F479351

General Info

Members Datasets Scaffolds Average Seq Length
756 336 1512 274

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0097102|Ga0316584_0097102_479_1438
Length 319
Sequence VYTRCWGQVLIFQEAGRFLEAKTPVPFAADSFRIQASLDEVSMTDNGADQGLFSVAGKVALVTGGTGVLGGAMAHGLAAAGAKVAIMGRRKERAAQVAREIVEQGGEAMPLPADVLDKDQLIAAKEDLVSTWGALDIMVNAAGGNSAAATVMPDQSFFDMAPDAFEQMLQLNLVGTVLPIQVFGPLLVEDGHGAIVNISSMTAIRPLTRVAGYGAAKASIDNFTRWLAVELIAKHGEGVRVNAIAPGFFIGEQNRDFLLNPDGTPTARGKVIVEHTPMGRFGEPEELVGTLLWLCSDASRFVTGVVVPVDGGFSVFAGV

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
228 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
291 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
302 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
303 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
304 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
305 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
306 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
327 2738543012 Acidovorax sp. CF301 Isolate Unclassified
328 2831426010 Nostoc sp. 106C Isolate Unclassified
329 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
330 2849660919 Nostoc sp. T09 Isolate Unclassified
331 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
332 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
333 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
334 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
335 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
336 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0.53
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.46
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0097102 3300036712 Unclassified 2206
2 SwRhRL3b_contig_3755293 2162886006 Bacteria 988
3 SwRhRL3b_contig_457262 2162886006 Bacteria 1086
4 SwRhRL2b_contig_3385910 2162886007 Bacteria 1027
5 rootL2_10066076 3300003322 Bacteria 2397
6 Ga0065704_10071963 3300005289 Bacteria 9451
7 Ga0065707_10102778 3300005295 Bacteria 2785
8 Ga0070676_10219599 3300005328 Bacteria 1255
9 Ga0070683_100002131 3300005329 Bacteria 15633
10 Ga0070683_100020655 3300005329 Bacteria 5862
11 Ga0070683_100053685 3300005329 Bacteria 3735
12 Ga0070683_100182180 3300005329 Bacteria 1994
13 Ga0070690_100002800 3300005330 Bacteria 9415
14 Ga0070690_100089427 3300005330 Bacteria 2025
15 Ga0070670_100029948 3300005331 Bacteria 4687
16 Ga0070670_100360616 3300005331 Bacteria 1278
17 Ga0068869_100173820 3300005334 Bacteria 1684
18 Ga0068869_100174660 3300005334 Bacteria 1680
19 Ga0070666_10080599 3300005335 Bacteria 2225
20 Ga0070680_100056327 3300005336 Bacteria 3214
21 Ga0070682_100015565 3300005337 Bacteria 4410
22 Ga0068868_100011793 3300005338 Bacteria 6371
23 Ga0068868_100022889 3300005338 Bacteria 4723
24 Ga0070689_100011455 3300005340 Bacteria 6354
25 Ga0070689_100047355 3300005340 Bacteria 3315
26 Ga0070689_100125171 3300005340 Bacteria 2056
27 Ga0070691_10008408 3300005341 Bacteria 4726
28 Ga0070691_10052672 3300005341 Unclassified 1946
29 Ga0070691_10075052 3300005341 Bacteria 1646
30 Ga0070687_100035862 3300005343 Bacteria 2467
31 Ga0070687_100326772 3300005343 Bacteria 982
32 Ga0070692_10043668 3300005345 Bacteria 2306
33 Ga0070668_100004428 3300005347 Bacteria 10426
34 Ga0070669_100002653 3300005353 Bacteria 12898
35 Ga0070669_100012904 3300005353 Bacteria 5934
36 Ga0070669_100050280 3300005353 Bacteria 3044
37 Ga0070675_100001221 3300005354 Bacteria 18688
38 Ga0070675_100240610 3300005354 Bacteria 1581
39 Ga0070674_100009404 3300005356 Bacteria 5851
40 Ga0070673_100016861 3300005364 Bacteria 5179
41 Ga0070688_100004105 3300005365 Bacteria 7556
42 Ga0070659_100000542 3300005366 Bacteria 27536
43 Ga0070659_100023719 3300005366 Bacteria 4698
44 Ga0070667_100051069 3300005367 Bacteria 3486
45 Ga0070667_100062597 3300005367 Bacteria 3152
46 Ga0070709_10005957 3300005434 Bacteria 6619
47 Ga0070709_10009752 3300005434 Bacteria 5304
48 Ga0070709_10292755 3300005434 Bacteria 1187
49 Ga0070714_100018322 3300005435 Bacteria 5686
50 Ga0070714_100022127 3300005435 Bacteria 5210
51 Ga0070714_100100065 3300005435 Bacteria 2553
52 Ga0070713_100000644 3300005436 Bacteria 22268
53 Ga0070713_100010845 3300005436 Bacteria 6605
54 Ga0070713_100025732 3300005436 Bacteria 4607
55 Ga0070713_100028119 3300005436 Bacteria 4437
56 Ga0070713_100107080 3300005436 Bacteria 2431
57 Ga0070710_10075547 3300005437 Bacteria 1953
58 Ga0070701_10001338 3300005438 Bacteria 9081
59 Ga0070711_100091702 3300005439 Bacteria 2191
60 Ga0070711_100347243 3300005439 Bacteria 1192
61 Ga0070705_100009893 3300005440 Bacteria 4755
62 Ga0070705_100084690 3300005440 Bacteria 1957
63 Ga0070705_100122437 3300005440 Bacteria 1682
64 Ga0070700_100002973 3300005441 Bacteria 8697
65 Ga0070708_100000017 3300005445 Bacteria 120364
66 Ga0070708_100081484 3300005445 Bacteria 2930
67 Ga0070708_100351505 3300005445 Unclassified 1389
68 Ga0070662_100001369 3300005457 Bacteria 14981
69 Ga0070662_100003796 3300005457 Bacteria 9448
70 Ga0070662_100031467 3300005457 Bacteria 3724
71 Ga0070662_100161464 3300005457 Bacteria 1753
72 Ga0070681_10075128 3300005458 Bacteria 3339
73 Ga0070681_10201521 3300005458 Bacteria 1908
74 Ga0070681_10381144 3300005458 Bacteria 1321
75 Ga0068867_100049818 3300005459 Bacteria 3084
76 Ga0068867_100061905 3300005459 Bacteria 2779
77 Ga0068867_100083187 3300005459 Bacteria 2416
78 Ga0070685_10008046 3300005466 Bacteria 5404
79 Ga0070706_100011641 3300005467 Bacteria 8171
80 Ga0070706_100023800 3300005467 Bacteria 5638
81 Ga0070706_100094274 3300005467 Bacteria 2778
82 Ga0070706_100387088 3300005467 Bacteria 1302
83 Ga0070707_100000423 3300005468 Bacteria 41848
84 Ga0070707_100001659 3300005468 Bacteria 21551
85 Ga0070707_100028523 3300005468 Bacteria 5313
86 Ga0070707_100189540 3300005468 Unclassified 2005
87 Ga0070707_100268261 3300005468 Unclassified 1660
88 Ga0070707_100281795 3300005468 Bacteria 1615
89 Ga0070698_100005376 3300005471 Bacteria 14003
90 Ga0070699_100179205 3300005518 Bacteria 1880
91 Ga0070699_100715738 3300005518 Bacteria 915
92 Ga0070679_100019988 3300005530 Bacteria 6524
93 Ga0070679_100043999 3300005530 Bacteria 4447
94 Ga0070679_100283711 3300005530 Bacteria 1608
95 Ga0070679_100463909 3300005530 Bacteria 1211
96 Ga0070679_100545343 3300005530 Unclassified 1103
97 Ga0070684_100000189 3300005535 Bacteria 42780
98 Ga0070684_100008507 3300005535 Bacteria 8026
99 Ga0070684_100025423 3300005535 Bacteria 4977
100 Ga0070684_100168777 3300005535 Bacteria 1987
101 Ga0070684_100199609 3300005535 Bacteria 1822
102 Ga0070697_100040456 3300005536 Bacteria 3772
103 Ga0070697_100388051 3300005536 Bacteria 1210
104 Ga0070672_100006852 3300005543 Bacteria 7697
105 Ga0070672_100116410 3300005543 Bacteria 2184
106 Ga0070686_100000084 3300005544 Bacteria 67713
107 Ga0070686_100001150 3300005544 Bacteria 15180
108 Ga0070686_100102271 3300005544 Bacteria 1938
109 Ga0070695_100102571 3300005545 Bacteria 1929
110 Ga0070695_100222609 3300005545 Bacteria 1360
111 Ga0070693_100049850 3300005547 Bacteria 2391
112 Ga0068855_100025404 3300005563 Bacteria 7087
113 Ga0068855_100033409 3300005563 Bacteria 6139
114 Ga0068855_100244652 3300005563 Bacteria 2003
115 Ga0070664_100039798 3300005564 Bacteria 3962
116 Ga0070664_100114907 3300005564 Bacteria 2352
117 Ga0070664_100141229 3300005564 Bacteria 2121
118 Ga0068857_100000218 3300005577 Bacteria 37864
119 Ga0068857_100011133 3300005577 Bacteria 7822
120 Ga0068857_100015248 3300005577 Bacteria 6708
121 Ga0068857_100034632 3300005577 Bacteria 4467
122 Ga0068854_100104386 3300005578 Unclassified 2129
123 Ga0068856_100007078 3300005614 Bacteria 10952
124 Ga0068856_100090475 3300005614 Bacteria 3044
125 Ga0068856_100105701 3300005614 Bacteria 2809
126 Ga0070702_100110745 3300005615 Bacteria 1702
127 Ga0068859_100020526 3300005617 Bacteria 6629
128 Ga0068859_100151775 3300005617 Bacteria 2392
129 Ga0068859_100162979 3300005617 Bacteria 2309
130 Ga0068864_100014517 3300005618 Bacteria 6543
131 Ga0068866_10070649 3300005718 Bacteria 1844
132 Ga0068861_100004794 3300005719 Bacteria 9091
133 Ga0068861_100006018 3300005719 Bacteria 8246
134 Ga0068861_100698749 3300005719 Unclassified 942
135 Ga0068870_10030117 3300005840 Bacteria 2741
136 Ga0068870_10105378 3300005840 Bacteria 1601
137 Ga0068863_100033711 3300005841 Bacteria 4878
138 Ga0068858_100009561 3300005842 Bacteria 9249
139 Ga0068860_100095097 3300005843 Bacteria 2840
140 Ga0068860_100128421 3300005843 Bacteria 2431
141 Ga0068860_100698707 3300005843 Bacteria 1024
142 Ga0068862_100003693 3300005844 Bacteria 13084
143 Ga0068862_100010149 3300005844 Bacteria 7770
144 Ga0068862_100093053 3300005844 Bacteria 2628
145 Ga0068862_100334123 3300005844 Bacteria 1402
146 Ga0068862_100401610 3300005844 Bacteria 1282
147 Ga0081538_10004934 3300005981 Bacteria 12152
148 Ga0081538_10058411 3300005981 Unclassified 2237
149 Ga0081539_10006724 3300005985 Bacteria 10828
150 Ga0070717_10002194 3300006028 Bacteria 13713
151 Ga0070717_10006759 3300006028 Bacteria 8462
152 Ga0070717_10054225 3300006028 Bacteria 3306
153 Ga0070717_10188747 3300006028 Bacteria 1800
154 Ga0070712_100011781 3300006175 Bacteria 5557
155 Ga0070712_100260264 3300006175 Bacteria 1390
156 Ga0075367_10025988 3300006178 Bacteria 3316
157 Ga0097621_100027954 3300006237 Bacteria 4440
158 Ga0068871_100186364 3300006358 Bacteria 1786
159 Ga0075428_100121338 3300006844 Bacteria 2846
160 Ga0075431_100005824 3300006847 Bacteria 12187
161 Ga0075431_100059879 3300006847 Bacteria 3929
162 Ga0075431_100060424 3300006847 Unclassified 3910
163 Ga0075431_100075773 3300006847 Bacteria 3471
164 Ga0075431_100198546 3300006847 Bacteria 2053
165 Ga0075431_100280113 3300006847 Bacteria 1688
166 Ga0075433_10257777 3300006852 Bacteria 1546
167 Ga0075433_10352332 3300006852 Bacteria 1301
168 Ga0075434_100564178 3300006871 Bacteria 1158
169 Ga0075429_100018221 3300006880 Bacteria 6077
170 Ga0075429_100045416 3300006880 Bacteria 3822
171 Ga0075429_100114920 3300006880 Unclassified 2353
172 Ga0075429_100181422 3300006880 Bacteria 1845
173 Ga0075429_100217311 3300006880 Bacteria 1675
174 Ga0068865_100002531 3300006881 Bacteria 10828
175 Ga0075436_100000008 3300006914 Bacteria 279288
176 Ga0097620_100020525 3300006931 Bacteria 6629
177 Ga0097620_100162972 3300006931 Bacteria 2309
178 Ga0075435_100011176 3300007076 Bacteria 6588
179 Ga0075435_100565414 3300007076 Bacteria 985
180 Ga0105240_10299268 3300009093 Bacteria 1841
181 Ga0111539_10034067 3300009094 Bacteria 6179
182 Ga0111539_10037944 3300009094 Bacteria 5811
183 Ga0111539_10277950 3300009094 Bacteria 1948
184 Ga0111539_10278763 3300009094 Bacteria 1945
185 Ga0111539_10310152 3300009094 Bacteria 1836
186 Ga0111539_10522275 3300009094 Bacteria 1383
187 Ga0105245_10000992 3300009098 Bacteria 25809
188 Ga0105245_10013041 3300009098 Bacteria 7241
189 Ga0105245_10196402 3300009098 Bacteria 1936
190 Ga0114129_10003771 3300009147 Bacteria 21375
191 Ga0114129_10339861 3300009147 Unclassified 1991
192 Ga0114129_11061829 3300009147 Bacteria 1016
193 Ga0105243_10344884 3300009148 Bacteria 1365
194 Ga0105241_10058808 3300009174 Bacteria 2953
195 Ga0105241_10158174 3300009174 Bacteria 1860
196 Ga0105242_10355554 3300009176 Bacteria 1354
197 Ga0105248_10030735 3300009177 Bacteria 5999
198 Ga0105248_10256521 3300009177 Bacteria 1968
199 Ga0105248_10435225 3300009177 Bacteria 1477
200 Ga0105237_10093925 3300009545 Bacteria 2989
201 Ga0105238_10087373 3300009551 Bacteria 3105
202 Ga0105249_10004305 3300009553 Bacteria 12305
203 Ga0105249_10084088 3300009553 Bacteria 2963
204 Ga0105249_10181183 3300009553 Bacteria 2050
205 Ga0105249_10374951 3300009553 Bacteria 1447
206 Ga0105239_10034069 3300010375 Bacteria 5591
207 Ga0157371_10104266 3300013102 Bacteria 2012
208 Ga0157370_10002998 3300013104 Bacteria 20044
209 Ga0157369_10004434 3300013105 Bacteria 16566
210 Ga0157374_10102074 3300013296 Bacteria 2750
211 Ga0157378_10087918 3300013297 Bacteria 2819
212 Ga0157378_10102726 3300013297 Bacteria 2611
213 Ga0163162_10235506 3300013306 Bacteria 1961
214 Ga0163162_10312581 3300013306 Bacteria 1704
215 Ga0163162_10344924 3300013306 Bacteria 1622
216 Ga0163162_10489675 3300013306 Bacteria 1361
217 Ga0157372_10004438 3300013307 Bacteria 14962
218 Ga0157372_10013512 3300013307 Bacteria 8726
219 Ga0157372_10042341 3300013307 Bacteria 5036
220 Ga0157372_10166661 3300013307 Unclassified 2548
221 Ga0157372_10420877 3300013307 Unclassified 1557
222 Ga0157375_10011814 3300013308 Bacteria 7721
223 Ga0157375_10024029 3300013308 Bacteria 5634
224 Ga0157375_10064145 3300013308 Bacteria 3656
225 Ga0157375_10300631 3300013308 Bacteria 1768
226 Ga0163163_10399910 3300014325 Bacteria 1432
227 Ga0157380_10004685 3300014326 Bacteria 9525
228 Ga0157380_10072086 3300014326 Bacteria 2797
229 Ga0157380_10284018 3300014326 Bacteria 1516
230 Ga0157380_10473288 3300014326 Unclassified 1209
231 Ga0157376_10017643 3300014969 Bacteria 5451
232 Ga0206349_1021214 3300020075 Bacteria 2614
233 Ga0206351_10214976 3300020077 Bacteria 2302
234 Ga0213874_10038735 3300021377 Bacteria 1416
235 Ga0213876_10000422 3300021384 Bacteria 35278
236 Ga0213875_10043471 3300021388 Bacteria 2110
237 Ga0224712_10003705 3300022467 Bacteria 4015
238 Ga0224712_10017120 3300022467 Bacteria 2397
239 Ga0207666_1006577 3300025271 Bacteria 1511
240 Ga0207697_10166163 3300025315 Bacteria 964
241 Ga0207692_10108241 3300025898 Unclassified 1537
242 Ga0207642_10029077 3300025899 Bacteria 2284
243 Ga0207680_10253945 3300025903 Bacteria 1215
244 Ga0207647_10120299 3300025904 Bacteria 1548
245 Ga0207699_10002389 3300025906 Bacteria 8861
246 Ga0207699_10029634 3300025906 Bacteria 3054
247 Ga0207645_10004858 3300025907 Bacteria 9864
248 Ga0207643_10093499 3300025908 Bacteria 1755
249 Ga0207684_10004086 3300025910 Bacteria 13909
250 Ga0207684_10006772 3300025910 Bacteria 10394
251 Ga0207684_10028825 3300025910 Bacteria 4728
252 Ga0207684_10177950 3300025910 Bacteria 1834
253 Ga0207707_10008698 3300025912 Bacteria 8811
254 Ga0207707_10010052 3300025912 Bacteria 8207
255 Ga0207707_10123864 3300025912 Bacteria 2260
256 Ga0207707_10295321 3300025912 Bacteria 1402
257 Ga0207695_10005313 3300025913 Bacteria 17157
258 Ga0207693_10015487 3300025915 Bacteria 6118
259 Ga0207660_10021678 3300025917 Bacteria 4323
260 Ga0207662_10007422 3300025918 Bacteria 5970
261 Ga0207662_10024684 3300025918 Bacteria 3459
262 Ga0207657_10071102 3300025919 Bacteria 2947
263 Ga0207652_10022504 3300025921 Bacteria 5215
264 Ga0207652_10038989 3300025921 Bacteria 4030
265 Ga0207652_10073005 3300025921 Bacteria 2984
266 Ga0207652_10224120 3300025921 Bacteria 1694
267 Ga0207652_10491624 3300025921 Bacteria 1105
268 Ga0207646_10000759 3300025922 Bacteria 41860
269 Ga0207646_10021798 3300025922 Bacteria 5911
270 Ga0207646_10128685 3300025922 Unclassified 2278
271 Ga0207681_10005309 3300025923 Bacteria 7916
272 Ga0207681_10034967 3300025923 Bacteria 3308
273 Ga0207694_10068221 3300025924 Bacteria 2777
274 Ga0207650_10014997 3300025925 Bacteria 5390
275 Ga0207659_10015233 3300025926 Bacteria 4976
276 Ga0207687_10003713 3300025927 Bacteria 10274
277 Ga0207687_10005579 3300025927 Bacteria 8314
278 Ga0207700_10005353 3300025928 Bacteria 7660
279 Ga0207700_10011557 3300025928 Bacteria 5636
280 Ga0207700_10017851 3300025928 Bacteria 4749
281 Ga0207700_10069468 3300025928 Bacteria 2704
282 Ga0207700_10089194 3300025928 Bacteria 2430
283 Ga0207700_10116617 3300025928 Bacteria 2158
284 Ga0207700_10178804 3300025928 Bacteria 1775
285 Ga0207664_10014420 3300025929 Bacteria 5706
286 Ga0207664_10128168 3300025929 Bacteria 2133
287 Ga0207690_10000668 3300025932 Bacteria 21960
288 Ga0207690_10010808 3300025932 Bacteria 5439
289 Ga0207706_10013624 3300025933 Bacteria 7385
290 Ga0207706_10039015 3300025933 Bacteria 4212
291 Ga0207706_10093627 3300025933 Bacteria 2642
292 Ga0207709_10637680 3300025935 Bacteria 847
293 Ga0207670_10003568 3300025936 Bacteria 8262
294 Ga0207670_10151340 3300025936 Bacteria 1722
295 Ga0207669_10000882 3300025937 Bacteria 12697
296 Ga0207669_10164729 3300025937 Bacteria 1571
297 Ga0207704_10002528 3300025938 Bacteria 8243
298 Ga0207691_10003103 3300025940 Bacteria 16223
299 Ga0207711_10164990 3300025941 Bacteria 2007
300 Ga0207689_10011603 3300025942 Bacteria 7549
301 Ga0207689_10147892 3300025942 Bacteria 1936
302 Ga0207661_10005786 3300025944 Bacteria 8718
303 Ga0207661_10023436 3300025944 Bacteria 4664
304 Ga0207661_10050549 3300025944 Bacteria 3312
305 Ga0207661_10106323 3300025944 Bacteria 2365
306 Ga0207679_10013719 3300025945 Bacteria 5313
307 Ga0207679_10051245 3300025945 Bacteria 3021
308 Ga0207667_10023459 3300025949 Bacteria 6793
309 Ga0207651_10047297 3300025960 Bacteria 2900
310 Ga0207712_10058827 3300025961 Bacteria 2717
311 Ga0207712_10151853 3300025961 Bacteria 1790
312 Ga0207668_10015516 3300025972 Bacteria 4735
313 Ga0207668_10203942 3300025972 Bacteria 1577
314 Ga0207658_10010275 3300025986 Bacteria 6360
315 Ga0207677_10080500 3300026023 Bacteria 2334
316 Ga0207703_10030733 3300026035 Bacteria 4244
317 Ga0207708_10001712 3300026075 Bacteria 16232
318 Ga0207708_10094193 3300026075 Bacteria 2312
319 Ga0207708_10095028 3300026075 Bacteria 2302
320 Ga0207702_10002092 3300026078 Bacteria 19254
321 Ga0207702_10002412 3300026078 Bacteria 17778
322 Ga0207702_10171962 3300026078 Bacteria 1987
323 Ga0207702_10302182 3300026078 Bacteria 1519
324 Ga0207641_10027946 3300026088 Bacteria 4659
325 Ga0207641_10899119 3300026088 Bacteria 879
326 Ga0207648_10018221 3300026089 Bacteria 6360
327 Ga0207648_10027889 3300026089 Bacteria 5010
328 Ga0207676_10003054 3300026095 Bacteria 11946
329 Ga0207676_10420612 3300026095 Bacteria 1253
330 Ga0207674_10000120 3300026116 Bacteria 91883
331 Ga0207674_10000366 3300026116 Bacteria 58754
332 Ga0207674_10006207 3300026116 Bacteria 14084
333 Ga0207674_10089473 3300026116 Bacteria 3071
334 Ga0207675_100002168 3300026118 Bacteria 19505
335 Ga0207675_100012609 3300026118 Bacteria 7897
336 Ga0207675_100192701 3300026118 Bacteria 1955
337 Ga0207675_100337858 3300026118 Bacteria 1474
338 Ga0207428_10075243 3300027907 Bacteria 2647
339 Ga0268265_10003865 3300028380 Bacteria 10576
340 Ga0268265_10094969 3300028380 Bacteria 2393
341 Ga0268265_10167452 3300028380 Bacteria 1874
342 Ga0268265_10841856 3300028380 Bacteria 897
343 Ga0268264_10075298 3300028381 Bacteria 2870
344 Ga0268264_10150506 3300028381 Bacteria 2086
345 Ga0268264_10560515 3300028381 Bacteria 1122
346 Ga0265334_10048236 3300028573 Bacteria 1641
347 Ga0265318_10000178 3300028577 Bacteria 56405
348 Ga0265318_10018767 3300028577 Bacteria 2816
349 Ga0265323_10004508 3300028653 Bacteria 6006
350 Ga0265323_10013823 3300028653 Bacteria 3211
351 Ga0265323_10041946 3300028653 Bacteria 1658
352 Ga0265336_10023827 3300028666 Bacteria 1938
353 Ga0265338_10005521 3300028800 Bacteria 16486
354 Ga0265338_10056870 3300028800 Bacteria 3464
355 Ga0265330_10000164 3300031235 Bacteria 52665
356 Ga0265330_10000645 3300031235 Bacteria 22423
357 Ga0265330_10000982 3300031235 Bacteria 17423
358 Ga0265330_10001395 3300031235 Bacteria 14130
359 Ga0265330_10007773 3300031235 Bacteria 5206
360 Ga0265330_10024432 3300031235 Bacteria 2741
361 Ga0265332_10000226 3300031238 Bacteria 45357
362 Ga0265332_10017126 3300031238 Bacteria 3197
363 Ga0265332_10022056 3300031238 Bacteria 2810
364 Ga0265328_10000594 3300031239 Bacteria 16800
365 Ga0265320_10000158 3300031240 Bacteria 56439
366 Ga0265320_10003882 3300031240 Bacteria 9897
367 Ga0265320_10005336 3300031240 Bacteria 8265
368 Ga0265325_10000338 3300031241 Bacteria 33218
369 Ga0265329_10000550 3300031242 Bacteria 19351
370 Ga0265329_10000905 3300031242 Bacteria 14872
371 Ga0265329_10002438 3300031242 Bacteria 8420
372 Ga0265329_10044046 3300031242 Bacteria 1427
373 Ga0265340_10009098 3300031247 Bacteria 5341
374 Ga0265340_10026018 3300031247 Bacteria 2961
375 Ga0265339_10012831 3300031249 Bacteria 5094
376 Ga0265339_10029579 3300031249 Bacteria 3108
377 Ga0265339_10044607 3300031249 Bacteria 2445
378 Ga0265339_10127295 3300031249 Bacteria 1305
379 Ga0265331_10000283 3300031250 Bacteria 56424
380 Ga0265316_10000530 3300031344 Bacteria 43046
381 Ga0265316_10000837 3300031344 Bacteria 34100
382 Ga0265316_10000918 3300031344 Bacteria 32093
383 Ga0265316_10000968 3300031344 Bacteria 31294
384 Ga0265316_10001094 3300031344 Bacteria 29360
385 Ga0265316_10001828 3300031344 Bacteria 22390
386 Ga0265316_10003413 3300031344 Bacteria 16073
387 Ga0265316_10008905 3300031344 Bacteria 9266
388 Ga0265316_10011363 3300031344 Bacteria 8038
389 Ga0265316_10014446 3300031344 Bacteria 6948
390 Ga0265316_10041565 3300031344 Bacteria 3678
391 Ga0265316_10137200 3300031344 Bacteria 1840
392 Ga0265316_10474058 3300031344 Bacteria 896
393 Ga0307408_100048383 3300031548 Unclassified 3050
394 Ga0307408_100141051 3300031548 Bacteria 1892
395 Ga0265313_10000434 3300031595 Bacteria 44323
396 Ga0265313_10000516 3300031595 Bacteria 40397
397 Ga0265313_10003119 3300031595 Bacteria 13692
398 Ga0265313_10069335 3300031595 Bacteria 1627
399 Ga0316575_10002464 3300031665 Bacteria 6225
400 Ga0316579_10064493 3300031691 Bacteria 1728
401 Ga0316579_10115633 3300031691 Unclassified 1288
402 Ga0265314_10000427 3300031711 Bacteria 56422
403 Ga0265314_10003291 3300031711 Bacteria 15782
404 Ga0265314_10004747 3300031711 Bacteria 12458
405 Ga0265314_10013708 3300031711 Bacteria 6535
406 Ga0265314_10028744 3300031711 Bacteria 4141
407 Ga0265314_10203891 3300031711 Bacteria 1167
408 Ga0265342_10000091 3300031712 Bacteria 99171
409 Ga0265342_10000236 3300031712 Bacteria 61931
410 Ga0265342_10000495 3300031712 Bacteria 42361
411 Ga0265342_10001020 3300031712 Bacteria 27589
412 Ga0265342_10002502 3300031712 Bacteria 15832
413 Ga0265342_10004150 3300031712 Bacteria 11533
414 Ga0265342_10004929 3300031712 Bacteria 10307
415 Ga0265342_10069145 3300031712 Bacteria 2062
416 Ga0265342_10101930 3300031712 Bacteria 1634
417 Ga0316576_10007551 3300031727 Bacteria 6860
418 Ga0316576_10007959 3300031727 Bacteria 6714
419 Ga0316576_10067782 3300031727 Bacteria 2628
420 Ga0316576_10233435 3300031727 Unclassified 1383
421 Ga0316578_10012016 3300031728 Bacteria 4555
422 Ga0316578_10064514 3300031728 Bacteria 2162
423 Ga0316578_10093335 3300031728 Bacteria 1800
424 Ga0316578_10174165 3300031728 Bacteria 1297
425 Ga0316577_10010055 3300031733 Bacteria 5100
426 Ga0316577_10013010 3300031733 Bacteria 4540
427 Ga0316577_10015694 3300031733 Bacteria 4167
428 Ga0316577_10018126 3300031733 Bacteria 3891
429 Ga0316577_10027251 3300031733 Bacteria 3185
430 Ga0316577_10035035 3300031733 Bacteria 2805
431 Ga0316577_10038636 3300031733 Unclassified 2669
432 Ga0316577_10061014 3300031733 Bacteria 2104
433 Ga0316577_10076812 3300031733 Bacteria 1865
434 Ga0316577_10084872 3300031733 Bacteria 1772
435 Ga0316577_10168613 3300031733 Bacteria 1235
436 Ga0316577_10204286 3300031733 Bacteria 1117
437 Ga0316577_10205991 3300031733 Bacteria 1112
438 Ga0307413_10113642 3300031824 Bacteria 1818
439 Ga0307410_10182846 3300031852 Bacteria 1588
440 Ga0307407_10025229 3300031903 Bacteria 3130
441 Ga0307407_10178993 3300031903 Bacteria 1404
442 Ga0307412_10062051 3300031911 Bacteria 2515
443 Ga0307409_100551314 3300031995 Bacteria 1132
444 Ga0307416_100043038 3300032002 Bacteria 3532
445 Ga0307411_10063582 3300032005 Unclassified 2467
446 Ga0307415_100187466 3300032126 Bacteria 1629
447 Ga0307415_100304119 3300032126 Unclassified 1322
448 Ga0316580_10044971 3300032139 Bacteria 1362
449 Ga0373926_0009943 3300035083 Bacteria 3185
450 Ga0373926_0047916 3300035083 Bacteria 1536
451 Ga0373934_0005155 3300035086 Bacteria 4841
452 Ga0373934_0010621 3300035086 Bacteria 3458
453 Ga0373944_0009883 3300035089 Bacteria 2594
454 Ga0373923_0003831 3300035111 Bacteria 4895
455 Ga0373945_0001777 3300035116 Bacteria 6659
456 Ga0373945_0079117 3300035116 Bacteria 1257
457 Ga0373953_0091555 3300035117 Bacteria 1272
458 Ga0373953_0100575 3300035117 Bacteria 1216
459 Ga0373953_0169520 3300035117 Bacteria 939
460 Ga0373954_0008997 3300035118 Bacteria 4394
461 Ga0373954_0040372 3300035118 Bacteria 2174
462 Ga0373954_0061910 3300035118 Bacteria 1767
463 Ga0373954_0068112 3300035118 Bacteria 1688
464 Ga0373956_0001279 3300035119 Bacteria 10425
465 Ga0373956_0077885 3300035119 Bacteria 1518
466 Ga0373957_0024042 3300035120 Bacteria 2184
467 Ga0373957_0031047 3300035120 Bacteria 1961
468 Ga0373957_0042289 3300035120 Bacteria 1719
469 Ga0373957_0056881 3300035120 Bacteria 1507
470 Ga0373943_0041765 3300035170 Bacteria 2219
471 Ga0373946_0028653 3300035171 Bacteria 2210
472 Ga0373955_0003339 3300035172 Bacteria 7051
473 Ga0373955_0005225 3300035172 Bacteria 5819
474 Ga0316574_0005803 3300035398 Bacteria 6621
475 Ga0316574_0036074 3300035398 Bacteria 3026
476 Ga0316574_0058020 3300035398 Unclassified 2425
477 Ga0316574_0350007 3300035398 Bacteria 935
478 Ga0373924_0002966 3300035410 Bacteria 5768
479 Ga0373931_0080503 3300035691 Bacteria 1796
480 Ga0373935_0140391 3300035692 Bacteria 1632
481 Ga0373927_0004165 3300035695 Bacteria 10164
482 Ga0373927_0021679 3300035695 Bacteria 4210
483 Ga0373933_0000071 3300035724 Bacteria 62531
484 Ga0373933_0002827 3300035724 Bacteria 9699
485 Ga0373933_0006888 3300035724 Bacteria 6191
486 Ga0373933_0026940 3300035724 Bacteria 3306
487 Ga0373933_0145970 3300035724 Bacteria 1496
488 Ga0373947_0000536 3300035725 Bacteria 22230
489 Ga0373947_0003376 3300035725 Bacteria 9447
490 Ga0373937_0000141 3300036401 Bacteria 69735
491 Ga0373937_0001599 3300036401 Bacteria 19042
492 Ga0373937_0010952 3300036401 Bacteria 7942
493 Ga0373937_0055944 3300036401 Bacteria 3622
494 Ga0373937_0199663 3300036401 Bacteria 1880
495 Ga0373937_0237430 3300036401 Bacteria 1717
496 Ga0316582_0001573 3300036647 Bacteria 10158
497 Ga0316582_0001967 3300036647 Bacteria 9403
498 Ga0316582_0002907 3300036647 Bacteria 8233
499 Ga0316582_0012828 3300036647 Bacteria 4694
500 Ga0316582_0015539 3300036647 Bacteria 4358
501 Ga0316582_0033750 3300036647 Bacteria 3146
502 Ga0316582_0084932 3300036647 Bacteria 2073
503 Ga0316582_0086300 3300036647 Unclassified 2058
504 Ga0316582_0108532 3300036647 Bacteria 1845
505 Ga0316582_0117457 3300036647 Bacteria 1777
506 Ga0316582_0196503 3300036647 Bacteria 1375
507 Ga0316582_0234567 3300036647 Bacteria 1256
508 Ga0316582_0248734 3300036647 Bacteria 1218
509 Ga0316582_0379225 3300036647 Bacteria 974
510 Ga0316584_0000161 3300036712 Bacteria 31222
511 Ga0316584_0004045 3300036712 Bacteria 9651
512 Ga0316584_0006407 3300036712 Bacteria 7968
513 Ga0316584_0011111 3300036712 Bacteria 6315
514 Ga0316584_0021002 3300036712 Bacteria 4742
515 Ga0316584_0035682 3300036712 Bacteria 3690
516 Ga0316584_0042074 3300036712 Bacteria 3406
517 Ga0316584_0053946 3300036712 Bacteria 3008
518 Ga0316584_0107666 3300036712 Bacteria 2086
519 Ga0316584_0108799 3300036712 Bacteria 2074
520 Ga0316584_0141617 3300036712 Bacteria 1793
521 Ga0316584_0161945 3300036712 Bacteria 1662
522 Ga0316584_0509316 3300036712 Bacteria 845
523 Ga0373925_0009561 3300037068 Bacteria 7062
524 Ga0373925_0656219 3300037068 Bacteria 865
525 Ga0395900_0288242 3300037418 Bacteria 1631
526 Ga0395905_0005426 3300037471 Bacteria 13027
527 Ga0395905_0532611 3300037471 Bacteria 1075
528 Ga0316581_0000595 3300037588 Bacteria 7147
529 Ga0316581_0003022 3300037588 Bacteria 4141
530 Ga0316581_0003775 3300037588 Bacteria 3806
531 Ga0316581_0004957 3300037588 Bacteria 3431
532 Ga0316581_0046255 3300037588 Bacteria 1330
533 Ga0316581_0048409 3300037588 Bacteria 1301
534 Ga0436364_0198679 3300037853 Bacteria 2531
535 Ga0395901_0006659 3300038443 Bacteria 11675
536 Ga0395901_0042233 3300038443 Bacteria 4727
537 Ga0237819_07077 3300038705 Bacteria 1636
538 Ga0400483_061585 3300039062 Bacteria 3334
539 Ga0400483_148375 3300039062 Bacteria 4862
540 Ga0400489_11819 3300039093 Bacteria 9617
541 Ga0400489_15711 3300039093 Bacteria 10276
542 Ga0400489_25754 3300039093 Bacteria 2785
543 Ga0400489_25858 3300039093 Bacteria 2449
544 Ga0400489_65167 3300039093 Bacteria 4627
545 Ga0400489_79360 3300039093 Bacteria 1814
546 Ga0400487_17497 3300039110 Bacteria 2777
547 Ga0436365_0301490 3300039437 Bacteria 5906
548 Ga0436365_0637502 3300039437 Bacteria 1658
549 Ga0436365_0873465 3300039437 Bacteria 246686
550 Ga0436363_0280714 3300039450 Bacteria 4273
551 Ga0451577_0000197 3300042876 Bacteria 126180
552 Ga0451577_0017683 3300042876 Bacteria 6581
553 Ga0451577_0032219 3300042876 Bacteria 4723
554 Ga0451577_0078601 3300042876 Bacteria 2941
555 Ga0451577_0099754 3300042876 Bacteria 2594
556 Ga0451577_0130933 3300042876 Bacteria 2250
557 Ga0451577_0152294 3300042876 Bacteria 2081
558 Ga0451577_0421566 3300042876 Unclassified 1212
559 Ga0451577_0496472 3300042876 Bacteria 1108
560 Ga0466969_0016606 3300044656 Bacteria 3850
561 Ga0453683_0000169 3300044673 Bacteria 90993
562 Ga0453683_0018122 3300044673 Bacteria 4522
563 Ga0453683_0060567 3300044673 Bacteria 2367
564 Ga0453683_0159473 3300044673 Bacteria 1427
565 Ga0466966_0010205 3300044684 Bacteria 6231
566 Ga0466961_0041464 3300044693 Bacteria 2951
567 Ga0466963_0217592 3300044694 Bacteria 1337
568 Ga0453684_0000393 3300044712 Bacteria 179711
569 Ga0453684_0000476 3300044712 Bacteria 159159
570 Ga0453684_0002622 3300044712 Bacteria 42982
571 Ga0453684_0004500 3300044712 Bacteria 29290
572 Ga0453684_0006175 3300044712 Bacteria 23014
573 Ga0453684_0006191 3300044712 Bacteria 22950
574 Ga0453684_0014058 3300044712 Bacteria 12878
575 Ga0453684_0021256 3300044712 Bacteria 9710
576 Ga0453684_0027265 3300044712 Bacteria 8200
577 Ga0453684_0044560 3300044712 Bacteria 5933
578 Ga0453684_0059927 3300044712 Bacteria 4902
579 Ga0453684_0099289 3300044712 Bacteria 3566
580 Ga0453684_0203964 3300044712 Unclassified 2303
581 Ga0453684_0291254 3300044712 Unclassified 1859
582 Ga0453684_0644187 3300044712 Bacteria 1157
583 Ga0453684_0653455 3300044712 Bacteria 1147
584 Ga0466971_0110696 3300044719 Bacteria 1267
585 Ga0466957_0030389 3300044842 Bacteria 3225
586 Ga0451576_0000145 3300045051 Bacteria 179711
587 Ga0451576_0001182 3300045051 Bacteria 46819
588 Ga0451576_0013401 3300045051 Bacteria 9172
589 Ga0451576_0130784 3300045051 Unclassified 2616
590 Ga0451576_0245881 3300045051 Bacteria 1869
591 Ga0451576_0275935 3300045051 Bacteria 1757
592 Ga0451576_0435570 3300045051 Bacteria 1376
593 Ga0451576_0794360 3300045051 Bacteria 994
594 Ga0466967_0001023 3300045976 Bacteria 15334
595 Ga0466967_0015155 3300045976 Bacteria 6034
596 Ga0466967_0055352 3300045976 Bacteria 3494
597 Ga0495592_0016891 3300046454 Bacteria 5542
598 Ga0495592_0097606 3300046454 Bacteria 2098
599 Ga0495603_0004951 3300046455 Bacteria 7972
600 Ga0495629_0022693 3300046459 Bacteria 4473
601 Ga0495629_0025318 3300046459 Bacteria 4219
602 Ga0495651_0000069 3300046462 Bacteria 75854
603 Ga0495651_0031688 3300046462 Bacteria 4122
604 Ga0495653_0000117 3300046463 Bacteria 65854
605 Ga0495653_0152105 3300046463 Unclassified 1616
606 Ga0495580_0135068 3300046472 Bacteria 1710
607 Ga0495582_0035148 3300046473 Bacteria 2755
608 Ga0495639_0001030 3300046475 Bacteria 12572
609 Ga0495639_0048900 3300046475 Archaea 1918
610 Ga0495662_0195821 3300046476 Bacteria 996
611 Ga0495664_0070386 3300046477 Bacteria 2089
612 Ga0495594_0003012 3300046499 Bacteria 8729
613 Ga0495594_0027621 3300046499 Bacteria 3059
614 Ga0495608_0000103 3300046511 Bacteria 60432
615 Ga0495628_0000082 3300046516 Bacteria 74118
616 Ga0495628_0051656 3300046516 Bacteria 3250
617 Ga0495630_0000666 3300046517 Bacteria 24813
618 Ga0495630_0001791 3300046517 Bacteria 14992
619 Ga0495643_0000173 3300046522 Bacteria 102549
620 Ga0495643_0085957 3300046522 Bacteria 1630
621 Ga0495652_0001484 3300046529 Bacteria 25898
622 Ga0495652_0363922 3300046529 Bacteria 1033
623 Ga0495665_0001803 3300046531 Bacteria 11535
624 Ga0495665_0231779 3300046531 Bacteria 953
625 Ga0495640_0079520 3300046533 Bacteria 2183
626 Ga0495640_0205076 3300046533 Bacteria 1248
627 Ga0495586_0048222 3300046535 Bacteria 2301
628 Ga0495587_0000147 3300046536 Bacteria 52763
629 Ga0495587_0000298 3300046536 Bacteria 35411
630 Ga0495645_0000061 3300046543 Bacteria 79047
631 Ga0495645_0001109 3300046543 Bacteria 18211
632 Ga0495622_0133847 3300046557 Bacteria 1128
633 Ga0495667_0000269 3300046559 Bacteria 33726
634 Ga0495667_0014755 3300046559 Bacteria 5280
635 Ga0495635_0000071 3300046663 Bacteria 63128
636 Ga0495659_0055110 3300046664 Bacteria 1456
637 Ga0495588_0033049 3300046674 Bacteria 2611
638 Ga0495588_0038331 3300046674 Bacteria 2437
639 Ga0495588_0040339 3300046674 Bacteria 2381
640 Ga0495657_0000366 3300046675 Bacteria 41737
641 Ga0495657_0167592 3300046675 Bacteria 1355
642 Ga0495657_0204942 3300046675 Bacteria 1201
643 Ga0495599_0000859 3300046678 Bacteria 16977
644 Ga0495599_0002136 3300046678 Bacteria 11486
645 Ga0495623_0000193 3300046679 Bacteria 38845
646 Ga0495623_0002351 3300046679 Bacteria 12585
647 Ga0495646_0007102 3300046680 Bacteria 7114
648 Ga0495658_0000148 3300046683 Bacteria 39132
649 Ga0495613_0023440 3300046689 Bacteria 4598
650 Ga0495613_0074533 3300046689 Bacteria 2471
651 Ga0495613_0156658 3300046689 Bacteria 1622
652 Ga0495613_0400515 3300046689 Bacteria 936
653 Ga0495613_0421768 3300046689 Bacteria 908
654 Ga0495600_0000133 3300046809 Bacteria 42147
655 Ga0495600_0017358 3300046809 Bacteria 4578
656 Ga0495581_0001652 3300047315 Bacteria 12429
657 Ga0495581_0016039 3300047315 Bacteria 4354
658 Ga0495604_0000028 3300047317 Bacteria 141804
659 Ga0495604_0216741 3300047317 Bacteria 1320
660 Ga0495674_0001137 3300047319 Bacteria 25628
661 Ga0495674_0011474 3300047319 Bacteria 8360
662 Ga0495674_0084975 3300047319 Bacteria 2711
663 Ga0495674_0149657 3300047319 Bacteria 1958
664 Ga0495674_0396217 3300047319 Bacteria 1115
665 Ga0495680_0019973 3300047322 Bacteria 5647
666 Ga0495680_0157174 3300047322 Bacteria 1653
667 Ga0495675_0001753 3300047444 Bacteria 12986
668 Ga0495675_0003478 3300047444 Bacteria 9483
669 Ga0495675_0160652 3300047444 Bacteria 1384
670 Ga0495684_0000044 3300047471 Bacteria 93511
671 Ga0495684_0011174 3300047471 Bacteria 6938
672 Ga0495684_0280920 3300047471 Bacteria 1201
673 Ga0495593_0000211 3300047673 Bacteria 30695
674 Ga0495602_0000414 3300048088 Bacteria 40006
675 Ga0495614_0000092 3300048089 Bacteria 30125
676 Ga0496101_0383372 3300048904 Bacteria 1106
677 Ga0496104_0027959 3300048907 Bacteria 5223
678 Ga0496104_0120774 3300048907 Bacteria 2516
679 Ga0496104_0146474 3300048907 Bacteria 2268
680 Ga0496109_0203162 3300048912 Bacteria 1863
681 Ga0496112_0000747 3300048915 Bacteria 22703
682 Ga0496112_0105623 3300048915 Bacteria 2786
683 Ga0496113_0066915 3300048916 Bacteria 2723
684 Ga0496113_0167168 3300048916 Bacteria 1741
685 Ga0496114_0004489 3300048917 Bacteria 10832
686 Ga0496114_0029255 3300048917 Bacteria 4526
687 Ga0501291_027508 3300049514 Unclassified 942
688 Ga0501300_001855 3300049523 Bacteria 3148
689 Ga0501033_0007612 3300049570 Bacteria 8422
690 Ga0501034_0074375 3300049571 Bacteria 3406
691 Ga0501034_0085121 3300049571 Bacteria 3163
692 Ga0501036_0221377 3300049572 Bacteria 1589
693 Ga0501037_0046411 3300049573 Bacteria 3186
694 Ga0501039_0139866 3300049575 Bacteria 1902
695 Ga0501043_0015605 3300049579 Bacteria 5954
696 Ga0501047_0046690 3300049581 Bacteria 4185
697 Ga0501047_0060492 3300049581 Bacteria 3655
698 Ga0501070_0168510 3300049586 Bacteria 1804
699 Ga0501073_0010701 3300049589 Bacteria 6720
700 Ga0501198_011727 3300049649 Bacteria 1311
701 Ga0501207_007528 3300049654 Unclassified 1554
702 Ga0501217_003247 3300049661 Unclassified 3274
703 Ga0501223_002407 3300049663 Bacteria 4169
704 Ga0501236_000948 3300049670 Unclassified 3272
705 Ga0501247_003384 3300049677 Bacteria 1707
706 Ga0501035_0000350 3300049822 Bacteria 52924
707 Ga0501035_0322267 3300049822 Bacteria 1298
708 Ga0501044_0002550 3300049823 Bacteria 20752
709 Ga0501044_0141704 3300049823 Bacteria 2392
710 nmdc:mga05p37_17980_c1 3300050507 Bacteria 8536
711 nmdc:mga05p37_278740_c1 3300050507 Unclassified 1995
712 nmdc:mga09592_111741_c1 3300050508 Bacteria 2344
713 nmdc:mga09592_114514_c1 3300050508 Bacteria 2314
714 nmdc:mga09592_4560_c1 3300050508 Bacteria 11211
715 nmdc:mga09592_487762_c1 3300050508 Bacteria 1061
716 nmdc:mga09592_62178_c1 3300050508 Bacteria 3158
717 nmdc:mga0qj67_80637_c1 3300050509 Bacteria 2608
718 nmdc:mga06r32_218316_c1 3300050510 Bacteria 1895
719 nmdc:mga06r32_24579_c1 3300050510 Bacteria 5595
720 nmdc:mga06r32_330694_c1 3300050510 Bacteria 1509
721 nmdc:mga06r32_70754_c1 3300050510 Bacteria 3375
722 nmdc:mga08y16_15747_c1 3300050511 Bacteria 7952
723 nmdc:mga08y16_24197_c1 3300050511 Bacteria 6410
724 nmdc:mga08y16_35168_c1 3300050511 Bacteria 5262
725 nmdc:mga08y16_534244_c1 3300050511 Bacteria 1188
726 nmdc:mga08y16_72264_c1 3300050511 Bacteria 3595
727 nmdc:mga0rr50_171825_c1 3300050513 Bacteria 1766
728 nmdc:mga0rr50_418636_c1 3300050513 Bacteria 1133
729 nmdc:mga0rr50_7858_c1 3300050513 Bacteria 6614
730 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
731 nmdc:mga0a205_155306_c1 3300050515 Bacteria 2187
732 Ga0495601_0002281 3300053077 Bacteria 10825
733 Ga0495601_0018513 3300053077 Bacteria 4241
734 Ga0495612_0005137 3300053078 Bacteria 5411
735 Ga0495612_0045946 3300053078 Bacteria 1788
736 Ga0495595_0137216 3300053084 Bacteria 1198
737 Ga0495619_0005505 3300053085 Bacteria 8032
738 Ga0495619_0117199 3300053085 Bacteria 1824
739 Ga0500645_038186 3300053730 Bacteria 1426
740 Ga0501084_0012175 3300054114 Bacteria 7120
741 Ga0501084_0061704 3300054114 Bacteria 3139
742 Ga0590071_003932 3300059421 Bacteria 3637
743 Ga0590075_001339 3300059424 Bacteria 6196
744 Ga0501082_0151461 3300060353 Unclassified 2015
745 Ga0501082_0306759 3300060353 Bacteria 1382
746 2617916016 2617270889 Bacteria 9064343
747 2739244792 2738543012 Bacteria 7115078
748 2831428391 2831426010 Bacteria 8662725
749 2848697274 2848694841 Bacteria 9205737
750 2849668275 2849660919 Bacteria 8251853
751 2886632920 2886627955 Bacteria 7618130
752 2913849126 2913844669 Bacteria 8381711
753 2913919487 2913912277 Bacteria 9037797
754 2913944107 2913939268 Bacteria 8559644
755 2977235548 2977232053 Bacteria 5485925
756 642604269 642555144 Bacteria 9059191
757 Ga0316584_0097102
758 SwRhRL3b_contig_3755293
759 SwRhRL3b_contig_457262
760 SwRhRL2b_contig_3385910
761 rootL2_10066076
762 Ga0065704_10071963
763 Ga0065707_10102778
764 Ga0070676_10219599
765 Ga0070683_100002131
766 Ga0070683_100020655
767 Ga0070683_100053685
768 Ga0070683_100182180
769 Ga0070690_100002800
770 Ga0070690_100089427
771 Ga0070670_100029948
772 Ga0070670_100360616
773 Ga0068869_100173820
774 Ga0068869_100174660
775 Ga0070666_10080599
776 Ga0070680_100056327
777 Ga0070682_100015565
778 Ga0068868_100011793
779 Ga0068868_100022889
780 Ga0070689_100011455
781 Ga0070689_100047355
782 Ga0070689_100125171
783 Ga0070691_10008408
784 Ga0070691_10052672
785 Ga0070691_10075052
786 Ga0070687_100035862
787 Ga0070687_100326772
788 Ga0070692_10043668
789 Ga0070668_100004428
790 Ga0070669_100002653
791 Ga0070669_100012904
792 Ga0070669_100050280
793 Ga0070675_100001221
794 Ga0070675_100240610
795 Ga0070674_100009404
796 Ga0070673_100016861
797 Ga0070688_100004105
798 Ga0070659_100000542
799 Ga0070659_100023719
800 Ga0070667_100051069
801 Ga0070667_100062597
802 Ga0070709_10005957
803 Ga0070709_10009752
804 Ga0070709_10292755
805 Ga0070714_100018322
806 Ga0070714_100022127
807 Ga0070714_100100065
808 Ga0070713_100000644
809 Ga0070713_100010845
810 Ga0070713_100025732
811 Ga0070713_100028119
812 Ga0070713_100107080
813 Ga0070710_10075547
814 Ga0070701_10001338
815 Ga0070711_100091702
816 Ga0070711_100347243
817 Ga0070705_100009893
818 Ga0070705_100084690
819 Ga0070705_100122437
820 Ga0070700_100002973
821 Ga0070708_100000017
822 Ga0070708_100081484
823 Ga0070708_100351505
824 Ga0070662_100001369
825 Ga0070662_100003796
826 Ga0070662_100031467
827 Ga0070662_100161464
828 Ga0070681_10075128
829 Ga0070681_10201521
830 Ga0070681_10381144
831 Ga0068867_100049818
832 Ga0068867_100061905
833 Ga0068867_100083187
834 Ga0070685_10008046
835 Ga0070706_100011641
836 Ga0070706_100023800
837 Ga0070706_100094274
838 Ga0070706_100387088
839 Ga0070707_100000423
840 Ga0070707_100001659
841 Ga0070707_100028523
842 Ga0070707_100189540
843 Ga0070707_100268261
844 Ga0070707_100281795
845 Ga0070698_100005376
846 Ga0070699_100179205
847 Ga0070699_100715738
848 Ga0070679_100019988
849 Ga0070679_100043999
850 Ga0070679_100283711
851 Ga0070679_100463909
852 Ga0070679_100545343
853 Ga0070684_100000189
854 Ga0070684_100008507
855 Ga0070684_100025423
856 Ga0070684_100168777
857 Ga0070684_100199609
858 Ga0070697_100040456
859 Ga0070697_100388051
860 Ga0070672_100006852
861 Ga0070672_100116410
862 Ga0070686_100000084
863 Ga0070686_100001150
864 Ga0070686_100102271
865 Ga0070695_100102571
866 Ga0070695_100222609
867 Ga0070693_100049850
868 Ga0068855_100025404
869 Ga0068855_100033409
870 Ga0068855_100244652
871 Ga0070664_100039798
872 Ga0070664_100114907
873 Ga0070664_100141229
874 Ga0068857_100000218
875 Ga0068857_100011133
876 Ga0068857_100015248
877 Ga0068857_100034632
878 Ga0068854_100104386
879 Ga0068856_100007078
880 Ga0068856_100090475
881 Ga0068856_100105701
882 Ga0070702_100110745
883 Ga0068859_100020526
884 Ga0068859_100151775
885 Ga0068859_100162979
886 Ga0068864_100014517
887 Ga0068866_10070649
888 Ga0068861_100004794
889 Ga0068861_100006018
890 Ga0068861_100698749
891 Ga0068870_10030117
892 Ga0068870_10105378
893 Ga0068863_100033711
894 Ga0068858_100009561
895 Ga0068860_100095097
896 Ga0068860_100128421
897 Ga0068860_100698707
898 Ga0068862_100003693
899 Ga0068862_100010149
900 Ga0068862_100093053
901 Ga0068862_100334123
902 Ga0068862_100401610
903 Ga0081538_10004934
904 Ga0081538_10058411
905 Ga0081539_10006724
906 Ga0070717_10002194
907 Ga0070717_10006759
908 Ga0070717_10054225
909 Ga0070717_10188747
910 Ga0070712_100011781
911 Ga0070712_100260264
912 Ga0075367_10025988
913 Ga0097621_100027954
914 Ga0068871_100186364
915 Ga0075428_100121338
916 Ga0075431_100005824
917 Ga0075431_100059879
918 Ga0075431_100060424
919 Ga0075431_100075773
920 Ga0075431_100198546
921 Ga0075431_100280113
922 Ga0075433_10257777
923 Ga0075433_10352332
924 Ga0075434_100564178
925 Ga0075429_100018221
926 Ga0075429_100045416
927 Ga0075429_100114920
928 Ga0075429_100181422
929 Ga0075429_100217311
930 Ga0068865_100002531
931 Ga0075436_100000008
932 Ga0097620_100020525
933 Ga0097620_100162972
934 Ga0075435_100011176
935 Ga0075435_100565414
936 Ga0105240_10299268
937 Ga0111539_10034067
938 Ga0111539_10037944
939 Ga0111539_10277950
940 Ga0111539_10278763
941 Ga0111539_10310152
942 Ga0111539_10522275
943 Ga0105245_10000992
944 Ga0105245_10013041
945 Ga0105245_10196402
946 Ga0114129_10003771
947 Ga0114129_10339861
948 Ga0114129_11061829
949 Ga0105243_10344884
950 Ga0105241_10058808
951 Ga0105241_10158174
952 Ga0105242_10355554
953 Ga0105248_10030735
954 Ga0105248_10256521
955 Ga0105248_10435225
956 Ga0105237_10093925
957 Ga0105238_10087373
958 Ga0105249_10004305
959 Ga0105249_10084088
960 Ga0105249_10181183
961 Ga0105249_10374951
962 Ga0105239_10034069
963 Ga0157371_10104266
964 Ga0157370_10002998
965 Ga0157369_10004434
966 Ga0157374_10102074
967 Ga0157378_10087918
968 Ga0157378_10102726
969 Ga0163162_10235506
970 Ga0163162_10312581
971 Ga0163162_10344924
972 Ga0163162_10489675
973 Ga0157372_10004438
974 Ga0157372_10013512
975 Ga0157372_10042341
976 Ga0157372_10166661
977 Ga0157372_10420877
978 Ga0157375_10011814
979 Ga0157375_10024029
980 Ga0157375_10064145
981 Ga0157375_10300631
982 Ga0163163_10399910
983 Ga0157380_10004685
984 Ga0157380_10072086
985 Ga0157380_10284018
986 Ga0157380_10473288
987 Ga0157376_10017643
988 Ga0206349_1021214
989 Ga0206351_10214976
990 Ga0213874_10038735
991 Ga0213876_10000422
992 Ga0213875_10043471
993 Ga0224712_10003705
994 Ga0224712_10017120
995 Ga0207666_1006577
996 Ga0207697_10166163
997 Ga0207692_10108241
998 Ga0207642_10029077
999 Ga0207680_10253945
1000 Ga0207647_10120299
1001 Ga0207699_10002389
1002 Ga0207699_10029634
1003 Ga0207645_10004858
1004 Ga0207643_10093499
1005 Ga0207684_10004086
1006 Ga0207684_10006772
1007 Ga0207684_10028825
1008 Ga0207684_10177950
1009 Ga0207707_10008698
1010 Ga0207707_10010052
1011 Ga0207707_10123864
1012 Ga0207707_10295321
1013 Ga0207695_10005313
1014 Ga0207693_10015487
1015 Ga0207660_10021678
1016 Ga0207662_10007422
1017 Ga0207662_10024684
1018 Ga0207657_10071102
1019 Ga0207652_10022504
1020 Ga0207652_10038989
1021 Ga0207652_10073005
1022 Ga0207652_10224120
1023 Ga0207652_10491624
1024 Ga0207646_10000759
1025 Ga0207646_10021798
1026 Ga0207646_10128685
1027 Ga0207681_10005309
1028 Ga0207681_10034967
1029 Ga0207694_10068221
1030 Ga0207650_10014997
1031 Ga0207659_10015233
1032 Ga0207687_10003713
1033 Ga0207687_10005579
1034 Ga0207700_10005353
1035 Ga0207700_10011557
1036 Ga0207700_10017851
1037 Ga0207700_10069468
1038 Ga0207700_10089194
1039 Ga0207700_10116617
1040 Ga0207700_10178804
1041 Ga0207664_10014420
1042 Ga0207664_10128168
1043 Ga0207690_10000668
1044 Ga0207690_10010808
1045 Ga0207706_10013624
1046 Ga0207706_10039015
1047 Ga0207706_10093627
1048 Ga0207709_10637680
1049 Ga0207670_10003568
1050 Ga0207670_10151340
1051 Ga0207669_10000882
1052 Ga0207669_10164729
1053 Ga0207704_10002528
1054 Ga0207691_10003103
1055 Ga0207711_10164990
1056 Ga0207689_10011603
1057 Ga0207689_10147892
1058 Ga0207661_10005786
1059 Ga0207661_10023436
1060 Ga0207661_10050549
1061 Ga0207661_10106323
1062 Ga0207679_10013719
1063 Ga0207679_10051245
1064 Ga0207667_10023459
1065 Ga0207651_10047297
1066 Ga0207712_10058827
1067 Ga0207712_10151853
1068 Ga0207668_10015516
1069 Ga0207668_10203942
1070 Ga0207658_10010275
1071 Ga0207677_10080500
1072 Ga0207703_10030733
1073 Ga0207708_10001712
1074 Ga0207708_10094193
1075 Ga0207708_10095028
1076 Ga0207702_10002092
1077 Ga0207702_10002412
1078 Ga0207702_10171962
1079 Ga0207702_10302182
1080 Ga0207641_10027946
1081 Ga0207641_10899119
1082 Ga0207648_10018221
1083 Ga0207648_10027889
1084 Ga0207676_10003054
1085 Ga0207676_10420612
1086 Ga0207674_10000120
1087 Ga0207674_10000366
1088 Ga0207674_10006207
1089 Ga0207674_10089473
1090 Ga0207675_100002168
1091 Ga0207675_100012609
1092 Ga0207675_100192701
1093 Ga0207675_100337858
1094 Ga0207428_10075243
1095 Ga0268265_10003865
1096 Ga0268265_10094969
1097 Ga0268265_10167452
1098 Ga0268265_10841856
1099 Ga0268264_10075298
1100 Ga0268264_10150506
1101 Ga0268264_10560515
1102 Ga0265334_10048236
1103 Ga0265318_10000178
1104 Ga0265318_10018767
1105 Ga0265323_10004508
1106 Ga0265323_10013823
1107 Ga0265323_10041946
1108 Ga0265336_10023827
1109 Ga0265338_10005521
1110 Ga0265338_10056870
1111 Ga0265330_10000164
1112 Ga0265330_10000645
1113 Ga0265330_10000982
1114 Ga0265330_10001395
1115 Ga0265330_10007773
1116 Ga0265330_10024432
1117 Ga0265332_10000226
1118 Ga0265332_10017126
1119 Ga0265332_10022056
1120 Ga0265328_10000594
1121 Ga0265320_10000158
1122 Ga0265320_10003882
1123 Ga0265320_10005336
1124 Ga0265325_10000338
1125 Ga0265329_10000550
1126 Ga0265329_10000905
1127 Ga0265329_10002438
1128 Ga0265329_10044046
1129 Ga0265340_10009098
1130 Ga0265340_10026018
1131 Ga0265339_10012831
1132 Ga0265339_10029579
1133 Ga0265339_10044607
1134 Ga0265339_10127295
1135 Ga0265331_10000283
1136 Ga0265316_10000530
1137 Ga0265316_10000837
1138 Ga0265316_10000918
1139 Ga0265316_10000968
1140 Ga0265316_10001094
1141 Ga0265316_10001828
1142 Ga0265316_10003413
1143 Ga0265316_10008905
1144 Ga0265316_10011363
1145 Ga0265316_10014446
1146 Ga0265316_10041565
1147 Ga0265316_10137200
1148 Ga0265316_10474058
1149 Ga0307408_100048383
1150 Ga0307408_100141051
1151 Ga0265313_10000434
1152 Ga0265313_10000516
1153 Ga0265313_10003119
1154 Ga0265313_10069335
1155 Ga0316575_10002464
1156 Ga0316579_10064493
1157 Ga0316579_10115633
1158 Ga0265314_10000427
1159 Ga0265314_10003291
1160 Ga0265314_10004747
1161 Ga0265314_10013708
1162 Ga0265314_10028744
1163 Ga0265314_10203891
1164 Ga0265342_10000091
1165 Ga0265342_10000236
1166 Ga0265342_10000495
1167 Ga0265342_10001020
1168 Ga0265342_10002502
1169 Ga0265342_10004150
1170 Ga0265342_10004929
1171 Ga0265342_10069145
1172 Ga0265342_10101930
1173 Ga0316576_10007551
1174 Ga0316576_10007959
1175 Ga0316576_10067782
1176 Ga0316576_10233435
1177 Ga0316578_10012016
1178 Ga0316578_10064514
1179 Ga0316578_10093335
1180 Ga0316578_10174165
1181 Ga0316577_10010055
1182 Ga0316577_10013010
1183 Ga0316577_10015694
1184 Ga0316577_10018126
1185 Ga0316577_10027251
1186 Ga0316577_10035035
1187 Ga0316577_10038636
1188 Ga0316577_10061014
1189 Ga0316577_10076812
1190 Ga0316577_10084872
1191 Ga0316577_10168613
1192 Ga0316577_10204286
1193 Ga0316577_10205991
1194 Ga0307413_10113642
1195 Ga0307410_10182846
1196 Ga0307407_10025229
1197 Ga0307407_10178993
1198 Ga0307412_10062051
1199 Ga0307409_100551314
1200 Ga0307416_100043038
1201 Ga0307411_10063582
1202 Ga0307415_100187466
1203 Ga0307415_100304119
1204 Ga0316580_10044971
1205 Ga0373926_0009943
1206 Ga0373926_0047916
1207 Ga0373934_0005155
1208 Ga0373934_0010621
1209 Ga0373944_0009883
1210 Ga0373923_0003831
1211 Ga0373945_0001777
1212 Ga0373945_0079117
1213 Ga0373953_0091555
1214 Ga0373953_0100575
1215 Ga0373953_0169520
1216 Ga0373954_0008997
1217 Ga0373954_0040372
1218 Ga0373954_0061910
1219 Ga0373954_0068112
1220 Ga0373956_0001279
1221 Ga0373956_0077885
1222 Ga0373957_0024042
1223 Ga0373957_0031047
1224 Ga0373957_0042289
1225 Ga0373957_0056881
1226 Ga0373943_0041765
1227 Ga0373946_0028653
1228 Ga0373955_0003339
1229 Ga0373955_0005225
1230 Ga0316574_0005803
1231 Ga0316574_0036074
1232 Ga0316574_0058020
1233 Ga0316574_0350007
1234 Ga0373924_0002966
1235 Ga0373931_0080503
1236 Ga0373935_0140391
1237 Ga0373927_0004165
1238 Ga0373927_0021679
1239 Ga0373933_0000071
1240 Ga0373933_0002827
1241 Ga0373933_0006888
1242 Ga0373933_0026940
1243 Ga0373933_0145970
1244 Ga0373947_0000536
1245 Ga0373947_0003376
1246 Ga0373937_0000141
1247 Ga0373937_0001599
1248 Ga0373937_0010952
1249 Ga0373937_0055944
1250 Ga0373937_0199663
1251 Ga0373937_0237430
1252 Ga0316582_0001573
1253 Ga0316582_0001967
1254 Ga0316582_0002907
1255 Ga0316582_0012828
1256 Ga0316582_0015539
1257 Ga0316582_0033750
1258 Ga0316582_0084932
1259 Ga0316582_0086300
1260 Ga0316582_0108532
1261 Ga0316582_0117457
1262 Ga0316582_0196503
1263 Ga0316582_0234567
1264 Ga0316582_0248734
1265 Ga0316582_0379225
1266 Ga0316584_0000161
1267 Ga0316584_0004045
1268 Ga0316584_0006407
1269 Ga0316584_0011111
1270 Ga0316584_0021002
1271 Ga0316584_0035682
1272 Ga0316584_0042074
1273 Ga0316584_0053946
1274 Ga0316584_0107666
1275 Ga0316584_0108799
1276 Ga0316584_0141617
1277 Ga0316584_0161945
1278 Ga0316584_0509316
1279 Ga0373925_0009561
1280 Ga0373925_0656219
1281 Ga0395900_0288242
1282 Ga0395905_0005426
1283 Ga0395905_0532611
1284 Ga0316581_0000595
1285 Ga0316581_0003022
1286 Ga0316581_0003775
1287 Ga0316581_0004957
1288 Ga0316581_0046255
1289 Ga0316581_0048409
1290 Ga0436364_0198679
1291 Ga0395901_0006659
1292 Ga0395901_0042233
1293 Ga0237819_07077
1294 Ga0400483_061585
1295 Ga0400483_148375
1296 Ga0400489_11819
1297 Ga0400489_15711
1298 Ga0400489_25754
1299 Ga0400489_25858
1300 Ga0400489_65167
1301 Ga0400489_79360
1302 Ga0400487_17497
1303 Ga0436365_0301490
1304 Ga0436365_0637502
1305 Ga0436365_0873465
1306 Ga0436363_0280714
1307 Ga0451577_0000197
1308 Ga0451577_0017683
1309 Ga0451577_0032219
1310 Ga0451577_0078601
1311 Ga0451577_0099754
1312 Ga0451577_0130933
1313 Ga0451577_0152294
1314 Ga0451577_0421566
1315 Ga0451577_0496472
1316 Ga0466969_0016606
1317 Ga0453683_0000169
1318 Ga0453683_0018122
1319 Ga0453683_0060567
1320 Ga0453683_0159473
1321 Ga0466966_0010205
1322 Ga0466961_0041464
1323 Ga0466963_0217592
1324 Ga0453684_0000393
1325 Ga0453684_0000476
1326 Ga0453684_0002622
1327 Ga0453684_0004500
1328 Ga0453684_0006175
1329 Ga0453684_0006191
1330 Ga0453684_0014058
1331 Ga0453684_0021256
1332 Ga0453684_0027265
1333 Ga0453684_0044560
1334 Ga0453684_0059927
1335 Ga0453684_0099289
1336 Ga0453684_0203964
1337 Ga0453684_0291254
1338 Ga0453684_0644187
1339 Ga0453684_0653455
1340 Ga0466971_0110696
1341 Ga0466957_0030389
1342 Ga0451576_0000145
1343 Ga0451576_0001182
1344 Ga0451576_0013401
1345 Ga0451576_0130784
1346 Ga0451576_0245881
1347 Ga0451576_0275935
1348 Ga0451576_0435570
1349 Ga0451576_0794360
1350 Ga0466967_0001023
1351 Ga0466967_0015155
1352 Ga0466967_0055352
1353 Ga0495592_0016891
1354 Ga0495592_0097606
1355 Ga0495603_0004951
1356 Ga0495629_0022693
1357 Ga0495629_0025318
1358 Ga0495651_0000069
1359 Ga0495651_0031688
1360 Ga0495653_0000117
1361 Ga0495653_0152105
1362 Ga0495580_0135068
1363 Ga0495582_0035148
1364 Ga0495639_0001030
1365 Ga0495639_0048900
1366 Ga0495662_0195821
1367 Ga0495664_0070386
1368 Ga0495594_0003012
1369 Ga0495594_0027621
1370 Ga0495608_0000103
1371 Ga0495628_0000082
1372 Ga0495628_0051656
1373 Ga0495630_0000666
1374 Ga0495630_0001791
1375 Ga0495643_0000173
1376 Ga0495643_0085957
1377 Ga0495652_0001484
1378 Ga0495652_0363922
1379 Ga0495665_0001803
1380 Ga0495665_0231779
1381 Ga0495640_0079520
1382 Ga0495640_0205076
1383 Ga0495586_0048222
1384 Ga0495587_0000147
1385 Ga0495587_0000298
1386 Ga0495645_0000061
1387 Ga0495645_0001109
1388 Ga0495622_0133847
1389 Ga0495667_0000269
1390 Ga0495667_0014755
1391 Ga0495635_0000071
1392 Ga0495659_0055110
1393 Ga0495588_0033049
1394 Ga0495588_0038331
1395 Ga0495588_0040339
1396 Ga0495657_0000366
1397 Ga0495657_0167592
1398 Ga0495657_0204942
1399 Ga0495599_0000859
1400 Ga0495599_0002136
1401 Ga0495623_0000193
1402 Ga0495623_0002351
1403 Ga0495646_0007102
1404 Ga0495658_0000148
1405 Ga0495613_0023440
1406 Ga0495613_0074533
1407 Ga0495613_0156658
1408 Ga0495613_0400515
1409 Ga0495613_0421768
1410 Ga0495600_0000133
1411 Ga0495600_0017358
1412 Ga0495581_0001652
1413 Ga0495581_0016039
1414 Ga0495604_0000028
1415 Ga0495604_0216741
1416 Ga0495674_0001137
1417 Ga0495674_0011474
1418 Ga0495674_0084975
1419 Ga0495674_0149657
1420 Ga0495674_0396217
1421 Ga0495680_0019973
1422 Ga0495680_0157174
1423 Ga0495675_0001753
1424 Ga0495675_0003478
1425 Ga0495675_0160652
1426 Ga0495684_0000044
1427 Ga0495684_0011174
1428 Ga0495684_0280920
1429 Ga0495593_0000211
1430 Ga0495602_0000414
1431 Ga0495614_0000092
1432 Ga0496101_0383372
1433 Ga0496104_0027959
1434 Ga0496104_0120774
1435 Ga0496104_0146474
1436 Ga0496109_0203162
1437 Ga0496112_0000747
1438 Ga0496112_0105623
1439 Ga0496113_0066915
1440 Ga0496113_0167168
1441 Ga0496114_0004489
1442 Ga0496114_0029255
1443 Ga0501291_027508
1444 Ga0501300_001855
1445 Ga0501033_0007612
1446 Ga0501034_0074375
1447 Ga0501034_0085121
1448 Ga0501036_0221377
1449 Ga0501037_0046411
1450 Ga0501039_0139866
1451 Ga0501043_0015605
1452 Ga0501047_0046690
1453 Ga0501047_0060492
1454 Ga0501070_0168510
1455 Ga0501073_0010701
1456 Ga0501198_011727
1457 Ga0501207_007528
1458 Ga0501217_003247
1459 Ga0501223_002407
1460 Ga0501236_000948
1461 Ga0501247_003384
1462 Ga0501035_0000350
1463 Ga0501035_0322267
1464 Ga0501044_0002550
1465 Ga0501044_0141704
1466 nmdc:mga05p37_17980_c1
1467 nmdc:mga05p37_278740_c1
1468 nmdc:mga09592_111741_c1
1469 nmdc:mga09592_114514_c1
1470 nmdc:mga09592_4560_c1
1471 nmdc:mga09592_487762_c1
1472 nmdc:mga09592_62178_c1
1473 nmdc:mga0qj67_80637_c1
1474 nmdc:mga06r32_218316_c1
1475 nmdc:mga06r32_24579_c1
1476 nmdc:mga06r32_330694_c1
1477 nmdc:mga06r32_70754_c1
1478 nmdc:mga08y16_15747_c1
1479 nmdc:mga08y16_24197_c1
1480 nmdc:mga08y16_35168_c1
1481 nmdc:mga08y16_534244_c1
1482 nmdc:mga08y16_72264_c1
1483 nmdc:mga0rr50_171825_c1
1484 nmdc:mga0rr50_418636_c1
1485 nmdc:mga0rr50_7858_c1
1486 nmdc:mga08x19_16_c1
1487 nmdc:mga0a205_155306_c1
1488 Ga0495601_0002281
1489 Ga0495601_0018513
1490 Ga0495612_0005137
1491 Ga0495612_0045946
1492 Ga0495595_0137216
1493 Ga0495619_0005505
1494 Ga0495619_0117199
1495 Ga0500645_038186
1496 Ga0501084_0012175
1497 Ga0501084_0061704
1498 Ga0590071_003932
1499 Ga0590075_001339
1500 Ga0501082_0151461
1501 Ga0501082_0306759
1502 2617916016
1503 2739244792
1504 2831428391
1505 2848697274
1506 2849668275
1507 2886632920
1508 2913849126
1509 2913919487
1510 2913944107
1511 2977235548
1512 642604269

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

58

257

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

66

314

0.91

PF08659

KR

KR domain

58

233

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

60

231

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iuy-assembly2.cif.gz_G crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c 0.9538 9 275
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9505 15 274
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9461 12 274
4iuy-assembly2.cif.gz_G crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c 0.9428 9 275
3sj7-assembly1.cif.gz_A-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9409 15 272
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9461 12 274 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9425 10 274 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 9 274 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 10 274 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 11 272 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X9Q6U3-F1-model_v4 deleted 0.9939 74 278
AF-A0A7C5NXC8-F1-model_v4 SDR family oxidoreductase 0.991 126 278 GO:0016616
AF-A0A535GZA2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9885 86 210 GO:0005829
GO:0016491
AF-A0A800BV48-F1-model_v4 SDR family oxidoreductase 0.9852 4 278 GO:0016616
GO:0030497
AF-A0A7X9Q6U3-F1-model_v4 deleted 0.9844 74 278

Map