300035171 Bacteria 3855
530 Ga0373946_0257646 3300035171 Bacteria 853
531 Ga0373961_0039552 3300035241 Bacteria 1355
532 Ga0316574_0097230 3300035398 Bacteria 1882
533 Ga0373931_0336288 3300035691 Bacteria 942
534 Ga0373931_0509948 3300035691 Bacteria 777
535 Ga0373935_0229368 3300035692 Bacteria 1292
536 Ga0373933_0095271 3300035724 Bacteria 1841
537 Ga0373937_0008585 3300036401 Bacteria 8873
538 Ga0373937_0057721 3300036401 Bacteria 3566
539 Ga0373937_0120460 3300036401 Bacteria 2445
540 Ga0373925_0000590 3300037068 Bacteria 34985
541 Ga0373925_0084873 3300037068 Bacteria 2413
542 Ga0395899_0090357 3300037312 Bacteria 2220
543 Ga0395899_0107827 3300037312 Bacteria 2004
544 Ga0395900_0144518 3300037418 Bacteria 2433
545 Ga0395900_0166167 3300037418 Bacteria 2249
546 Ga0395900_0284319 3300037418 Bacteria 1645
547 Ga0395905_0006594 3300037471 Bacteria 11649
548 Ga0395905_0077695 3300037471 Bacteria 3110
549 Ga0395905_0164659 3300037471 Bacteria 2083
550 Ga0395905_0277013 3300037471 Bacteria 1563
551 Ga0395901_0156880 3300038443 Bacteria 2390
552 Ga0395901_0328300 3300038443 Bacteria 1582
553 Ga0436365_1078319 3300039437 Bacteria 2057
554 Ga0436361_0181224 3300039447 Bacteria 8489
555 Ga0436361_0376061 3300039447 Bacteria 200571
556 Ga0436361_0902439 3300039447 Bacteria 94295
557 Ga0436363_1718963 3300039450 Bacteria 12069
558 Ga0451789_1034659 3300041443 Bacteria 1119
559 Ga0451800_1561068 3300041459 Bacteria 1848
560 Ga0451807_1197568 3300041486 Bacteria 882
561 Ga0439455_0100503 3300042012 Bacteria 799
562 Ga0439459_0000390 3300042438 Bacteria 5486
563 Ga0450918_000032 3300042531 Bacteria 28506
564 Ga0451577_0007371 3300042876 Bacteria 10799
565 Ga0451577_0021405 3300042876 Bacteria 5918
566 Ga0451577_0074187 3300042876 Bacteria 3035
567 Ga0451577_0165977 3300042876 Bacteria 1989
568 Ga0451577_0193695 3300042876 Bacteria 1834
569 Ga0451577_0263812 3300042876 Bacteria 1560
570 Ga0453683_0141637 3300044673 Bacteria 1518
571 Ga0466963_0101280 3300044694 Bacteria 1972
572 Ga0466963_0199946 3300044694 Bacteria 1398
573 Ga0453684_0039271 3300044712 Bacteria 6453
574 Ga0453684_0082776 3300044712 Bacteria 3996
575 Ga0453684_0358473 3300044712 Bacteria 1642
576 Ga0466960_0045148 3300044901 Bacteria 2103
577 Ga0466960_0083844 3300044901 Bacteria 1612
578 Ga0466959_0019220 3300045049 Bacteria 5023
579 Ga0451576_0017398 3300045051 Bacteria 7904
580 Ga0451576_0028309 3300045051 Bacteria 6004
581 Ga0451576_0038659 3300045051 Bacteria 5050
582 Ga0451576_0526943 3300045051 Bacteria 1241
583 Ga0495629_0020987 3300046459 Bacteria 4662
584 Ga0495629_0259162 3300046459 Bacteria 1195
585 Ga0495651_0122525 3300046462 Bacteria 1908
586 Ga0495653_0028328 3300046463 Bacteria 4479
587 Ga0495653_0166984 3300046463 Bacteria 1522
588 Ga0495580_0037203 3300046472 Bacteria 3494
589 Ga0495580_0042110 3300046472 Bacteria 3255
590 Ga0495580_0155371 3300046472 Bacteria 1584
591 Ga0495639_0011279 3300046475 Bacteria 3850
592 Ga0495639_0135150 3300046475 Bacteria 1183
593 Ga0495664_0298182 3300046477 Bacteria 973
594 Ga0495585_0000221 3300046492 Bacteria 59316
595 Ga0495594_0008790 3300046499 Bacteria 5208
596 Ga0495596_0002792 3300046500 Bacteria 9151
597 Ga0495583_0000423 3300046506 Bacteria 63964
598 Ga0495583_0012616 3300046506 Bacteria 4769
599 Ga0495583_0096010 3300046506 Bacteria 1270
600 Ga0495606_0043881 3300046507 Bacteria 2977
601 Ga0495608_0020687 3300046511 Bacteria 4521
602 Ga0495628_0142105 3300046516 Bacteria 1832
603 Ga0495631_0001877 3300046518 Bacteria 12390
604 Ga0495643_0005705 3300046522 Bacteria 8335
605 Ga0495643_0010037 3300046522 Bacteria 5843
606 Ga0495644_0000126 3300046523 Bacteria 36677
607 Ga0495663_0007041 3300046525 Bacteria 3105
608 Ga0495642_0009846 3300046528 Bacteria 3661
609 Ga0495665_0026312 3300046531 Bacteria 3124
610 Ga0495640_0227531 3300046533 Bacteria 1174
611 Ga0495586_0036380 3300046535 Bacteria 2643
612 Ga0495609_0012392 3300046538 Bacteria 4044
613 Ga0495621_0022745 3300046539 Bacteria 2081
614 Ga0495621_0033099 3300046539 Bacteria 1780
615 Ga0495597_0019148 3300046542 Bacteria 3206
616 Ga0495622_0133718 3300046557 Bacteria 1128
617 Ga0495667_0045705 3300046559 Bacteria 2898
618 Ga0495656_0146225 3300046615 Bacteria 1138
619 Ga0495625_0198158 3300046660 Bacteria 1327
620 Ga0495635_0021814 3300046663 Bacteria 4463
621 Ga0495635_0283366 3300046663 Bacteria 1113
622 Ga0495661_0056627 3300046665 Bacteria 2344
623 Ga0495657_0207846 3300046675 Bacteria 1191
624 Ga0495647_0007674 3300046681 Bacteria 3623
625 Ga0495658_0013030 3300046683 Bacteria 4226
626 Ga0495613_0030943 3300046689 Bacteria 3975
627 Ga0495670_0199514 3300046691 Bacteria 1059
628 Ga0495589_0065104 3300046794 Bacteria 1787
629 Ga0495600_0133460 3300046809 Bacteria 1613
630 Ga0495581_0002485 3300047315 Bacteria 10441
631 Ga0495604_0173342 3300047317 Bacteria 1515
632 Ga0495636_0009263 3300047318 Bacteria 3876
633 Ga0495636_0059269 3300047318 Bacteria 1615
634 Ga0495676_0048251 3300047321 Bacteria 3435
635 Ga0495680_0026364 3300047322 Bacteria 4792
636 Ga0495687_012369 3300047443 Bacteria 4517
637 Ga0495677_0157428 3300047445 Bacteria 876
638 Ga0495685_001412 3300047447 Bacteria 7340
639 Ga0495673_0044987 3300047469 Bacteria 1965
640 Ga0495684_0043266 3300047471 Bacteria 3448
641 Ga0495684_0081087 3300047471 Bacteria 2462
642 Ga0495686_0000159 3300047472 Bacteria 129374
643 Ga0495602_0011216 3300048088 Bacteria 9267
644 Ga0496102_0061118 3300048905 Bacteria 3447
645 Ga0496102_0165727 3300048905 Bacteria 2079
646 Ga0496102_0194392 3300048905 Bacteria 1912
647 Ga0496104_0388826 3300048907 Bacteria 1307
648 Ga0496104_0529421 3300048907 Bacteria 1089
649 Ga0496106_0018631 3300048909 Bacteria 5138
650 Ga0496107_0463492 3300048910 Bacteria 941
651 Ga0496109_0070025 3300048912 Bacteria 3218
652 Ga0496110_0075929 3300048913 Bacteria 2987
653 Ga0496112_0110109 3300048915 Bacteria 2724
654 Ga0496114_0048179 3300048917 Bacteria 3545
655 Ga0496115_0124484 3300048918 Bacteria 2123
656 Ga0501308_003257 3300049128 Bacteria 1494
657 Ga0501307_024941 3300049162 Bacteria 800
658 Ga0495682_0001373 3300049460 Bacteria 13326
659 Ga0501319_010878 3300049535 Bacteria 729
660 Ga0501320_011576 3300049536 Bacteria 916
661 Ga0501325_003764 3300049541 Bacteria 1125
662 Ga0501032_0186741 3300049569 Bacteria 1356
663 Ga0501034_0000188 3300049571 Bacteria 115935
664 Ga0501034_0101726 3300049571 Bacteria 2867
665 Ga0501034_0178519 3300049571 Bacteria 2089
666 Ga0501036_0038713 3300049572 Bacteria 4036
667 Ga0501037_0110141 3300049573 Bacteria 1984
668 Ga0501040_0002233 3300049576 Bacteria 12477
669 Ga0501046_0214432 3300049580 Bacteria 1428
670 Ga0501047_0129578 3300049581 Bacteria 2403
671 Ga0501047_0185572 3300049581 Bacteria 1945
672 Ga0501048_0039419 3300049582 Bacteria 3389
673 Ga0501048_0093669 3300049582 Bacteria 2119
674 Ga0501069_0343462 3300049585 Bacteria 879
675 Ga0501071_0043530 3300049587 Bacteria 3219
676 Ga0501072_0006430 3300049588 Bacteria 8953
677 Ga0501072_0128287 3300049588 Bacteria 2021
678 Ga0501073_0407773 3300049589 Bacteria 939
679 Ga0501074_0044204 3300049590 Bacteria 3225
680 Ga0501075_0000739 3300049591 Bacteria 20297
681 Ga0501075_0009894 3300049591 Bacteria 6683
682 Ga0501075_0403638 3300049591 Bacteria 1042
683 Ga0501076_0001064 3300049592 Bacteria 18031
684 Ga0501198_000058 3300049649 Bacteria 31939
685 Ga0501222_000066 3300049662 Bacteria 32105
686 Ga0501249_010174 3300049679 Bacteria 1964
687 Ga0501079_0040293 3300049741 Bacteria 3602
688 Ga0501080_0002824 3300049742 Bacteria 15268
689 Ga0501081_0001893 3300049743 Bacteria 12994
690 Ga0501081_0310317 3300049743 Bacteria 1158
691 Ga0501266_000629 3300049763 Bacteria 4593
692 Ga0501045_0016289 3300049824 Bacteria 5278
693 Ga0501045_0021163 3300049824 Bacteria 4650
694 nmdc:mga03683_145738_c1 3300050489 Bacteria 1066
695 nmdc:mga03683_52218_c1 3300050489 Bacteria 1708
696 nmdc:mga03683_58200_c1 3300050489 Bacteria 1628
697 nmdc:mga00v17_13946_c1 3300050491 Bacteria 4473
698 nmdc:mga0yw44_103235_c1 3300050492 Bacteria 1818
699 nmdc:mga0yw44_22523_c1 3300050492 Bacteria 3535
700 nmdc:mga0yw44_288738_c1 3300050492 Bacteria 1097
701 nmdc:mga0k408_18775_c1 3300050493 Bacteria 3861
702 nmdc:mga0k408_25881_c1 3300050493 Bacteria 3325
703 nmdc:mga0k408_29098_c1 3300050493 Bacteria 3143
704 nmdc:mga0k408_30193_c1 3300050493 Bacteria 3089
705 nmdc:mga06z11_175211_c1 3300050494 Bacteria 1234
706 nmdc:mga07m45_1123_c1 3300050496 Bacteria 12008
707 nmdc:mga07m45_153534_c1 3300050496 Bacteria 1335
708 nmdc:mga07m45_173563_c1 3300050496 Bacteria 1253
709 nmdc:mga07m45_570_c1 3300050496 Bacteria 15667
710 nmdc:mga05p37_148368_c1 3300050507 Bacteria 2870
711 nmdc:mga05p37_293961_c1 3300050507 Bacteria 1933
712 nmdc:mga09592_320479_c1 3300050508 Bacteria 1343
713 nmdc:mga06r32_111993_c1 3300050510 Bacteria 2686
714 nmdc:mga08y16_103046_c1 3300050511 Bacteria 2971
715 nmdc:mga08y16_234476_c1 3300050511 Bacteria 1898
716 nmdc:mga08y16_505392_c1 3300050511 Bacteria 1227
717 nmdc:mga0n895_793723_c1 3300050512 Bacteria 938
718 nmdc:mga0a205_20483_c1 3300050515 Bacteria 6241
719 Ga0495595_0072978 3300053084 Bacteria 1625
720 Ga0495595_0196376 3300053084 Bacteria 1004
721 Ga0495619_0005573 3300053085 Bacteria 7984
722 Ga0500644_0001943 3300053088 Bacteria 5277
723 Ga0500651_0012255 3300053093 Bacteria 5198
724 Ga0500641_0071149 3300053096 Bacteria 1464
725 Ga0500572_026875 3300053111 Bacteria 1572
726 Ga0500593_000343 3300053117 Bacteria 18732
727 Ga0500595_000293 3300053119 Bacteria 32908
728 Ga0500607_073737 3300053121 Bacteria 1756
729 Ga0500608_079507 3300053122 Bacteria 1549
730 Ga0500614_001975 3300053123 Bacteria 4702
731 Ga0500559_0001438 3300053136 Bacteria 13507
732 Ga0500559_0005250 3300053136 Bacteria 5972
733 Ga0500619_012431 3300053154 Bacteria 2225
734 Ga0500645_000214 3300053730 Bacteria 44143
735 Ga0501084_0081031 3300054114 Bacteria 2722
736 Ga0590071_010055 3300059421 Bacteria 2215
737 Ga0501082_0002239 3300060353 Bacteria 16916
738 Ga0530510_0000539 3300061734 Bacteria 24276

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0214432 Ga0501046_0214432_400_1050 214
2 3300044712 Ga0453684_0039271 Ga0453684_0039271_299_1021 222
3 3300021361 Ga0213872_10004070 Ga0213872_100040704 223
4 3300039447 Ga0436361_0902439 Ga0436361_0902439_86921_87625 223
5 iso_pu_bacteria 8018150411 8018154877 226
6 3300005288 Ga0065714_10076714 Ga0065714_100767142 228
7 3300005293 Ga0065715_10000585 Ga0065715_100005857 228
8 3300005365 Ga0070688_100043076 Ga0070688_1000430763 228
9 3300005617 Ga0068859_100032413 Ga0068859_1000324135 228
10 3300005618 Ga0068864_100196521 Ga0068864_1001965213 228
11 3300006931 Ga0097620_100032411 Ga0097620_1000324113 228
12 3300014326 Ga0157380_10097288 Ga0157380_100972883 228
13 3300014745 Ga0157377_10512206 Ga0157377_105122062 228
14 3300046506 Ga0495583_0012616 Ga0495583_0012616_2609_3310 228
15 3300046691 Ga0495670_0199514 Ga0495670_0199514_76_777 228
16 3300047318 Ga0495636_0009263 Ga0495636_0009263_1609_2310 228
17 3300048905 Ga0496102_0061118 Ga0496102_0061118_50_751 228
18 3300049569 Ga0501032_0186741 Ga0501032_0186741_600_1292 228
19 3300049571 Ga0501034_0101726 Ga0501034_0101726_465_1157 228
20 3300049581 Ga0501047_0129578 Ga0501047_0129578_1209_1901 228
21 3300049582 Ga0501048_0093669 Ga0501048_0093669_1066_1758 228
22 3300049585 Ga0501069_0343462 Ga0501069_0343462_72_764 228
23 iso_pu_bacteria 2588253510 2588294976 228
24 iso_pu_bacteria 2643221558 2643813986 228
25 iso_pu_bacteria 2904584206 2904585370 228
26 iso_pu_bacteria 2904589729 2904593719 228
27 iso_pu_bacteria 2904601388 2904604135 228
28 iso_pu_bacteria 2919079590 2919081637 228
29 iso_pu_bacteria 8005658619 8005661959 228
30 iso_pu_bacteria 2511231002 2511246216 229
31 iso_pu_bacteria 2547132374 2548497304 229
32 iso_pu_bacteria 2643221570 2643865689 229
33 iso_pu_bacteria 2643221596 2643992983 229
34 iso_pu_bacteria 2643221644 2644246065 229
35 iso_pu_bacteria 2643221652 2644294433 229
36 iso_pu_bacteria 2643221660 2644338978 229
37 iso_pu_bacteria 2643221717 2644647631 229
38 iso_pu_bacteria 2842718218 2842719179 229
39 iso_pu_bacteria 2894023352 2894025685 229
40 iso_pu_bacteria 2919704043 2919704447 229
41 iso_pu_bacteria 2974320154 2974323678 229
42 iso_pu_bacteria 2990710928 2990712594 229
43 3300005343 Ga0070687_100112234 Ga0070687_1001122341 230
44 3300005353 Ga0070669_100148852 Ga0070669_1001488523 230
45 3300005618 Ga0068864_100859563 Ga0068864_1008595632 230
46 3300006844 Ga0075428_100369594 Ga0075428_1003695942 230
47 3300009174 Ga0105241_10234661 Ga0105241_102346612 230
48 3300009553 Ga0105249_11208747 Ga0105249_112087471 230
49 3300013308 Ga0157375_10777640 Ga0157375_107776402 230
50 3300025918 Ga0207662_10056780 Ga0207662_100567803 230
51 3300025923 Ga0207681_10546600 Ga0207681_105466001 230
52 3300026035 Ga0207703_10064105 Ga0207703_100641052 230
53 3300026095 Ga0207676_10735282 Ga0207676_107352822 230
54 3300028379 Ga0268266_10442110 Ga0268266_104421102 230
55 3300035114 Ga0373939_0026096 Ga0373939_0026096_282_992 230
56 3300048905 Ga0496102_0194392 Ga0496102_0194392_483_1193 230
57 3300048907 Ga0496104_0388826 Ga0496104_0388826_18_728 230
58 3300003751 Ga0055538_1000019 Ga0055538_1000019106 231
59 3300003752 Ga0055539_1000024 Ga0055539_1000024185 231
60 3300003756 Ga0055533_1000032 Ga0055533_1000032106 231
61 3300003759 Ga0055525_1000041 Ga0055525_1000041106 231
62 3300003841 Ga0055541_1000018 Ga0055541_1000018185 231
63 3300005327 Ga0070658_10485685 Ga0070658_104856851 231
64 3300005329 Ga0070683_100119856 Ga0070683_1001198562 231
65 3300005330 Ga0070690_100018254 Ga0070690_1000182542 231
66 3300005331 Ga0070670_100003183 Ga0070670_10000318313 231
67 3300005333 Ga0070677_10068946 Ga0070677_100689461 231
68 3300005334 Ga0068869_100000205 Ga0068869_10000020525 231
69 3300005334 Ga0068869_100297452 Ga0068869_1002974522 231
70 3300005335 Ga0070666_10001671 Ga0070666_100016719 231
71 3300005336 Ga0070680_100004745 Ga0070680_1000047455 231
72 3300005337 Ga0070682_100000180 Ga0070682_10000018010 231
73 3300005338 Ga0068868_100213446 Ga0068868_1002134462 231
74 3300005339 Ga0070660_100000321 Ga0070660_1000003215 231
75 3300005339 Ga0070660_100732330 Ga0070660_1007323301 231
76 3300005341 Ga0070691_10075486 Ga0070691_100754862 231
77 3300005344 Ga0070661_100600764 Ga0070661_1006007641 231
78 3300005345 Ga0070692_10002301 Ga0070692_100023012 231
79 3300005347 Ga0070668_100007445 Ga0070668_1000074453 231
80 3300005354 Ga0070675_100008402 Ga0070675_1000084024 231
81 3300005355 Ga0070671_100002283 Ga0070671_10000228315 231
82 3300005355 Ga0070671_100100449 Ga0070671_1001004491 231
83 3300005356 Ga0070674_100001737 Ga0070674_10000173712 231
84 3300005364 Ga0070673_100000414 Ga0070673_10000041417 231
85 3300005364 Ga0070673_100006199 Ga0070673_1000061993 231
86 3300005366 Ga0070659_100000881 Ga0070659_1000008818 231
87 3300005367 Ga0070667_100022534 Ga0070667_1000225343 231
88 3300005367 Ga0070667_100074164 Ga0070667_1000741643 231
89 3300005367 Ga0070667_100243904 Ga0070667_1002439041 231
90 3300005406 Ga0070703_10001102 Ga0070703_100011028 231
91 3300005437 Ga0070710_10026855 Ga0070710_100268553 231
92 3300005439 Ga0070711_100012774 Ga0070711_1000127743 231
93 3300005440 Ga0070705_100000078 Ga0070705_10000007831 231
94 3300005444 Ga0070694_100001715 Ga0070694_1000017155 231
95 3300005455 Ga0070663_100036402 Ga0070663_1000364022 231
96 3300005455 Ga0070663_100045392 Ga0070663_1000453922 231
97 3300005455 Ga0070663_100056080 Ga0070663_1000560802 231
98 3300005456 Ga0070678_100004553 Ga0070678_10000455310 231
99 3300005456 Ga0070678_100016630 Ga0070678_1000166303 231
100 3300005457 Ga0070662_100001051 Ga0070662_1000010512 231
101 3300005457 Ga0070662_100062976 Ga0070662_1000629763 231
102 3300005458 Ga0070681_10006915 Ga0070681_100069154 231
103 3300005459 Ga0068867_100004322 Ga0068867_1000043223 231
104 3300005459 Ga0068867_100111808 Ga0068867_1001118082 231
105 3300005467 Ga0070706_100583745 Ga0070706_1005837452 231
106 3300005467 Ga0070706_100899436 Ga0070706_1008994361 231
107 3300005468 Ga0070707_100407961 Ga0070707_1004079612 231
108 3300005518 Ga0070699_100100198 Ga0070699_1001001983 231
109 3300005518 Ga0070699_100221582 Ga0070699_1002215822 231
110 3300005530 Ga0070679_100000702 Ga0070679_10000070213 231
111 3300005536 Ga0070697_100093457 Ga0070697_1000934572 231
112 3300005539 Ga0068853_100000255 Ga0068853_1000002559 231
113 3300005539 Ga0068853_100005722 Ga0068853_10000572212 231
114 3300005543 Ga0070672_100006664 Ga0070672_1000066649 231
115 3300005543 Ga0070672_100013507 Ga0070672_1000135076 231
116 3300005545 Ga0070695_100001050 Ga0070695_1000010505 231
117 3300005545 Ga0070695_100001834 Ga0070695_1000018342 231
118 3300005546 Ga0070696_100034665 Ga0070696_1000346653 231
119 3300005547 Ga0070693_100000163 Ga0070693_10000016315 231
120 3300005547 Ga0070693_100000754 Ga0070693_10000075411 231
121 3300005549 Ga0070704_100008672 Ga0070704_1000086721 231
122 3300005563 Ga0068855_100003137 Ga0068855_1000031378 231
123 3300005564 Ga0070664_100008022 Ga0070664_1000080224 231
124 3300005578 Ga0068854_100000709 Ga0068854_10000070914 231
125 3300005614 Ga0068856_100018398 Ga0068856_1000183985 231
126 3300005615 Ga0070702_100196285 Ga0070702_1001962852 231
127 3300005616 Ga0068852_100003709 Ga0068852_1000037097 231
128 3300005616 Ga0068852_100181355 Ga0068852_1001813552 231
129 3300005617 Ga0068859_100010878 Ga0068859_1000108782 231
130 3300005617 Ga0068859_100269160 Ga0068859_1002691602 231
131 3300005618 Ga0068864_100009447 Ga0068864_1000094472 231
132 3300005718 Ga0068866_10002311 Ga0068866_100023114 231
133 3300005719 Ga0068861_100226500 Ga0068861_1002265002 231
134 3300005834 Ga0068851_10000963 Ga0068851_100009633 231
135 3300005834 Ga0068851_10031907 Ga0068851_100319074 231
136 3300005840 Ga0068870_10000769 Ga0068870_100007698 231
137 3300005841 Ga0068863_100003538 Ga0068863_1000035389 231
138 3300005841 Ga0068863_100034158 Ga0068863_1000341582 231
139 3300005842 Ga0068858_100006057 Ga0068858_1000060575 231
140 3300005843 Ga0068860_100009497 Ga0068860_1000094974 231
141 3300005843 Ga0068860_100017520 Ga0068860_1000175204 231
142 3300005843 Ga0068860_100037793 Ga0068860_1000377932 231
143 3300005844 Ga0068862_100001036 Ga0068862_10000103619 231
144 3300005985 Ga0081539_10051073 Ga0081539_100510732 231
145 3300006173 Ga0070716_100077917 Ga0070716_1000779172 231
146 3300006175 Ga0070712_100049133 Ga0070712_1000491332 231
147 3300006175 Ga0070712_100940678 Ga0070712_1009406781 231
148 3300006237 Ga0097621_100020664 Ga0097621_1000206644 231
149 3300006358 Ga0068871_100156297 Ga0068871_1001562972 231
150 3300006871 Ga0075434_100052781 Ga0075434_1000527814 231
151 3300006871 Ga0075434_100505625 Ga0075434_1005056251 231
152 3300006881 Ga0068865_100032504 Ga0068865_1000325043 231
153 3300006881 Ga0068865_100157495 Ga0068865_1001574952 231
154 3300006931 Ga0097620_100010879 Ga0097620_1000108798 231
155 3300006931 Ga0097620_100269178 Ga0097620_1002691782 231
156 3300007076 Ga0075435_100007737 Ga0075435_1000077372 231
157 3300007265 Ga0099794_10009804 Ga0099794_100098042 231
158 3300007265 Ga0099794_10015415 Ga0099794_100154151 231
159 3300009094 Ga0111539_10129855 Ga0111539_101298552 231
160 3300009098 Ga0105245_10016167 Ga0105245_100161674 231
161 3300009147 Ga0114129_10126434 Ga0114129_101264342 231
162 3300009174 Ga0105241_10000746 Ga0105241_1000074626 231
163 3300009174 Ga0105241_10007582 Ga0105241_100075824 231
164 3300009176 Ga0105242_10028027 Ga0105242_100280273 231
165 3300009176 Ga0105242_10034642 Ga0105242_100346425 231
166 3300009177 Ga0105248_10106882 Ga0105248_101068822 231
167 3300010375 Ga0105239_10059396 Ga0105239_100593964 231
168 3300011119 Ga0105246_10091377 Ga0105246_100913773 231
169 3300013100 Ga0157373_10000755 Ga0157373_1000075512 231
170 3300013102 Ga0157371_10074673 Ga0157371_100746733 231
171 3300013105 Ga0157369_10027542 Ga0157369_100275425 231
172 3300013296 Ga0157374_10000367 Ga0157374_1000036718 231
173 3300013296 Ga0157374_10067000 Ga0157374_100670005 231
174 3300013307 Ga0157372_10001139 Ga0157372_1000113916 231
175 3300013308 Ga0157375_10000991 Ga0157375_100009919 231
176 3300013308 Ga0157375_10012239 Ga0157375_100122393 231
177 3300014325 Ga0163163_10000659 Ga0163163_1000065925 231
178 3300014325 Ga0163163_10060644 Ga0163163_100606443 231
179 3300014325 Ga0163163_10078882 Ga0163163_100788824 231
180 3300014745 Ga0157377_10106124 Ga0157377_101061242 231
181 3300014969 Ga0157376_10097581 Ga0157376_100975813 231
182 3300017792 Ga0163161_10048022 Ga0163161_100480224 231
183 3300020070 Ga0206356_10080782 Ga0206356_100807822 231
184 3300021377 Ga0213874_10003972 Ga0213874_100039724 231
185 3300025885 Ga0207653_10003877 Ga0207653_100038772 231
186 3300025893 Ga0207682_10001173 Ga0207682_1000117314 231
187 3300025899 Ga0207642_10019484 Ga0207642_100194841 231
188 3300025903 Ga0207680_10002438 Ga0207680_100024383 231
189 3300025903 Ga0207680_10118350 Ga0207680_101183502 231
190 3300025905 Ga0207685_10035540 Ga0207685_100355402 231
191 3300025907 Ga0207645_10000170 Ga0207645_1000017021 231
192 3300025907 Ga0207645_10001033 Ga0207645_1000103315 231
193 3300025908 Ga0207643_10000051 Ga0207643_1000005130 231
194 3300025908 Ga0207643_10005125 Ga0207643_100051258 231
195 3300025910 Ga0207684_10554503 Ga0207684_105545031 231
196 3300025910 Ga0207684_10732066 Ga0207684_107320661 231
197 3300025911 Ga0207654_10018395 Ga0207654_100183954 231
198 3300025911 Ga0207654_10116764 Ga0207654_101167643 231
199 3300025912 Ga0207707_10000453 Ga0207707_1000045328 231
200 3300025915 Ga0207693_10002513 Ga0207693_1000251313 231
201 3300025916 Ga0207663_10011146 Ga0207663_100111464 231
202 3300025917 Ga0207660_10000203 Ga0207660_1000020319 231
203 3300025919 Ga0207657_10000357 Ga0207657_100003574 231
204 3300025920 Ga0207649_10000678 Ga0207649_100006785 231
205 3300025921 Ga0207652_10000690 Ga0207652_100006908 231
206 3300025922 Ga0207646_10605610 Ga0207646_106056102 231
207 3300025925 Ga0207650_10064440 Ga0207650_100644402 231
208 3300025927 Ga0207687_10004230 Ga0207687_100042303 231
209 3300025927 Ga0207687_10300479 Ga0207687_103004792 231
210 3300025932 Ga0207690_10006825 Ga0207690_100068252 231
211 3300025933 Ga0207706_10022334 Ga0207706_100223344 231
212 3300025934 Ga0207686_10004948 Ga0207686_100049484 231
213 3300025937 Ga0207669_10032621 Ga0207669_100326213 231
214 3300025937 Ga0207669_10170721 Ga0207669_101707211 231
215 3300025938 Ga0207704_10102105 Ga0207704_101021052 231
216 3300025939 Ga0207665_10098428 Ga0207665_100984282 231
217 3300025940 Ga0207691_10000006 Ga0207691_1000000646 231
218 3300025940 Ga0207691_10015193 Ga0207691_100151933 231
219 3300025941 Ga0207711_10402296 Ga0207711_104022961 231
220 3300025942 Ga0207689_10000296 Ga0207689_1000029624 231
221 3300025944 Ga0207661_10315535 Ga0207661_103155352 231
222 3300025945 Ga0207679_10000233 Ga0207679_1000023331 231
223 3300025949 Ga0207667_10001806 Ga0207667_100018065 231
224 3300025960 Ga0207651_10026513 Ga0207651_100265133 231
225 3300025960 Ga0207651_10306489 Ga0207651_103064892 231
226 3300025972 Ga0207668_10013784 Ga0207668_100137846 231
227 3300025981 Ga0207640_10008493 Ga0207640_100084934 231
228 3300025986 Ga0207658_10020008 Ga0207658_100200085 231
229 3300025986 Ga0207658_10352861 Ga0207658_103528611 231
230 3300026035 Ga0207703_10026631 Ga0207703_100266315 231
231 3300026035 Ga0207703_10639942 Ga0207703_106399422 231
232 3300026041 Ga0207639_10001326 Ga0207639_100013265 231
233 3300026041 Ga0207639_10005406 Ga0207639_100054062 231
234 3300026067 Ga0207678_10003431 Ga0207678_100034312 231
235 3300026067 Ga0207678_10054639 Ga0207678_100546392 231
236 3300026067 Ga0207678_10103322 Ga0207678_101033222 231
237 3300026075 Ga0207708_10339658 Ga0207708_103396582 231
238 3300026078 Ga0207702_10001254 Ga0207702_1000125423 231
239 3300026088 Ga0207641_10029865 Ga0207641_100298656 231
240 3300026088 Ga0207641_10164161 Ga0207641_101641612 231
241 3300026089 Ga0207648_10004394 Ga0207648_1000439412 231
242 3300026089 Ga0207648_10016091 Ga0207648_100160912 231
243 3300026089 Ga0207648_10022282 Ga0207648_100222824 231
244 3300026089 Ga0207648_10219500 Ga0207648_102195003 231
245 3300026095 Ga0207676_10002144 Ga0207676_1000214416 231
246 3300026095 Ga0207676_10002162 Ga0207676_100021624 231
247 3300026095 Ga0207676_10255471 Ga0207676_102554711 231
248 3300026116 Ga0207674_10000836 Ga0207674_1000083627 231
249 3300026118 Ga0207675_100179851 Ga0207675_1001798514 231
250 3300026118 Ga0207675_100196626 Ga0207675_1001966263 231
251 3300026121 Ga0207683_10000853 Ga0207683_100008537 231
252 3300026121 Ga0207683_10019137 Ga0207683_100191375 231
253 3300026142 Ga0207698_10003568 Ga0207698_100035682 231
254 3300026142 Ga0207698_10051282 Ga0207698_100512823 231
255 3300027671 Ga0209588_1005062 Ga0209588_10050624 231
256 3300028379 Ga0268266_10006477 Ga0268266_100064778 231
257 3300028380 Ga0268265_10007291 Ga0268265_100072916 231
258 3300028381 Ga0268264_10003910 Ga0268264_100039107 231
259 3300028381 Ga0268264_10011656 Ga0268264_100116562 231
260 3300028556 Ga0265337_1016980 Ga0265337_10169802 231
261 3300028558 Ga0265326_10009471 Ga0265326_100094713 231
262 3300028653 Ga0265323_10005281 Ga0265323_100052814 231
263 3300028666 Ga0265336_10031580 Ga0265336_100315801 231
264 3300028800 Ga0265338_10036401 Ga0265338_100364015 231
265 3300031235 Ga0265330_10001807 Ga0265330_100018072 231
266 3300031247 Ga0265340_10010296 Ga0265340_100102964 231
267 3300031616 Ga0307508_10006236 Ga0307508_1000623612 231
268 3300031711 Ga0265314_10000008 Ga0265314_10000008206 231
269 3300031712 Ga0265342_10004246 Ga0265342_100042466 231
270 3300031730 Ga0307516_10158118 Ga0307516_101581184 231
271 3300033179 Ga0307507_10124333 Ga0307507_101243332 231
272 3300035113 Ga0373936_0030132 Ga0373936_0030132_560_1261 231
273 3300035115 Ga0373941_0033512 Ga0373941_0033512_772_1470 231
274 3300035116 Ga0373945_0020619 Ga0373945_0020619_939_1640 231
275 3300035118 Ga0373954_0001721 Ga0373954_0001721_5327_6028 231
276 3300035121 Ga0373960_0039518 Ga0373960_0039518_47_745 231
277 3300035170 Ga0373943_0016261 Ga0373943_0016261_649_1350 231
278 3300035171 Ga0373946_0008118 Ga0373946_0008118_2524_3225 231
279 3300035241 Ga0373961_0039552 Ga0373961_0039552_642_1340 231
280 3300035691 Ga0373931_0336288 Ga0373931_0336288_49_747 231
281 3300035691 Ga0373931_0509948 Ga0373931_0509948_57_758 231
282 3300035692 Ga0373935_0229368 Ga0373935_0229368_382_1083 231
283 3300035724 Ga0373933_0095271 Ga0373933_0095271_361_1059 231
284 3300036401 Ga0373937_0008585 Ga0373937_0008585_84_785 231
285 3300036401 Ga0373937_0057721 Ga0373937_0057721_1861_2562 231
286 3300037068 Ga0373925_0000590 Ga0373925_0000590_33024_33725 231
287 3300037068 Ga0373925_0084873 Ga0373925_0084873_697_1398 231
288 3300037471 Ga0395905_0006594 Ga0395905_0006594_2911_3609 231
289 3300039450 Ga0436363_1718963 Ga0436363_1718963_9204_9902 231
290 3300042438 Ga0439459_0000390 Ga0439459_0000390_1668_2366 231
291 3300042876 Ga0451577_0007371 Ga0451577_0007371_8177_8875 231
292 3300042876 Ga0451577_0021405 Ga0451577_0021405_669_1373 231
293 3300042876 Ga0451577_0074187 Ga0451577_0074187_1899_2597 231
294 3300044712 Ga0453684_0082776 Ga0453684_0082776_1284_1988 231
295 3300044712 Ga0453684_0358473 Ga0453684_0358473_284_982 231
296 3300045051 Ga0451576_0017398 Ga0451576_0017398_926_1624 231
297 3300045051 Ga0451576_0028309 Ga0451576_0028309_25_723 231
298 3300045051 Ga0451576_0038659 Ga0451576_0038659_1244_1942 231
299 3300046459 Ga0495629_0259162 Ga0495629_0259162_454_1155 231
300 3300046462 Ga0495651_0122525 Ga0495651_0122525_899_1600 231
301 3300046463 Ga0495653_0028328 Ga0495653_0028328_323_1024 231
302 3300046463 Ga0495653_0166984 Ga0495653_0166984_580_1278 231
303 3300046472 Ga0495580_0037203 Ga0495580_0037203_124_825 231
304 3300046472 Ga0495580_0155371 Ga0495580_0155371_61_762 231
305 3300046475 Ga0495639_0011279 Ga0495639_0011279_1965_2666 231
306 3300046477 Ga0495664_0298182 Ga0495664_0298182_253_954 231
307 3300046499 Ga0495594_0008790 Ga0495594_0008790_2930_3631 231
308 3300046507 Ga0495606_0043881 Ga0495606_0043881_2003_2701 231
309 3300046511 Ga0495608_0020687 Ga0495608_0020687_2736_3437 231
310 3300046522 Ga0495643_0005705 Ga0495643_0005705_2242_2940 231
311 3300046528 Ga0495642_0009846 Ga0495642_0009846_168_866 231
312 3300046531 Ga0495665_0026312 Ga0495665_0026312_604_1305 231
313 3300046535 Ga0495586_0036380 Ga0495586_0036380_481_1182 231
314 3300046542 Ga0495597_0019148 Ga0495597_0019148_2421_3119 231
315 3300046559 Ga0495667_0045705 Ga0495667_0045705_1216_1917 231
316 3300046663 Ga0495635_0021814 Ga0495635_0021814_2503_3204 231
317 3300046663 Ga0495635_0283366 Ga0495635_0283366_313_1014 231
318 3300046665 Ga0495661_0056627 Ga0495661_0056627_1548_2246 231
319 3300046675 Ga0495657_0207846 Ga0495657_0207846_88_789 231
320 3300046689 Ga0495613_0030943 Ga0495613_0030943_3254_3955 231
321 3300046809 Ga0495600_0133460 Ga0495600_0133460_368_1069 231
322 3300047315 Ga0495581_0002485 Ga0495581_0002485_5947_6648 231
323 3300047317 Ga0495604_0173342 Ga0495604_0173342_72_773 231
324 3300047322 Ga0495680_0026364 Ga0495680_0026364_1064_1765 231
325 3300047443 Ga0495687_012369 Ga0495687_012369_1514_2212 231
326 3300047471 Ga0495684_0081087 Ga0495684_0081087_371_1072 231
327 3300048088 Ga0495602_0011216 Ga0495602_0011216_5808_6506 231
328 3300048905 Ga0496102_0165727 Ga0496102_0165727_146_844 231
329 3300048907 Ga0496104_0529421 Ga0496104_0529421_358_1059 231
330 3300048909 Ga0496106_0018631 Ga0496106_0018631_3649_4347 231
331 3300048910 Ga0496107_0463492 Ga0496107_0463492_221_919 231
332 3300048912 Ga0496109_0070025 Ga0496109_0070025_875_1576 231
333 3300048913 Ga0496110_0075929 Ga0496110_0075929_1526_2227 231
334 3300048915 Ga0496112_0110109 Ga0496112_0110109_421_1119 231
335 3300048917 Ga0496114_0048179 Ga0496114_0048179_1083_1784 231
336 3300049571 Ga0501034_0000188 Ga0501034_0000188_70485_71183 231
337 3300049581 Ga0501047_0185572 Ga0501047_0185572_14_712 231
338 3300049591 Ga0501075_0403638 Ga0501075_0403638_44_742 231
339 3300050507 nmdc:mga05p37_148368_c1 nmdc:mga05p37_148368_c1_175_873 231
340 3300050507 nmdc:mga05p37_293961_c1 nmdc:mga05p37_293961_c1_868_1566 231
341 3300050511 nmdc:mga08y16_103046_c1 nmdc:mga08y16_103046_c1_2003_2701 231
342 3300050512 nmdc:mga0n895_793723_c1 nmdc:mga0n895_793723_c1_60_758 231
343 3300050515 nmdc:mga0a205_20483_c1 nmdc:mga0a205_20483_c1_5155_5853 231
344 3300053084 Ga0495595_0196376 Ga0495595_0196376_178_879 231
345 3300053085 Ga0495619_0005573 Ga0495619_0005573_6220_6921 231
346 3300053111 Ga0500572_026875 Ga0500572_026875_77_775 231
347 3300053119 Ga0500595_000293 Ga0500595_000293_20471_21169 231
348 3300053121 Ga0500607_073737 Ga0500607_073737_527_1225 231
349 3300053122 Ga0500608_079507 Ga0500608_079507_810_1508 231
350 3300053123 Ga0500614_001975 Ga0500614_001975_3119_3817 231
351 3300053136 Ga0500559_0005250 Ga0500559_0005250_1051_1749 231
352 3300053154 Ga0500619_012431 Ga0500619_012431_888_1586 231
353 3300003775 Ga0055524_1000606 Ga0055524_10006065 232
354 3300003784 Ga0055534_1001043 Ga0055534_100104310 232
355 3300005262 Ga0065165_1004504 Ga0065165_10045044 232
356 3300005334 Ga0068869_100100872 Ga0068869_1001008722 232
357 3300005340 Ga0070689_100366130 Ga0070689_1003661302 232
358 3300005543 Ga0070672_100111344 Ga0070672_1001113442 232
359 3300005548 Ga0070665_100001831 Ga0070665_10000183112 232
360 3300005844 Ga0068862_100098895 Ga0068862_1000988953 232
361 3300006178 Ga0075367_10049042 Ga0075367_100490422 232
362 3300006195 Ga0075366_10003459 Ga0075366_100034596 232
363 3300006353 Ga0075370_10000726 Ga0075370_1000072611 232
364 3300006353 Ga0075370_10001753 Ga0075370_100017536 232
365 3300006358 Ga0068871_100428970 Ga0068871_1004289702 232
366 3300009093 Ga0105240_10092977 Ga0105240_100929773 232
367 3300009093 Ga0105240_10212393 Ga0105240_102123932 232
368 3300009148 Ga0105243_10198138 Ga0105243_101981383 232
369 3300014968 Ga0157379_10183473 Ga0157379_101834732 232
370 3300015261 Ga0182006_1001089 Ga0182006_10010894 232
371 3300021361 Ga0213872_10012552 Ga0213872_100125522 232
372 3300025224 Ga0209784_100009 Ga0209784_100009252 232
373 3300025225 Ga0209566_100007 Ga0209566_100007252 232
374 3300025226 Ga0209674_100018 Ga0209674_100018252 232
375 3300025230 Ga0209563_100020 Ga0209563_100020252 232
376 3300025253 Ga0209677_100010 Ga0209677_100010252 232
377 3300025273 Ga0209673_1008723 Ga0209673_10087235 232
378 3300025920 Ga0207649_10066613 Ga0207649_100666133 232
379 3300025940 Ga0207691_10185420 Ga0207691_101854203 232
380 3300025942 Ga0207689_10305819 Ga0207689_103058192 232
381 3300026089 Ga0207648_10171082 Ga0207648_101710822 232
382 3300027682 Ga0209971_1047136 Ga0209971_10471362 232
383 3300028379 Ga0268266_10008840 Ga0268266_100088404 232
384 3300028380 Ga0268265_10198550 Ga0268265_101985503 232
385 3300031235 Ga0265330_10053113 Ga0265330_100531133 232
386 3300031238 Ga0265332_10006958 Ga0265332_100069581 232
387 3300031711 Ga0265314_10003341 Ga0265314_100033416 232
388 3300031852 Ga0307410_10489998 Ga0307410_104899982 232
389 3300033180 Ga0307510_10001034 Ga0307510_1000103416 232
390 3300035171 Ga0373946_0257646 Ga0373946_0257646_67_810 232
391 3300035398 Ga0316574_0097230 Ga0316574_0097230_292_996 232
392 3300036401 Ga0373937_0120460 Ga0373937_0120460_1597_2340 232
393 3300039447 Ga0436361_0181224 Ga0436361_0181224_988_1689 232
394 3300042012 Ga0439455_0100503 Ga0439455_0100503_18_737 232
395 3300042876 Ga0451577_0193695 Ga0451577_0193695_49_747 232
396 3300045049 Ga0466959_0019220 Ga0466959_0019220_498_1199 232
397 3300046459 Ga0495629_0020987 Ga0495629_0020987_1609_2352 232
398 3300046472 Ga0495580_0042110 Ga0495580_0042110_1941_2657 232
399 3300046516 Ga0495628_0142105 Ga0495628_0142105_705_1448 232
400 3300046523 Ga0495644_0000126 Ga0495644_0000126_6784_7482 232
401 3300046681 Ga0495647_0007674 Ga0495647_0007674_1682_2425 232
402 3300046683 Ga0495658_0013030 Ga0495658_0013030_782_1525 232
403 3300047447 Ga0495685_001412 Ga0495685_001412_1591_2289 232
404 3300047471 Ga0495684_0043266 Ga0495684_0043266_1330_2073 232
405 3300047472 Ga0495686_0000159 Ga0495686_0000159_16348_17049 232
406 3300049460 Ga0495682_0001373 Ga0495682_0001373_5828_6526 232
407 3300049572 Ga0501036_0038713 Ga0501036_0038713_2990_3688 232
408 3300049573 Ga0501037_0110141 Ga0501037_0110141_1145_1843 232
409 3300049576 Ga0501040_0002233 Ga0501040_0002233_5704_6402 232
410 3300049582 Ga0501048_0039419 Ga0501048_0039419_2143_2841 232
411 3300049587 Ga0501071_0043530 Ga0501071_0043530_1655_2353 232
412 3300049588 Ga0501072_0006430 Ga0501072_0006430_7907_8605 232
413 3300049588 Ga0501072_0128287 Ga0501072_0128287_941_1717 232
414 3300049589 Ga0501073_0407773 Ga0501073_0407773_136_834 232
415 3300049590 Ga0501074_0044204 Ga0501074_0044204_2280_2978 232
416 3300049591 Ga0501075_0000739 Ga0501075_0000739_13565_14263 232
417 3300049591 Ga0501075_0009894 Ga0501075_0009894_816_1592 232
418 3300049592 Ga0501076_0001064 Ga0501076_0001064_6574_7272 232
419 3300049741 Ga0501079_0040293 Ga0501079_0040293_1871_2569 232
420 3300049742 Ga0501080_0002824 Ga0501080_0002824_8486_9184 232
421 3300049743 Ga0501081_0001893 Ga0501081_0001893_11602_12300 232
422 3300049743 Ga0501081_0310317 Ga0501081_0310317_72_848 232
423 3300049824 Ga0501045_0016289 Ga0501045_0016289_1527_2303 232
424 3300049824 Ga0501045_0021163 Ga0501045_0021163_1916_2614 232
425 3300050493 nmdc:mga0k408_18775_c1 nmdc:mga0k408_18775_c1_1846_2568 232
426 3300050493 nmdc:mga0k408_29098_c1 nmdc:mga0k408_29098_c1_1816_2535 232
427 3300050494 nmdc:mga06z11_175211_c1 nmdc:mga06z11_175211_c1_36_755 232
428 3300050496 nmdc:mga07m45_1123_c1 nmdc:mga07m45_1123_c1_9212_9931 232
429 3300050496 nmdc:mga07m45_570_c1 nmdc:mga07m45_570_c1_9869_10588 232
430 3300053084 Ga0495595_0072978 Ga0495595_0072978_775_1518 232
431 3300053088 Ga0500644_0001943 Ga0500644_0001943_3577_4275 232
432 3300053730 Ga0500645_000214 Ga0500645_000214_28866_29564 232
433 3300060353 Ga0501082_0002239 Ga0501082_0002239_5195_5893 232
434 3300061734 Ga0530510_0000539 Ga0530510_0000539_16384_17082 232
435 3300002704 JGI25155J39150_1000008 JGI25155J39150_1000008207 233
436 3300002705 JGI25156J39149_1000002 JGI25156J39149_100000247 233
437 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010270 233
438 3300002741 JGI25157J39369_1000001 JGI25157J39369_100000168 233
439 3300002774 JGI25150J39212_1028518 JGI25150J39212_10285181 233
440 3300002987 JGI25159J45721_1001868 JGI25159J45721_10018684 233
441 3300002987 JGI25159J45721_1002408 JGI25159J45721_10024082 233
442 3300003187 JGI25151J46595_10003749 JGI25151J46595_100037498 233
443 3300003187 JGI25151J46595_10004501 JGI25151J46595_100045013 233
444 3300003322 rootL2_10142603 rootL2_101426032 233
445 3300003347 JGI26128J50194_1001075 JGI26128J50194_10010752 233
446 3300003354 JGI25160J50197_1000342 JGI25160J50197_10003428 233
447 3300003354 JGI25160J50197_1016285 JGI25160J50197_10162852 233
448 3300003374 JGI25161J50226_1000259 JGI25161J50226_10002598 233
449 3300003771 Ga0055526_1001483 Ga0055526_10014839 233
450 3300003771 Ga0055526_1003973 Ga0055526_10039734 233
451 3300003773 Ga0055537_1000102 Ga0055537_100010211 233
452 3300003773 Ga0055537_1005851 Ga0055537_10058513 233
453 3300003775 Ga0055524_1000093 Ga0055524_100009361 233
454 3300003781 Ga0055536_1006611 Ga0055536_10066116 233
455 3300003784 Ga0055534_1002793 Ga0055534_10027932 233
456 3300003790 Ga0055528_1000696 Ga0055528_100069611 233
457 3300003791 Ga0055530_10000891 Ga0055530_100008919 233
458 3300003792 Ga0055540_1000089 Ga0055540_100008987 233
459 3300003792 Ga0055540_1000196 Ga0055540_10001963 233
460 3300003794 Ga0055531_10004653 Ga0055531_100046539 233
461 3300004625 Ga0055543_1000527 Ga0055543_100052716 233
462 3300005262 Ga0065165_1005633 Ga0065165_10056332 233
463 3300005262 Ga0065165_1006014 Ga0065165_10060142 233
464 3300005288 Ga0065714_10028103 Ga0065714_100281031 233
465 3300005327 Ga0070658_10006296 Ga0070658_100062963 233
466 3300005327 Ga0070658_10063873 Ga0070658_100638732 233
467 3300005329 Ga0070683_100013440 Ga0070683_1000134407 233
468 3300005331 Ga0070670_100015364 Ga0070670_1000153646 233
469 3300005331 Ga0070670_100050796 Ga0070670_1000507964 233
470 3300005336 Ga0070680_100026210 Ga0070680_1000262102 233
471 3300005339 Ga0070660_100025968 Ga0070660_1000259685 233
472 3300005339 Ga0070660_100113763 Ga0070660_1001137632 233
473 3300005344 Ga0070661_100005929 Ga0070661_1000059292 233
474 3300005344 Ga0070661_100057362 Ga0070661_1000573623 233
475 3300005344 Ga0070661_100203509 Ga0070661_1002035092 233
476 3300005354 Ga0070675_100269821 Ga0070675_1002698212 233
477 3300005354 Ga0070675_100615831 Ga0070675_1006158311 233
478 3300005366 Ga0070659_100007664 Ga0070659_1000076643 233
479 3300005434 Ga0070709_10006612 Ga0070709_100066127 233
480 3300005434 Ga0070709_10318978 Ga0070709_103189781 233
481 3300005435 Ga0070714_100067425 Ga0070714_1000674252 233
482 3300005437 Ga0070710_10381774 Ga0070710_103817742 233
483 3300005439 Ga0070711_100138301 Ga0070711_1001383012 233
484 3300005455 Ga0070663_100003555 Ga0070663_1000035554 233
485 3300005458 Ga0070681_10003260 Ga0070681_100032604 233
486 3300005458 Ga0070681_10054456 Ga0070681_100544562 233
487 3300005458 Ga0070681_10612792 Ga0070681_106127921 233
488 3300005459 Ga0068867_100000642 Ga0068867_1000006423 233
489 3300005459 Ga0068867_100149513 Ga0068867_1001495133 233
490 3300005467 Ga0070706_100097493 Ga0070706_1000974933 233
491 3300005530 Ga0070679_100024228 Ga0070679_1000242283 233
492 3300005535 Ga0070684_100001566 Ga0070684_1000015669 233
493 3300005539 Ga0068853_100012208 Ga0068853_1000122086 233
494 3300005539 Ga0068853_100181494 Ga0068853_1001814942 233
495 3300005539 Ga0068853_100610168 Ga0068853_1006101681 233
496 3300005547 Ga0070693_100027690 Ga0070693_1000276903 233
497 3300005548 Ga0070665_100024636 Ga0070665_1000246364 233
498 3300005563 Ga0068855_100004144 Ga0068855_10000414410 233
499 3300005563 Ga0068855_100054072 Ga0068855_1000540722 233
500 3300005563 Ga0068855_100203970 Ga0068855_1002039703 233
501 3300005564 Ga0070664_100006434 Ga0070664_1000064349 233
502 3300005577 Ga0068857_100040360 Ga0068857_1000403606 233
503 3300005578 Ga0068854_100003114 Ga0068854_1000031141 233
504 3300005578 Ga0068854_100011172 Ga0068854_1000111725 233
505 3300005578 Ga0068854_100203609 Ga0068854_1002036092 233
506 3300005614 Ga0068856_100011686 Ga0068856_1000116867 233
507 3300005614 Ga0068856_100019664 Ga0068856_1000196643 233
508 3300005614 Ga0068856_100394237 Ga0068856_1003942372 233
509 3300005616 Ga0068852_100165800 Ga0068852_1001658002 233
510 3300005618 Ga0068864_100043522 Ga0068864_1000435224 233
511 3300005618 Ga0068864_100158672 Ga0068864_1001586721 233
512 3300005719 Ga0068861_100818218 Ga0068861_1008182182 233
513 3300005834 Ga0068851_10005511 Ga0068851_100055117 233
514 3300005834 Ga0068851_10030349 Ga0068851_100303493 233
515 3300005840 Ga0068870_10499007 Ga0068870_104990071 233
516 3300005841 Ga0068863_100160162 Ga0068863_1001601621 233
517 3300005843 Ga0068860_100051083 Ga0068860_1000510834 233
518 3300005844 Ga0068862_100203779 Ga0068862_1002037792 233
519 3300006177 Ga0075362_10132739 Ga0075362_101327393 233
520 3300006177 Ga0075362_10154208 Ga0075362_101542082 233
521 3300006178 Ga0075367_10025914 Ga0075367_100259145 233
522 3300006178 Ga0075367_10284136 Ga0075367_102841361 233
523 3300006195 Ga0075366_10067100 Ga0075366_100671003 233
524 3300006195 Ga0075366_10085271 Ga0075366_100852712 233
525 3300006353 Ga0075370_10079724 Ga0075370_100797242 233
526 3300006353 Ga0075370_10160842 Ga0075370_101608422 233
527 3300006353 Ga0075370_10168532 Ga0075370_101685322 233
528 3300006847 Ga0075431_100344011 Ga0075431_1003440112 233
529 3300006880 Ga0075429_100051315 Ga0075429_1000513154 233
530 3300006914 Ga0075436_100052221 Ga0075436_1000522215 233
531 3300006946 Ga0079104_1000970 Ga0079104_100097022 233
532 3300006946 Ga0079104_1010113 Ga0079104_10101133 233
533 3300009093 Ga0105240_10012204 Ga0105240_100122048 233
534 3300009093 Ga0105240_10119142 Ga0105240_101191422 233
535 3300009093 Ga0105240_10211547 Ga0105240_102115473 233
536 3300009093 Ga0105240_10269429 Ga0105240_102694292 233
537 3300009174 Ga0105241_10000415 Ga0105241_1000041521 233
538 3300009174 Ga0105241_10060181 Ga0105241_100601813 233
539 3300009177 Ga0105248_10425935 Ga0105248_104259351 233
540 3300009545 Ga0105237_10014925 Ga0105237_100149259 233
541 3300010375 Ga0105239_10016788 Ga0105239_100167889 233
542 3300011119 Ga0105246_10619932 Ga0105246_106199321 233
543 3300012513 Ga0157326_1007504 Ga0157326_10075042 233
544 3300013100 Ga0157373_10005045 Ga0157373_100050453 233
545 3300013100 Ga0157373_10018416 Ga0157373_100184165 233
546 3300013102 Ga0157371_10007161 Ga0157371_100071617 233
547 3300013104 Ga0157370_10022272 Ga0157370_100222726 233
548 3300013104 Ga0157370_10050451 Ga0157370_100504512 233
549 3300013104 Ga0157370_10068790 Ga0157370_100687905 233
550 3300013104 Ga0157370_10341411 Ga0157370_103414111 233
551 3300013105 Ga0157369_10049289 Ga0157369_100492893 233
552 3300013296 Ga0157374_10149417 Ga0157374_101494172 233
553 3300013307 Ga0157372_10005206 Ga0157372_1000520614 233
554 3300013307 Ga0157372_10043686 Ga0157372_100436864 233
555 3300013307 Ga0157372_10049928 Ga0157372_100499284 233
556 3300013307 Ga0157372_10546428 Ga0157372_105464282 233
557 3300014745 Ga0157377_10000052 Ga0157377_1000005222 233
558 3300014969 Ga0157376_10002363 Ga0157376_100023637 233
559 3300021361 Ga0213872_10000016 Ga0213872_1000001699 233
560 3300025206 Ga0209435_100001 Ga0209435_1000011248 233
561 3300025208 Ga0209436_104299 Ga0209436_1042995 233
562 3300025245 Ga0207425_1003360 Ga0207425_10033606 233
563 3300025245 Ga0207425_1005687 Ga0207425_10056874 233
564 3300025246 Ga0209646_1000001 Ga0209646_10000011617 233
565 3300025250 Ga0209026_1000001 Ga0209026_1000001270 233
566 3300025256 Ga0209759_1000001 Ga0209759_10000011248 233
567 3300025258 Ga0209129_1013818 Ga0209129_10138181 233
568 3300025258 Ga0209129_1016874 Ga0209129_10168741 233
569 3300025258 Ga0209129_1035648 Ga0209129_10356481 233
570 3300025263 Ga0209565_1000161 Ga0209565_100016173 233
571 3300025263 Ga0209565_1000884 Ga0209565_10008847 233
572 3300025273 Ga0209673_1000391 Ga0209673_100039148 233
573 3300025273 Ga0209673_1057290 Ga0209673_10572902 233
574 3300025284 Ga0209130_1000118 Ga0209130_100011834 233
575 3300025284 Ga0209130_1000359 Ga0209130_100035944 233
576 3300025291 Ga0209675_1000111 Ga0209675_1000111101 233
577 3300025291 Ga0209675_1000495 Ga0209675_100049511 233
578 3300025292 Ga0209676_1000054 Ga0209676_100005488 233
579 3300025292 Ga0209676_1003774 Ga0209676_100377410 233
580 3300025294 Ga0209025_1001351 Ga0209025_100135118 233
581 3300025294 Ga0209025_1004481 Ga0209025_10044816 233
582 3300025294 Ga0209025_1006065 Ga0209025_10060652 233
583 3300025295 Ga0209564_1000610 Ga0209564_100061023 233
584 3300025295 Ga0209564_1000815 Ga0209564_100081525 233
585 3300025295 Ga0209564_1030948 Ga0209564_10309483 233
586 3300025297 Ga0209758_1006167 Ga0209758_10061675 233
587 3300025298 Ga0209050_1000066 Ga0209050_100006688 233
588 3300025298 Ga0209050_1001609 Ga0209050_10016098 233
589 3300025299 Ga0209256_1000003 Ga0209256_10000031361 233
590 3300025299 Ga0209256_1044726 Ga0209256_10447262 233
591 3300025302 Ga0207426_1000197 Ga0207426_100019754 233
592 3300025302 Ga0207426_1001157 Ga0207426_100115712 233
593 3300025303 Ga0209051_1000044 Ga0209051_100004488 233
594 3300025304 Ga0209257_1000082 Ga0209257_100008288 233
595 3300025906 Ga0207699_10113857 Ga0207699_101138571 233
596 3300025907 Ga0207645_10061863 Ga0207645_100618633 233
597 3300025908 Ga0207643_10040757 Ga0207643_100407571 233
598 3300025909 Ga0207705_10176135 Ga0207705_101761352 233
599 3300025910 Ga0207684_10032385 Ga0207684_100323852 233
600 3300025911 Ga0207654_10030744 Ga0207654_100307444 233
601 3300025912 Ga0207707_10008794 Ga0207707_100087947 233
602 3300025912 Ga0207707_10011006 Ga0207707_100110064 233
603 3300025912 Ga0207707_10013892 Ga0207707_100138927 233
604 3300025913 Ga0207695_10010473 Ga0207695_100104731 233
605 3300025913 Ga0207695_10419225 Ga0207695_104192251 233
606 3300025914 Ga0207671_10021270 Ga0207671_100212703 233
607 3300025916 Ga0207663_10162626 Ga0207663_101626262 233
608 3300025917 Ga0207660_10007462 Ga0207660_100074622 233
609 3300025919 Ga0207657_10000148 Ga0207657_1000014842 233
610 3300025919 Ga0207657_10079515 Ga0207657_100795153 233
611 3300025919 Ga0207657_10116297 Ga0207657_101162972 233
612 3300025920 Ga0207649_10012182 Ga0207649_100121824 233
613 3300025920 Ga0207649_10013098 Ga0207649_100130984 233
614 3300025920 Ga0207649_10178766 Ga0207649_101787662 233
615 3300025921 Ga0207652_10007190 Ga0207652_1000719010 233
616 3300025924 Ga0207694_10019608 Ga0207694_100196083 233
617 3300025924 Ga0207694_10068899 Ga0207694_100688993 233
618 3300025925 Ga0207650_10072818 Ga0207650_100728182 233
619 3300025925 Ga0207650_10168846 Ga0207650_101688462 233
620 3300025926 Ga0207659_10060367 Ga0207659_100603672 233
621 3300025926 Ga0207659_10259955 Ga0207659_102599552 233
622 3300025932 Ga0207690_10076874 Ga0207690_100768742 233
623 3300025932 Ga0207690_10116822 Ga0207690_101168222 233
624 3300025935 Ga0207709_10073370 Ga0207709_100733703 233
625 3300025937 Ga0207669_10320671 Ga0207669_103206712 233
626 3300025940 Ga0207691_10123425 Ga0207691_101234252 233
627 3300025944 Ga0207661_10029191 Ga0207661_100291912 233
628 3300025944 Ga0207661_10067004 Ga0207661_100670044 233
629 3300025945 Ga0207679_10005432 Ga0207679_100054323 233
630 3300025949 Ga0207667_10002455 Ga0207667_1000245513 233
631 3300025949 Ga0207667_10040920 Ga0207667_100409203 233
632 3300025949 Ga0207667_10043513 Ga0207667_100435133 233
633 3300025949 Ga0207667_10163275 Ga0207667_101632752 233
634 3300025949 Ga0207667_10165462 Ga0207667_101654623 233
635 3300025981 Ga0207640_10017603 Ga0207640_100176034 233
636 3300026041 Ga0207639_10337620 Ga0207639_103376202 233
637 3300026067 Ga0207678_10000214 Ga0207678_1000021441 233
638 3300026067 Ga0207678_10171130 Ga0207678_101711301 233
639 3300026078 Ga0207702_10018586 Ga0207702_100185863 233
640 3300026078 Ga0207702_10064868 Ga0207702_100648683 233
641 3300026078 Ga0207702_10643810 Ga0207702_106438102 233
642 3300026078 Ga0207702_10704946 Ga0207702_107049461 233
643 3300026088 Ga0207641_10537997 Ga0207641_105379971 233
644 3300026088 Ga0207641_10745058 Ga0207641_107450581 233
645 3300026089 Ga0207648_10001074 Ga0207648_1000107414 233
646 3300026095 Ga0207676_10123826 Ga0207676_101238264 233
647 3300026116 Ga0207674_10000312 Ga0207674_1000031229 233
648 3300026116 Ga0207674_10050212 Ga0207674_100502122 233
649 3300026116 Ga0207674_10271124 Ga0207674_102711242 233
650 3300026142 Ga0207698_10000387 Ga0207698_1000038710 233
651 3300026142 Ga0207698_10229165 Ga0207698_102291652 233
652 3300027111 Ga0209281_1000993 Ga0209281_100099322 233
653 3300027395 Ga0209996_1003277 Ga0209996_10032772 233
654 3300027471 Ga0209995_1005220 Ga0209995_10052202 233
655 3300027526 Ga0209968_1004026 Ga0209968_10040261 233
656 3300027543 Ga0209999_1014337 Ga0209999_10143371 233
657 3300027614 Ga0209970_1002103 Ga0209970_10021032 233
658 3300027665 Ga0209983_1005427 Ga0209983_10054272 233
659 3300027695 Ga0209966_1000006 Ga0209966_100000626 233
660 3300027717 Ga0209998_10004415 Ga0209998_100044153 233
661 3300027876 Ga0209974_10007390 Ga0209974_100073904 233
662 3300027907 Ga0207428_10083126 Ga0207428_100831263 233
663 3300027907 Ga0207428_10359126 Ga0207428_103591261 233
664 3300028380 Ga0268265_10289484 Ga0268265_102894842 233
665 3300028381 Ga0268264_10194216 Ga0268264_101942162 233
666 3300028794 Ga0307515_10000028 Ga0307515_10000028203 233
667 3300028794 Ga0307515_10002860 Ga0307515_1000286036 233
668 3300028794 Ga0307515_10004730 Ga0307515_100047305 233
669 3300028794 Ga0307515_10114546 Ga0307515_101145462 233
670 3300031238 Ga0265332_10000003 Ga0265332_1000000372 233
671 3300031456 Ga0307513_10000017 Ga0307513_10000017269 233
672 3300031456 Ga0307513_10000021 Ga0307513_10000021200 233
673 3300031456 Ga0307513_10012920 Ga0307513_1001292010 233
674 3300031456 Ga0307513_10020368 Ga0307513_100203682 233
675 3300031456 Ga0307513_10094414 Ga0307513_100944141 233
676 3300031456 Ga0307513_10358370 Ga0307513_103583702 233
677 3300031507 Ga0307509_10001516 Ga0307509_1000151615 233
678 3300031507 Ga0307509_10233057 Ga0307509_102330572 233
679 3300031649 Ga0307514_10000225 Ga0307514_1000022595 233
680 3300031730 Ga0307516_10000386 Ga0307516_100003863 233
681 3300031824 Ga0307413_10175796 Ga0307413_101757962 233
682 3300031901 Ga0307406_10027094 Ga0307406_100270943 233
683 3300032005 Ga0307411_10266996 Ga0307411_102669962 233
684 3300037312 Ga0395899_0090357 Ga0395899_0090357_1215_1919 233
685 3300037312 Ga0395899_0107827 Ga0395899_0107827_1022_1726 233
686 3300037418 Ga0395900_0144518 Ga0395900_0144518_1667_2371 233
687 3300037418 Ga0395900_0166167 Ga0395900_0166167_105_806 233
688 3300037418 Ga0395900_0284319 Ga0395900_0284319_704_1405 233
689 3300037471 Ga0395905_0077695 Ga0395905_0077695_1732_2433 233
690 3300037471 Ga0395905_0164659 Ga0395905_0164659_1216_1920 233
691 3300037471 Ga0395905_0277013 Ga0395905_0277013_549_1250 233
692 3300038443 Ga0395901_0156880 Ga0395901_0156880_1223_1927 233
693 3300038443 Ga0395901_0328300 Ga0395901_0328300_813_1517 233
694 3300039437 Ga0436365_1078319 Ga0436365_1078319_459_1160 233
695 3300039447 Ga0436361_0376061 Ga0436361_0376061_126804_127505 233
696 3300041443 Ga0451789_1034659 Ga0451789_1034659_225_926 233
697 3300041459 Ga0451800_1561068 Ga0451800_1561068_363_1094 233
698 3300041486 Ga0451807_1197568 Ga0451807_1197568_18_794 233
699 3300042531 Ga0450918_000032 Ga0450918_000032_6385_7086 233
700 3300042876 Ga0451577_0165977 Ga0451577_0165977_852_1553 233
701 3300042876 Ga0451577_0263812 Ga0451577_0263812_646_1347 233
702 3300044673 Ga0453683_0141637 Ga0453683_0141637_260_961 233
703 3300044694 Ga0466963_0101280 Ga0466963_0101280_608_1438 233
704 3300044694 Ga0466963_0199946 Ga0466963_0199946_152_856 233
705 3300044901 Ga0466960_0045148 Ga0466960_0045148_519_1223 233
706 3300044901 Ga0466960_0083844 Ga0466960_0083844_729_1430 233
707 3300045051 Ga0451576_0526943 Ga0451576_0526943_421_1122 233
708 3300046475 Ga0495639_0135150 Ga0495639_0135150_455_1162 233
709 3300046492 Ga0495585_0000221 Ga0495585_0000221_10699_11400 233
710 3300046500 Ga0495596_0002792 Ga0495596_0002792_6040_6741 233
711 3300046506 Ga0495583_0000423 Ga0495583_0000423_17070_17771 233
712 3300046506 Ga0495583_0000423 Ga0495583_0000423_47135_47836 233
713 3300046506 Ga0495583_0096010 Ga0495583_0096010_276_977 233
714 3300046518 Ga0495631_0001877 Ga0495631_0001877_4827_5528 233
715 3300046522 Ga0495643_0010037 Ga0495643_0010037_2202_2903 233
716 3300046525 Ga0495663_0007041 Ga0495663_0007041_1015_1716 233
717 3300046533 Ga0495640_0227531 Ga0495640_0227531_88_789 233
718 3300046538 Ga0495609_0012392 Ga0495609_0012392_1753_2454 233
719 3300046539 Ga0495621_0022745 Ga0495621_0022745_483_1184 233
720 3300046539 Ga0495621_0033099 Ga0495621_0033099_1029_1730 233
721 3300046557 Ga0495622_0133718 Ga0495622_0133718_50_751 233
722 3300046615 Ga0495656_0146225 Ga0495656_0146225_331_1032 233
723 3300046660 Ga0495625_0198158 Ga0495625_0198158_513_1214 233
724 3300046794 Ga0495589_0065104 Ga0495589_0065104_690_1391 233
725 3300047318 Ga0495636_0059269 Ga0495636_0059269_390_1091 233
726 3300047321 Ga0495676_0048251 Ga0495676_0048251_2051_2752 233
727 3300047445 Ga0495677_0157428 Ga0495677_0157428_50_751 233
728 3300047469 Ga0495673_0044987 Ga0495673_0044987_508_1209 233
729 3300048918 Ga0496115_0124484 Ga0496115_0124484_377_1111 233
730 3300049128 Ga0501308_003257 Ga0501308_003257_740_1444 233
731 3300049162 Ga0501307_024941 Ga0501307_024941_13_717 233
732 3300049535 Ga0501319_010878 Ga0501319_010878_11_715 233
733 3300049536 Ga0501320_011576 Ga0501320_011576_198_902 233
734 3300049541 Ga0501325_003764 Ga0501325_003764_400_1101 233
735 3300049571 Ga0501034_0178519 Ga0501034_0178519_282_992 233
736 3300049649 Ga0501198_000058 Ga0501198_000058_13672_14373 233
737 3300049662 Ga0501222_000066 Ga0501222_000066_13813_14514 233
738 3300049679 Ga0501249_010174 Ga0501249_010174_1101_1802 233
739 3300049763 Ga0501266_000629 Ga0501266_000629_3180_3884 233
740 3300050489 nmdc:mga03683_145738_c1 nmdc:mga03683_145738_c1_190_921 233
741 3300050489 nmdc:mga03683_52218_c1 nmdc:mga03683_52218_c1_554_1255 233
742 3300050489 nmdc:mga03683_58200_c1 nmdc:mga03683_58200_c1_699_1421 233
743 3300050491 nmdc:mga00v17_13946_c1 nmdc:mga00v17_13946_c1_2900_3601 233
744 3300050492 nmdc:mga0yw44_103235_c1 nmdc:mga0yw44_103235_c1_1004_1708 233
745 3300050492 nmdc:mga0yw44_22523_c1 nmdc:mga0yw44_22523_c1_212_913 233
746 3300050492 nmdc:mga0yw44_288738_c1 nmdc:mga0yw44_288738_c1_383_1087 233
747 3300050493 nmdc:mga0k408_25881_c1 nmdc:mga0k408_25881_c1_2021_2743 233
748 3300050493 nmdc:mga0k408_30193_c1 nmdc:mga0k408_30193_c1_1741_2442 233
749 3300050496 nmdc:mga07m45_153534_c1 nmdc:mga07m45_153534_c1_106_807 233
750 3300050496 nmdc:mga07m45_173563_c1 nmdc:mga07m45_173563_c1_67_768 233
751 3300050508 nmdc:mga09592_320479_c1 nmdc:mga09592_320479_c1_613_1317 233
752 3300050510 nmdc:mga06r32_111993_c1 nmdc:mga06r32_111993_c1_1333_2037 233
753 3300050511 nmdc:mga08y16_234476_c1 nmdc:mga08y16_234476_c1_188_892 233
754 3300050511 nmdc:mga08y16_505392_c1 nmdc:mga08y16_505392_c1_489_1211 233
755 3300053093 Ga0500651_0012255 Ga0500651_0012255_570_1271 233
756 3300053096 Ga0500641_0071149 Ga0500641_0071149_418_1119 233
757 3300053117 Ga0500593_000343 Ga0500593_000343_7335_8036 233
758 3300053136 Ga0500559_0001438 Ga0500559_0001438_7422_8123 233
759 3300054114 Ga0501084_0081031 Ga0501084_0081031_583_1284 233
760 3300059421 Ga0590071_010055 Ga0590071_010055_539_1276 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

189

274

0.99

PF02678

Pirin

Pirin

46

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9732 1 233
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9702 1 233
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9619 1 233
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9569 1 233
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.8885 39 120
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9868 11 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9847 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9787 11 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9686 13 131 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9588 40 120 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Y1J1V3-F1-model_v4 deleted 0.9995 1 233
AF-A0A0K8NZF1-F1-model_v4 Pirin 0.9983 1 233 GO:0046872
AF-A0A258LRN3-F1-model_v4 Quercetin 2,3-dioxygenase 0.9976 52 233 GO:0046872
GO:0051213
AF-A0A850QIQ9-F1-model_v4 Pirin family protein 0.9969 1 233 GO:0046872
AF-A0A354XYT3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9967 5 136

Feature Viewer

pLDDT pTM Quality
96.27 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map