F479351
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 756 | 336 | 1512 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0097102|Ga0316584_0097102_479_1438 |
| Length | 319 |
| Sequence | VYTRCWGQVLIFQEAGRFLEAKTPVPFAADSFRIQASLDEVSMTDNGADQGLFSVAGKVALVTGGTGVLGGAMAHGLAAAGAKVAIMGRRKERAAQVAREIVEQGGEAMPLPADVLDKDQLIAAKEDLVSTWGALDIMVNAAGGNSAAATVMPDQSFFDMAPDAFEQMLQLNLVGTVLPIQVFGPLLVEDGHGAIVNISSMTAIRPLTRVAGYGAAKASIDNFTRWLAVELIAKHGEGVRVNAIAPGFFIGEQNRDFLLNPDGTPTARGKVIVEHTPMGRFGEPEELVGTLLWLCSDASRFVTGVVVPVDGGFSVFAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 183 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 228 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 291 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 302 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 303 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 304 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 327 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 328 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 329 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 330 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 331 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 332 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 333 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 334 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 335 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 336 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.02 |
| Metatranscriptomes | 0.53 |
| Isolates | 1.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 94.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316584_0097102 | 3300036712 | Unclassified | 2206 |
| 2 | SwRhRL3b_contig_3755293 | 2162886006 | Bacteria | 988 |
| 3 | SwRhRL3b_contig_457262 | 2162886006 | Bacteria | 1086 |
| 4 | SwRhRL2b_contig_3385910 | 2162886007 | Bacteria | 1027 |
| 5 | rootL2_10066076 | 3300003322 | Bacteria | 2397 |
| 6 | Ga0065704_10071963 | 3300005289 | Bacteria | 9451 |
| 7 | Ga0065707_10102778 | 3300005295 | Bacteria | 2785 |
| 8 | Ga0070676_10219599 | 3300005328 | Bacteria | 1255 |
| 9 | Ga0070683_100002131 | 3300005329 | Bacteria | 15633 |
| 10 | Ga0070683_100020655 | 3300005329 | Bacteria | 5862 |
| 11 | Ga0070683_100053685 | 3300005329 | Bacteria | 3735 |
| 12 | Ga0070683_100182180 | 3300005329 | Bacteria | 1994 |
| 13 | Ga0070690_100002800 | 3300005330 | Bacteria | 9415 |
| 14 | Ga0070690_100089427 | 3300005330 | Bacteria | 2025 |
| 15 | Ga0070670_100029948 | 3300005331 | Bacteria | 4687 |
| 16 | Ga0070670_100360616 | 3300005331 | Bacteria | 1278 |
| 17 | Ga0068869_100173820 | 3300005334 | Bacteria | 1684 |
| 18 | Ga0068869_100174660 | 3300005334 | Bacteria | 1680 |
| 19 | Ga0070666_10080599 | 3300005335 | Bacteria | 2225 |
| 20 | Ga0070680_100056327 | 3300005336 | Bacteria | 3214 |
| 21 | Ga0070682_100015565 | 3300005337 | Bacteria | 4410 |
| 22 | Ga0068868_100011793 | 3300005338 | Bacteria | 6371 |
| 23 | Ga0068868_100022889 | 3300005338 | Bacteria | 4723 |
| 24 | Ga0070689_100011455 | 3300005340 | Bacteria | 6354 |
| 25 | Ga0070689_100047355 | 3300005340 | Bacteria | 3315 |
| 26 | Ga0070689_100125171 | 3300005340 | Bacteria | 2056 |
| 27 | Ga0070691_10008408 | 3300005341 | Bacteria | 4726 |
| 28 | Ga0070691_10052672 | 3300005341 | Unclassified | 1946 |
| 29 | Ga0070691_10075052 | 3300005341 | Bacteria | 1646 |
| 30 | Ga0070687_100035862 | 3300005343 | Bacteria | 2467 |
| 31 | Ga0070687_100326772 | 3300005343 | Bacteria | 982 |
| 32 | Ga0070692_10043668 | 3300005345 | Bacteria | 2306 |
| 33 | Ga0070668_100004428 | 3300005347 | Bacteria | 10426 |
| 34 | Ga0070669_100002653 | 3300005353 | Bacteria | 12898 |
| 35 | Ga0070669_100012904 | 3300005353 | Bacteria | 5934 |
| 36 | Ga0070669_100050280 | 3300005353 | Bacteria | 3044 |
| 37 | Ga0070675_100001221 | 3300005354 | Bacteria | 18688 |
| 38 | Ga0070675_100240610 | 3300005354 | Bacteria | 1581 |
| 39 | Ga0070674_100009404 | 3300005356 | Bacteria | 5851 |
| 40 | Ga0070673_100016861 | 3300005364 | Bacteria | 5179 |
| 41 | Ga0070688_100004105 | 3300005365 | Bacteria | 7556 |
| 42 | Ga0070659_100000542 | 3300005366 | Bacteria | 27536 |
| 43 | Ga0070659_100023719 | 3300005366 | Bacteria | 4698 |
| 44 | Ga0070667_100051069 | 3300005367 | Bacteria | 3486 |
| 45 | Ga0070667_100062597 | 3300005367 | Bacteria | 3152 |
| 46 | Ga0070709_10005957 | 3300005434 | Bacteria | 6619 |
| 47 | Ga0070709_10009752 | 3300005434 | Bacteria | 5304 |
| 48 | Ga0070709_10292755 | 3300005434 | Bacteria | 1187 |
| 49 | Ga0070714_100018322 | 3300005435 | Bacteria | 5686 |
| 50 | Ga0070714_100022127 | 3300005435 | Bacteria | 5210 |
| 51 | Ga0070714_100100065 | 3300005435 | Bacteria | 2553 |
| 52 | Ga0070713_100000644 | 3300005436 | Bacteria | 22268 |
| 53 | Ga0070713_100010845 | 3300005436 | Bacteria | 6605 |
| 54 | Ga0070713_100025732 | 3300005436 | Bacteria | 4607 |
| 55 | Ga0070713_100028119 | 3300005436 | Bacteria | 4437 |
| 56 | Ga0070713_100107080 | 3300005436 | Bacteria | 2431 |
| 57 | Ga0070710_10075547 | 3300005437 | Bacteria | 1953 |
| 58 | Ga0070701_10001338 | 3300005438 | Bacteria | 9081 |
| 59 | Ga0070711_100091702 | 3300005439 | Bacteria | 2191 |
| 60 | Ga0070711_100347243 | 3300005439 | Bacteria | 1192 |
| 61 | Ga0070705_100009893 | 3300005440 | Bacteria | 4755 |
| 62 | Ga0070705_100084690 | 3300005440 | Bacteria | 1957 |
| 63 | Ga0070705_100122437 | 3300005440 | Bacteria | 1682 |
| 64 | Ga0070700_100002973 | 3300005441 | Bacteria | 8697 |
| 65 | Ga0070708_100000017 | 3300005445 | Bacteria | 120364 |
| 66 | Ga0070708_100081484 | 3300005445 | Bacteria | 2930 |
| 67 | Ga0070708_100351505 | 3300005445 | Unclassified | 1389 |
| 68 | Ga0070662_100001369 | 3300005457 | Bacteria | 14981 |
| 69 | Ga0070662_100003796 | 3300005457 | Bacteria | 9448 |
| 70 | Ga0070662_100031467 | 3300005457 | Bacteria | 3724 |
| 71 | Ga0070662_100161464 | 3300005457 | Bacteria | 1753 |
| 72 | Ga0070681_10075128 | 3300005458 | Bacteria | 3339 |
| 73 | Ga0070681_10201521 | 3300005458 | Bacteria | 1908 |
| 74 | Ga0070681_10381144 | 3300005458 | Bacteria | 1321 |
| 75 | Ga0068867_100049818 | 3300005459 | Bacteria | 3084 |
| 76 | Ga0068867_100061905 | 3300005459 | Bacteria | 2779 |
| 77 | Ga0068867_100083187 | 3300005459 | Bacteria | 2416 |
| 78 | Ga0070685_10008046 | 3300005466 | Bacteria | 5404 |
| 79 | Ga0070706_100011641 | 3300005467 | Bacteria | 8171 |
| 80 | Ga0070706_100023800 | 3300005467 | Bacteria | 5638 |
| 81 | Ga0070706_100094274 | 3300005467 | Bacteria | 2778 |
| 82 | Ga0070706_100387088 | 3300005467 | Bacteria | 1302 |
| 83 | Ga0070707_100000423 | 3300005468 | Bacteria | 41848 |
| 84 | Ga0070707_100001659 | 3300005468 | Bacteria | 21551 |
| 85 | Ga0070707_100028523 | 3300005468 | Bacteria | 5313 |
| 86 | Ga0070707_100189540 | 3300005468 | Unclassified | 2005 |
| 87 | Ga0070707_100268261 | 3300005468 | Unclassified | 1660 |
| 88 | Ga0070707_100281795 | 3300005468 | Bacteria | 1615 |
| 89 | Ga0070698_100005376 | 3300005471 | Bacteria | 14003 |
| 90 | Ga0070699_100179205 | 3300005518 | Bacteria | 1880 |
| 91 | Ga0070699_100715738 | 3300005518 | Bacteria | 915 |
| 92 | Ga0070679_100019988 | 3300005530 | Bacteria | 6524 |
| 93 | Ga0070679_100043999 | 3300005530 | Bacteria | 4447 |
| 94 | Ga0070679_100283711 | 3300005530 | Bacteria | 1608 |
| 95 | Ga0070679_100463909 | 3300005530 | Bacteria | 1211 |
| 96 | Ga0070679_100545343 | 3300005530 | Unclassified | 1103 |
| 97 | Ga0070684_100000189 | 3300005535 | Bacteria | 42780 |
| 98 | Ga0070684_100008507 | 3300005535 | Bacteria | 8026 |
| 99 | Ga0070684_100025423 | 3300005535 | Bacteria | 4977 |
| 100 | Ga0070684_100168777 | 3300005535 | Bacteria | 1987 |
| 101 | Ga0070684_100199609 | 3300005535 | Bacteria | 1822 |
| 102 | Ga0070697_100040456 | 3300005536 | Bacteria | 3772 |
| 103 | Ga0070697_100388051 | 3300005536 | Bacteria | 1210 |
| 104 | Ga0070672_100006852 | 3300005543 | Bacteria | 7697 |
| 105 | Ga0070672_100116410 | 3300005543 | Bacteria | 2184 |
| 106 | Ga0070686_100000084 | 3300005544 | Bacteria | 67713 |
| 107 | Ga0070686_100001150 | 3300005544 | Bacteria | 15180 |
| 108 | Ga0070686_100102271 | 3300005544 | Bacteria | 1938 |
| 109 | Ga0070695_100102571 | 3300005545 | Bacteria | 1929 |
| 110 | Ga0070695_100222609 | 3300005545 | Bacteria | 1360 |
| 111 | Ga0070693_100049850 | 3300005547 | Bacteria | 2391 |
| 112 | Ga0068855_100025404 | 3300005563 | Bacteria | 7087 |
| 113 | Ga0068855_100033409 | 3300005563 | Bacteria | 6139 |
| 114 | Ga0068855_100244652 | 3300005563 | Bacteria | 2003 |
| 115 | Ga0070664_100039798 | 3300005564 | Bacteria | 3962 |
| 116 | Ga0070664_100114907 | 3300005564 | Bacteria | 2352 |
| 117 | Ga0070664_100141229 | 3300005564 | Bacteria | 2121 |
| 118 | Ga0068857_100000218 | 3300005577 | Bacteria | 37864 |
| 119 | Ga0068857_100011133 | 3300005577 | Bacteria | 7822 |
| 120 | Ga0068857_100015248 | 3300005577 | Bacteria | 6708 |
| 121 | Ga0068857_100034632 | 3300005577 | Bacteria | 4467 |
| 122 | Ga0068854_100104386 | 3300005578 | Unclassified | 2129 |
| 123 | Ga0068856_100007078 | 3300005614 | Bacteria | 10952 |
| 124 | Ga0068856_100090475 | 3300005614 | Bacteria | 3044 |
| 125 | Ga0068856_100105701 | 3300005614 | Bacteria | 2809 |
| 126 | Ga0070702_100110745 | 3300005615 | Bacteria | 1702 |
| 127 | Ga0068859_100020526 | 3300005617 | Bacteria | 6629 |
| 128 | Ga0068859_100151775 | 3300005617 | Bacteria | 2392 |
| 129 | Ga0068859_100162979 | 3300005617 | Bacteria | 2309 |
| 130 | Ga0068864_100014517 | 3300005618 | Bacteria | 6543 |
| 131 | Ga0068866_10070649 | 3300005718 | Bacteria | 1844 |
| 132 | Ga0068861_100004794 | 3300005719 | Bacteria | 9091 |
| 133 | Ga0068861_100006018 | 3300005719 | Bacteria | 8246 |
| 134 | Ga0068861_100698749 | 3300005719 | Unclassified | 942 |
| 135 | Ga0068870_10030117 | 3300005840 | Bacteria | 2741 |
| 136 | Ga0068870_10105378 | 3300005840 | Bacteria | 1601 |
| 137 | Ga0068863_100033711 | 3300005841 | Bacteria | 4878 |
| 138 | Ga0068858_100009561 | 3300005842 | Bacteria | 9249 |
| 139 | Ga0068860_100095097 | 3300005843 | Bacteria | 2840 |
| 140 | Ga0068860_100128421 | 3300005843 | Bacteria | 2431 |
| 141 | Ga0068860_100698707 | 3300005843 | Bacteria | 1024 |
| 142 | Ga0068862_100003693 | 3300005844 | Bacteria | 13084 |
| 143 | Ga0068862_100010149 | 3300005844 | Bacteria | 7770 |
| 144 | Ga0068862_100093053 | 3300005844 | Bacteria | 2628 |
| 145 | Ga0068862_100334123 | 3300005844 | Bacteria | 1402 |
| 146 | Ga0068862_100401610 | 3300005844 | Bacteria | 1282 |
| 147 | Ga0081538_10004934 | 3300005981 | Bacteria | 12152 |
| 148 | Ga0081538_10058411 | 3300005981 | Unclassified | 2237 |
| 149 | Ga0081539_10006724 | 3300005985 | Bacteria | 10828 |
| 150 | Ga0070717_10002194 | 3300006028 | Bacteria | 13713 |
| 151 | Ga0070717_10006759 | 3300006028 | Bacteria | 8462 |
| 152 | Ga0070717_10054225 | 3300006028 | Bacteria | 3306 |
| 153 | Ga0070717_10188747 | 3300006028 | Bacteria | 1800 |
| 154 | Ga0070712_100011781 | 3300006175 | Bacteria | 5557 |
| 155 | Ga0070712_100260264 | 3300006175 | Bacteria | 1390 |
| 156 | Ga0075367_10025988 | 3300006178 | Bacteria | 3316 |
| 157 | Ga0097621_100027954 | 3300006237 | Bacteria | 4440 |
| 158 | Ga0068871_100186364 | 3300006358 | Bacteria | 1786 |
| 159 | Ga0075428_100121338 | 3300006844 | Bacteria | 2846 |
| 160 | Ga0075431_100005824 | 3300006847 | Bacteria | 12187 |
| 161 | Ga0075431_100059879 | 3300006847 | Bacteria | 3929 |
| 162 | Ga0075431_100060424 | 3300006847 | Unclassified | 3910 |
| 163 | Ga0075431_100075773 | 3300006847 | Bacteria | 3471 |
| 164 | Ga0075431_100198546 | 3300006847 | Bacteria | 2053 |
| 165 | Ga0075431_100280113 | 3300006847 | Bacteria | 1688 |
| 166 | Ga0075433_10257777 | 3300006852 | Bacteria | 1546 |
| 167 | Ga0075433_10352332 | 3300006852 | Bacteria | 1301 |
| 168 | Ga0075434_100564178 | 3300006871 | Bacteria | 1158 |
| 169 | Ga0075429_100018221 | 3300006880 | Bacteria | 6077 |
| 170 | Ga0075429_100045416 | 3300006880 | Bacteria | 3822 |
| 171 | Ga0075429_100114920 | 3300006880 | Unclassified | 2353 |
| 172 | Ga0075429_100181422 | 3300006880 | Bacteria | 1845 |
| 173 | Ga0075429_100217311 | 3300006880 | Bacteria | 1675 |
| 174 | Ga0068865_100002531 | 3300006881 | Bacteria | 10828 |
| 175 | Ga0075436_100000008 | 3300006914 | Bacteria | 279288 |
| 176 | Ga0097620_100020525 | 3300006931 | Bacteria | 6629 |
| 177 | Ga0097620_100162972 | 3300006931 | Bacteria | 2309 |
| 178 | Ga0075435_100011176 | 3300007076 | Bacteria | 6588 |
| 179 | Ga0075435_100565414 | 3300007076 | Bacteria | 985 |
| 180 | Ga0105240_10299268 | 3300009093 | Bacteria | 1841 |
| 181 | Ga0111539_10034067 | 3300009094 | Bacteria | 6179 |
| 182 | Ga0111539_10037944 | 3300009094 | Bacteria | 5811 |
| 183 | Ga0111539_10277950 | 3300009094 | Bacteria | 1948 |
| 184 | Ga0111539_10278763 | 3300009094 | Bacteria | 1945 |
| 185 | Ga0111539_10310152 | 3300009094 | Bacteria | 1836 |
| 186 | Ga0111539_10522275 | 3300009094 | Bacteria | 1383 |
| 187 | Ga0105245_10000992 | 3300009098 | Bacteria | 25809 |
| 188 | Ga0105245_10013041 | 3300009098 | Bacteria | 7241 |
| 189 | Ga0105245_10196402 | 3300009098 | Bacteria | 1936 |
| 190 | Ga0114129_10003771 | 3300009147 | Bacteria | 21375 |
| 191 | Ga0114129_10339861 | 3300009147 | Unclassified | 1991 |
| 192 | Ga0114129_11061829 | 3300009147 | Bacteria | 1016 |
| 193 | Ga0105243_10344884 | 3300009148 | Bacteria | 1365 |
| 194 | Ga0105241_10058808 | 3300009174 | Bacteria | 2953 |
| 195 | Ga0105241_10158174 | 3300009174 | Bacteria | 1860 |
| 196 | Ga0105242_10355554 | 3300009176 | Bacteria | 1354 |
| 197 | Ga0105248_10030735 | 3300009177 | Bacteria | 5999 |
| 198 | Ga0105248_10256521 | 3300009177 | Bacteria | 1968 |
| 199 | Ga0105248_10435225 | 3300009177 | Bacteria | 1477 |
| 200 | Ga0105237_10093925 | 3300009545 | Bacteria | 2989 |
| 201 | Ga0105238_10087373 | 3300009551 | Bacteria | 3105 |
| 202 | Ga0105249_10004305 | 3300009553 | Bacteria | 12305 |
| 203 | Ga0105249_10084088 | 3300009553 | Bacteria | 2963 |
| 204 | Ga0105249_10181183 | 3300009553 | Bacteria | 2050 |
| 205 | Ga0105249_10374951 | 3300009553 | Bacteria | 1447 |
| 206 | Ga0105239_10034069 | 3300010375 | Bacteria | 5591 |
| 207 | Ga0157371_10104266 | 3300013102 | Bacteria | 2012 |
| 208 | Ga0157370_10002998 | 3300013104 | Bacteria | 20044 |
| 209 | Ga0157369_10004434 | 3300013105 | Bacteria | 16566 |
| 210 | Ga0157374_10102074 | 3300013296 | Bacteria | 2750 |
| 211 | Ga0157378_10087918 | 3300013297 | Bacteria | 2819 |
| 212 | Ga0157378_10102726 | 3300013297 | Bacteria | 2611 |
| 213 | Ga0163162_10235506 | 3300013306 | Bacteria | 1961 |
| 214 | Ga0163162_10312581 | 3300013306 | Bacteria | 1704 |
| 215 | Ga0163162_10344924 | 3300013306 | Bacteria | 1622 |
| 216 | Ga0163162_10489675 | 3300013306 | Bacteria | 1361 |
| 217 | Ga0157372_10004438 | 3300013307 | Bacteria | 14962 |
| 218 | Ga0157372_10013512 | 3300013307 | Bacteria | 8726 |
| 219 | Ga0157372_10042341 | 3300013307 | Bacteria | 5036 |
| 220 | Ga0157372_10166661 | 3300013307 | Unclassified | 2548 |
| 221 | Ga0157372_10420877 | 3300013307 | Unclassified | 1557 |
| 222 | Ga0157375_10011814 | 3300013308 | Bacteria | 7721 |
| 223 | Ga0157375_10024029 | 3300013308 | Bacteria | 5634 |
| 224 | Ga0157375_10064145 | 3300013308 | Bacteria | 3656 |
| 225 | Ga0157375_10300631 | 3300013308 | Bacteria | 1768 |
| 226 | Ga0163163_10399910 | 3300014325 | Bacteria | 1432 |
| 227 | Ga0157380_10004685 | 3300014326 | Bacteria | 9525 |
| 228 | Ga0157380_10072086 | 3300014326 | Bacteria | 2797 |
| 229 | Ga0157380_10284018 | 3300014326 | Bacteria | 1516 |
| 230 | Ga0157380_10473288 | 3300014326 | Unclassified | 1209 |
| 231 | Ga0157376_10017643 | 3300014969 | Bacteria | 5451 |
| 232 | Ga0206349_1021214 | 3300020075 | Bacteria | 2614 |
| 233 | Ga0206351_10214976 | 3300020077 | Bacteria | 2302 |
| 234 | Ga0213874_10038735 | 3300021377 | Bacteria | 1416 |
| 235 | Ga0213876_10000422 | 3300021384 | Bacteria | 35278 |
| 236 | Ga0213875_10043471 | 3300021388 | Bacteria | 2110 |
| 237 | Ga0224712_10003705 | 3300022467 | Bacteria | 4015 |
| 238 | Ga0224712_10017120 | 3300022467 | Bacteria | 2397 |
| 239 | Ga0207666_1006577 | 3300025271 | Bacteria | 1511 |
| 240 | Ga0207697_10166163 | 3300025315 | Bacteria | 964 |
| 241 | Ga0207692_10108241 | 3300025898 | Unclassified | 1537 |
| 242 | Ga0207642_10029077 | 3300025899 | Bacteria | 2284 |
| 243 | Ga0207680_10253945 | 3300025903 | Bacteria | 1215 |
| 244 | Ga0207647_10120299 | 3300025904 | Bacteria | 1548 |
| 245 | Ga0207699_10002389 | 3300025906 | Bacteria | 8861 |
| 246 | Ga0207699_10029634 | 3300025906 | Bacteria | 3054 |
| 247 | Ga0207645_10004858 | 3300025907 | Bacteria | 9864 |
| 248 | Ga0207643_10093499 | 3300025908 | Bacteria | 1755 |
| 249 | Ga0207684_10004086 | 3300025910 | Bacteria | 13909 |
| 250 | Ga0207684_10006772 | 3300025910 | Bacteria | 10394 |
| 251 | Ga0207684_10028825 | 3300025910 | Bacteria | 4728 |
| 252 | Ga0207684_10177950 | 3300025910 | Bacteria | 1834 |
| 253 | Ga0207707_10008698 | 3300025912 | Bacteria | 8811 |
| 254 | Ga0207707_10010052 | 3300025912 | Bacteria | 8207 |
| 255 | Ga0207707_10123864 | 3300025912 | Bacteria | 2260 |
| 256 | Ga0207707_10295321 | 3300025912 | Bacteria | 1402 |
| 257 | Ga0207695_10005313 | 3300025913 | Bacteria | 17157 |
| 258 | Ga0207693_10015487 | 3300025915 | Bacteria | 6118 |
| 259 | Ga0207660_10021678 | 3300025917 | Bacteria | 4323 |
| 260 | Ga0207662_10007422 | 3300025918 | Bacteria | 5970 |
| 261 | Ga0207662_10024684 | 3300025918 | Bacteria | 3459 |
| 262 | Ga0207657_10071102 | 3300025919 | Bacteria | 2947 |
| 263 | Ga0207652_10022504 | 3300025921 | Bacteria | 5215 |
| 264 | Ga0207652_10038989 | 3300025921 | Bacteria | 4030 |
| 265 | Ga0207652_10073005 | 3300025921 | Bacteria | 2984 |
| 266 | Ga0207652_10224120 | 3300025921 | Bacteria | 1694 |
| 267 | Ga0207652_10491624 | 3300025921 | Bacteria | 1105 |
| 268 | Ga0207646_10000759 | 3300025922 | Bacteria | 41860 |
| 269 | Ga0207646_10021798 | 3300025922 | Bacteria | 5911 |
| 270 | Ga0207646_10128685 | 3300025922 | Unclassified | 2278 |
| 271 | Ga0207681_10005309 | 3300025923 | Bacteria | 7916 |
| 272 | Ga0207681_10034967 | 3300025923 | Bacteria | 3308 |
| 273 | Ga0207694_10068221 | 3300025924 | Bacteria | 2777 |
| 274 | Ga0207650_10014997 | 3300025925 | Bacteria | 5390 |
| 275 | Ga0207659_10015233 | 3300025926 | Bacteria | 4976 |
| 276 | Ga0207687_10003713 | 3300025927 | Bacteria | 10274 |
| 277 | Ga0207687_10005579 | 3300025927 | Bacteria | 8314 |
| 278 | Ga0207700_10005353 | 3300025928 | Bacteria | 7660 |
| 279 | Ga0207700_10011557 | 3300025928 | Bacteria | 5636 |
| 280 | Ga0207700_10017851 | 3300025928 | Bacteria | 4749 |
| 281 | Ga0207700_10069468 | 3300025928 | Bacteria | 2704 |
| 282 | Ga0207700_10089194 | 3300025928 | Bacteria | 2430 |
| 283 | Ga0207700_10116617 | 3300025928 | Bacteria | 2158 |
| 284 | Ga0207700_10178804 | 3300025928 | Bacteria | 1775 |
| 285 | Ga0207664_10014420 | 3300025929 | Bacteria | 5706 |
| 286 | Ga0207664_10128168 | 3300025929 | Bacteria | 2133 |
| 287 | Ga0207690_10000668 | 3300025932 | Bacteria | 21960 |
| 288 | Ga0207690_10010808 | 3300025932 | Bacteria | 5439 |
| 289 | Ga0207706_10013624 | 3300025933 | Bacteria | 7385 |
| 290 | Ga0207706_10039015 | 3300025933 | Bacteria | 4212 |
| 291 | Ga0207706_10093627 | 3300025933 | Bacteria | 2642 |
| 292 | Ga0207709_10637680 | 3300025935 | Bacteria | 847 |
| 293 | Ga0207670_10003568 | 3300025936 | Bacteria | 8262 |
| 294 | Ga0207670_10151340 | 3300025936 | Bacteria | 1722 |
| 295 | Ga0207669_10000882 | 3300025937 | Bacteria | 12697 |
| 296 | Ga0207669_10164729 | 3300025937 | Bacteria | 1571 |
| 297 | Ga0207704_10002528 | 3300025938 | Bacteria | 8243 |
| 298 | Ga0207691_10003103 | 3300025940 | Bacteria | 16223 |
| 299 | Ga0207711_10164990 | 3300025941 | Bacteria | 2007 |
| 300 | Ga0207689_10011603 | 3300025942 | Bacteria | 7549 |
| 301 | Ga0207689_10147892 | 3300025942 | Bacteria | 1936 |
| 302 | Ga0207661_10005786 | 3300025944 | Bacteria | 8718 |
| 303 | Ga0207661_10023436 | 3300025944 | Bacteria | 4664 |
| 304 | Ga0207661_10050549 | 3300025944 | Bacteria | 3312 |
| 305 | Ga0207661_10106323 | 3300025944 | Bacteria | 2365 |
| 306 | Ga0207679_10013719 | 3300025945 | Bacteria | 5313 |
| 307 | Ga0207679_10051245 | 3300025945 | Bacteria | 3021 |
| 308 | Ga0207667_10023459 | 3300025949 | Bacteria | 6793 |
| 309 | Ga0207651_10047297 | 3300025960 | Bacteria | 2900 |
| 310 | Ga0207712_10058827 | 3300025961 | Bacteria | 2717 |
| 311 | Ga0207712_10151853 | 3300025961 | Bacteria | 1790 |
| 312 | Ga0207668_10015516 | 3300025972 | Bacteria | 4735 |
| 313 | Ga0207668_10203942 | 3300025972 | Bacteria | 1577 |
| 314 | Ga0207658_10010275 | 3300025986 | Bacteria | 6360 |
| 315 | Ga0207677_10080500 | 3300026023 | Bacteria | 2334 |
| 316 | Ga0207703_10030733 | 3300026035 | Bacteria | 4244 |
| 317 | Ga0207708_10001712 | 3300026075 | Bacteria | 16232 |
| 318 | Ga0207708_10094193 | 3300026075 | Bacteria | 2312 |
| 319 | Ga0207708_10095028 | 3300026075 | Bacteria | 2302 |
| 320 | Ga0207702_10002092 | 3300026078 | Bacteria | 19254 |
| 321 | Ga0207702_10002412 | 3300026078 | Bacteria | 17778 |
| 322 | Ga0207702_10171962 | 3300026078 | Bacteria | 1987 |
| 323 | Ga0207702_10302182 | 3300026078 | Bacteria | 1519 |
| 324 | Ga0207641_10027946 | 3300026088 | Bacteria | 4659 |
| 325 | Ga0207641_10899119 | 3300026088 | Bacteria | 879 |
| 326 | Ga0207648_10018221 | 3300026089 | Bacteria | 6360 |
| 327 | Ga0207648_10027889 | 3300026089 | Bacteria | 5010 |
| 328 | Ga0207676_10003054 | 3300026095 | Bacteria | 11946 |
| 329 | Ga0207676_10420612 | 3300026095 | Bacteria | 1253 |
| 330 | Ga0207674_10000120 | 3300026116 | Bacteria | 91883 |
| 331 | Ga0207674_10000366 | 3300026116 | Bacteria | 58754 |
| 332 | Ga0207674_10006207 | 3300026116 | Bacteria | 14084 |
| 333 | Ga0207674_10089473 | 3300026116 | Bacteria | 3071 |
| 334 | Ga0207675_100002168 | 3300026118 | Bacteria | 19505 |
| 335 | Ga0207675_100012609 | 3300026118 | Bacteria | 7897 |
| 336 | Ga0207675_100192701 | 3300026118 | Bacteria | 1955 |
| 337 | Ga0207675_100337858 | 3300026118 | Bacteria | 1474 |
| 338 | Ga0207428_10075243 | 3300027907 | Bacteria | 2647 |
| 339 | Ga0268265_10003865 | 3300028380 | Bacteria | 10576 |
| 340 | Ga0268265_10094969 | 3300028380 | Bacteria | 2393 |
| 341 | Ga0268265_10167452 | 3300028380 | Bacteria | 1874 |
| 342 | Ga0268265_10841856 | 3300028380 | Bacteria | 897 |
| 343 | Ga0268264_10075298 | 3300028381 | Bacteria | 2870 |
| 344 | Ga0268264_10150506 | 3300028381 | Bacteria | 2086 |
| 345 | Ga0268264_10560515 | 3300028381 | Bacteria | 1122 |
| 346 | Ga0265334_10048236 | 3300028573 | Bacteria | 1641 |
| 347 | Ga0265318_10000178 | 3300028577 | Bacteria | 56405 |
| 348 | Ga0265318_10018767 | 3300028577 | Bacteria | 2816 |
| 349 | Ga0265323_10004508 | 3300028653 | Bacteria | 6006 |
| 350 | Ga0265323_10013823 | 3300028653 | Bacteria | 3211 |
| 351 | Ga0265323_10041946 | 3300028653 | Bacteria | 1658 |
| 352 | Ga0265336_10023827 | 3300028666 | Bacteria | 1938 |
| 353 | Ga0265338_10005521 | 3300028800 | Bacteria | 16486 |
| 354 | Ga0265338_10056870 | 3300028800 | Bacteria | 3464 |
| 355 | Ga0265330_10000164 | 3300031235 | Bacteria | 52665 |
| 356 | Ga0265330_10000645 | 3300031235 | Bacteria | 22423 |
| 357 | Ga0265330_10000982 | 3300031235 | Bacteria | 17423 |
| 358 | Ga0265330_10001395 | 3300031235 | Bacteria | 14130 |
| 359 | Ga0265330_10007773 | 3300031235 | Bacteria | 5206 |
| 360 | Ga0265330_10024432 | 3300031235 | Bacteria | 2741 |
| 361 | Ga0265332_10000226 | 3300031238 | Bacteria | 45357 |
| 362 | Ga0265332_10017126 | 3300031238 | Bacteria | 3197 |
| 363 | Ga0265332_10022056 | 3300031238 | Bacteria | 2810 |
| 364 | Ga0265328_10000594 | 3300031239 | Bacteria | 16800 |
| 365 | Ga0265320_10000158 | 3300031240 | Bacteria | 56439 |
| 366 | Ga0265320_10003882 | 3300031240 | Bacteria | 9897 |
| 367 | Ga0265320_10005336 | 3300031240 | Bacteria | 8265 |
| 368 | Ga0265325_10000338 | 3300031241 | Bacteria | 33218 |
| 369 | Ga0265329_10000550 | 3300031242 | Bacteria | 19351 |
| 370 | Ga0265329_10000905 | 3300031242 | Bacteria | 14872 |
| 371 | Ga0265329_10002438 | 3300031242 | Bacteria | 8420 |
| 372 | Ga0265329_10044046 | 3300031242 | Bacteria | 1427 |
| 373 | Ga0265340_10009098 | 3300031247 | Bacteria | 5341 |
| 374 | Ga0265340_10026018 | 3300031247 | Bacteria | 2961 |
| 375 | Ga0265339_10012831 | 3300031249 | Bacteria | 5094 |
| 376 | Ga0265339_10029579 | 3300031249 | Bacteria | 3108 |
| 377 | Ga0265339_10044607 | 3300031249 | Bacteria | 2445 |
| 378 | Ga0265339_10127295 | 3300031249 | Bacteria | 1305 |
| 379 | Ga0265331_10000283 | 3300031250 | Bacteria | 56424 |
| 380 | Ga0265316_10000530 | 3300031344 | Bacteria | 43046 |
| 381 | Ga0265316_10000837 | 3300031344 | Bacteria | 34100 |
| 382 | Ga0265316_10000918 | 3300031344 | Bacteria | 32093 |
| 383 | Ga0265316_10000968 | 3300031344 | Bacteria | 31294 |
| 384 | Ga0265316_10001094 | 3300031344 | Bacteria | 29360 |
| 385 | Ga0265316_10001828 | 3300031344 | Bacteria | 22390 |
| 386 | Ga0265316_10003413 | 3300031344 | Bacteria | 16073 |
| 387 | Ga0265316_10008905 | 3300031344 | Bacteria | 9266 |
| 388 | Ga0265316_10011363 | 3300031344 | Bacteria | 8038 |
| 389 | Ga0265316_10014446 | 3300031344 | Bacteria | 6948 |
| 390 | Ga0265316_10041565 | 3300031344 | Bacteria | 3678 |
| 391 | Ga0265316_10137200 | 3300031344 | Bacteria | 1840 |
| 392 | Ga0265316_10474058 | 3300031344 | Bacteria | 896 |
| 393 | Ga0307408_100048383 | 3300031548 | Unclassified | 3050 |
| 394 | Ga0307408_100141051 | 3300031548 | Bacteria | 1892 |
| 395 | Ga0265313_10000434 | 3300031595 | Bacteria | 44323 |
| 396 | Ga0265313_10000516 | 3300031595 | Bacteria | 40397 |
| 397 | Ga0265313_10003119 | 3300031595 | Bacteria | 13692 |
| 398 | Ga0265313_10069335 | 3300031595 | Bacteria | 1627 |
| 399 | Ga0316575_10002464 | 3300031665 | Bacteria | 6225 |
| 400 | Ga0316579_10064493 | 3300031691 | Bacteria | 1728 |
| 401 | Ga0316579_10115633 | 3300031691 | Unclassified | 1288 |
| 402 | Ga0265314_10000427 | 3300031711 | Bacteria | 56422 |
| 403 | Ga0265314_10003291 | 3300031711 | Bacteria | 15782 |
| 404 | Ga0265314_10004747 | 3300031711 | Bacteria | 12458 |
| 405 | Ga0265314_10013708 | 3300031711 | Bacteria | 6535 |
| 406 | Ga0265314_10028744 | 3300031711 | Bacteria | 4141 |
| 407 | Ga0265314_10203891 | 3300031711 | Bacteria | 1167 |
| 408 | Ga0265342_10000091 | 3300031712 | Bacteria | 99171 |
| 409 | Ga0265342_10000236 | 3300031712 | Bacteria | 61931 |
| 410 | Ga0265342_10000495 | 3300031712 | Bacteria | 42361 |
| 411 | Ga0265342_10001020 | 3300031712 | Bacteria | 27589 |
| 412 | Ga0265342_10002502 | 3300031712 | Bacteria | 15832 |
| 413 | Ga0265342_10004150 | 3300031712 | Bacteria | 11533 |
| 414 | Ga0265342_10004929 | 3300031712 | Bacteria | 10307 |
| 415 | Ga0265342_10069145 | 3300031712 | Bacteria | 2062 |
| 416 | Ga0265342_10101930 | 3300031712 | Bacteria | 1634 |
| 417 | Ga0316576_10007551 | 3300031727 | Bacteria | 6860 |
| 418 | Ga0316576_10007959 | 3300031727 | Bacteria | 6714 |
| 419 | Ga0316576_10067782 | 3300031727 | Bacteria | 2628 |
| 420 | Ga0316576_10233435 | 3300031727 | Unclassified | 1383 |
| 421 | Ga0316578_10012016 | 3300031728 | Bacteria | 4555 |
| 422 | Ga0316578_10064514 | 3300031728 | Bacteria | 2162 |
| 423 | Ga0316578_10093335 | 3300031728 | Bacteria | 1800 |
| 424 | Ga0316578_10174165 | 3300031728 | Bacteria | 1297 |
| 425 | Ga0316577_10010055 | 3300031733 | Bacteria | 5100 |
| 426 | Ga0316577_10013010 | 3300031733 | Bacteria | 4540 |
| 427 | Ga0316577_10015694 | 3300031733 | Bacteria | 4167 |
| 428 | Ga0316577_10018126 | 3300031733 | Bacteria | 3891 |
| 429 | Ga0316577_10027251 | 3300031733 | Bacteria | 3185 |
| 430 | Ga0316577_10035035 | 3300031733 | Bacteria | 2805 |
| 431 | Ga0316577_10038636 | 3300031733 | Unclassified | 2669 |
| 432 | Ga0316577_10061014 | 3300031733 | Bacteria | 2104 |
| 433 | Ga0316577_10076812 | 3300031733 | Bacteria | 1865 |
| 434 | Ga0316577_10084872 | 3300031733 | Bacteria | 1772 |
| 435 | Ga0316577_10168613 | 3300031733 | Bacteria | 1235 |
| 436 | Ga0316577_10204286 | 3300031733 | Bacteria | 1117 |
| 437 | Ga0316577_10205991 | 3300031733 | Bacteria | 1112 |
| 438 | Ga0307413_10113642 | 3300031824 | Bacteria | 1818 |
| 439 | Ga0307410_10182846 | 3300031852 | Bacteria | 1588 |
| 440 | Ga0307407_10025229 | 3300031903 | Bacteria | 3130 |
| 441 | Ga0307407_10178993 | 3300031903 | Bacteria | 1404 |
| 442 | Ga0307412_10062051 | 3300031911 | Bacteria | 2515 |
| 443 | Ga0307409_100551314 | 3300031995 | Bacteria | 1132 |
| 444 | Ga0307416_100043038 | 3300032002 | Bacteria | 3532 |
| 445 | Ga0307411_10063582 | 3300032005 | Unclassified | 2467 |
| 446 | Ga0307415_100187466 | 3300032126 | Bacteria | 1629 |
| 447 | Ga0307415_100304119 | 3300032126 | Unclassified | 1322 |
| 448 | Ga0316580_10044971 | 3300032139 | Bacteria | 1362 |
| 449 | Ga0373926_0009943 | 3300035083 | Bacteria | 3185 |
| 450 | Ga0373926_0047916 | 3300035083 | Bacteria | 1536 |
| 451 | Ga0373934_0005155 | 3300035086 | Bacteria | 4841 |
| 452 | Ga0373934_0010621 | 3300035086 | Bacteria | 3458 |
| 453 | Ga0373944_0009883 | 3300035089 | Bacteria | 2594 |
| 454 | Ga0373923_0003831 | 3300035111 | Bacteria | 4895 |
| 455 | Ga0373945_0001777 | 3300035116 | Bacteria | 6659 |
| 456 | Ga0373945_0079117 | 3300035116 | Bacteria | 1257 |
| 457 | Ga0373953_0091555 | 3300035117 | Bacteria | 1272 |
| 458 | Ga0373953_0100575 | 3300035117 | Bacteria | 1216 |
| 459 | Ga0373953_0169520 | 3300035117 | Bacteria | 939 |
| 460 | Ga0373954_0008997 | 3300035118 | Bacteria | 4394 |
| 461 | Ga0373954_0040372 | 3300035118 | Bacteria | 2174 |
| 462 | Ga0373954_0061910 | 3300035118 | Bacteria | 1767 |
| 463 | Ga0373954_0068112 | 3300035118 | Bacteria | 1688 |
| 464 | Ga0373956_0001279 | 3300035119 | Bacteria | 10425 |
| 465 | Ga0373956_0077885 | 3300035119 | Bacteria | 1518 |
| 466 | Ga0373957_0024042 | 3300035120 | Bacteria | 2184 |
| 467 | Ga0373957_0031047 | 3300035120 | Bacteria | 1961 |
| 468 | Ga0373957_0042289 | 3300035120 | Bacteria | 1719 |
| 469 | Ga0373957_0056881 | 3300035120 | Bacteria | 1507 |
| 470 | Ga0373943_0041765 | 3300035170 | Bacteria | 2219 |
| 471 | Ga0373946_0028653 | 3300035171 | Bacteria | 2210 |
| 472 | Ga0373955_0003339 | 3300035172 | Bacteria | 7051 |
| 473 | Ga0373955_0005225 | 3300035172 | Bacteria | 5819 |
| 474 | Ga0316574_0005803 | 3300035398 | Bacteria | 6621 |
| 475 | Ga0316574_0036074 | 3300035398 | Bacteria | 3026 |
| 476 | Ga0316574_0058020 | 3300035398 | Unclassified | 2425 |
| 477 | Ga0316574_0350007 | 3300035398 | Bacteria | 935 |
| 478 | Ga0373924_0002966 | 3300035410 | Bacteria | 5768 |
| 479 | Ga0373931_0080503 | 3300035691 | Bacteria | 1796 |
| 480 | Ga0373935_0140391 | 3300035692 | Bacteria | 1632 |
| 481 | Ga0373927_0004165 | 3300035695 | Bacteria | 10164 |
| 482 | Ga0373927_0021679 | 3300035695 | Bacteria | 4210 |
| 483 | Ga0373933_0000071 | 3300035724 | Bacteria | 62531 |
| 484 | Ga0373933_0002827 | 3300035724 | Bacteria | 9699 |
| 485 | Ga0373933_0006888 | 3300035724 | Bacteria | 6191 |
| 486 | Ga0373933_0026940 | 3300035724 | Bacteria | 3306 |
| 487 | Ga0373933_0145970 | 3300035724 | Bacteria | 1496 |
| 488 | Ga0373947_0000536 | 3300035725 | Bacteria | 22230 |
| 489 | Ga0373947_0003376 | 3300035725 | Bacteria | 9447 |
| 490 | Ga0373937_0000141 | 3300036401 | Bacteria | 69735 |
| 491 | Ga0373937_0001599 | 3300036401 | Bacteria | 19042 |
| 492 | Ga0373937_0010952 | 3300036401 | Bacteria | 7942 |
| 493 | Ga0373937_0055944 | 3300036401 | Bacteria | 3622 |
| 494 | Ga0373937_0199663 | 3300036401 | Bacteria | 1880 |
| 495 | Ga0373937_0237430 | 3300036401 | Bacteria | 1717 |
| 496 | Ga0316582_0001573 | 3300036647 | Bacteria | 10158 |
| 497 | Ga0316582_0001967 | 3300036647 | Bacteria | 9403 |
| 498 | Ga0316582_0002907 | 3300036647 | Bacteria | 8233 |
| 499 | Ga0316582_0012828 | 3300036647 | Bacteria | 4694 |
| 500 | Ga0316582_0015539 | 3300036647 | Bacteria | 4358 |
| 501 | Ga0316582_0033750 | 3300036647 | Bacteria | 3146 |
| 502 | Ga0316582_0084932 | 3300036647 | Bacteria | 2073 |
| 503 | Ga0316582_0086300 | 3300036647 | Unclassified | 2058 |
| 504 | Ga0316582_0108532 | 3300036647 | Bacteria | 1845 |
| 505 | Ga0316582_0117457 | 3300036647 | Bacteria | 1777 |
| 506 | Ga0316582_0196503 | 3300036647 | Bacteria | 1375 |
| 507 | Ga0316582_0234567 | 3300036647 | Bacteria | 1256 |
| 508 | Ga0316582_0248734 | 3300036647 | Bacteria | 1218 |
| 509 | Ga0316582_0379225 | 3300036647 | Bacteria | 974 |
| 510 | Ga0316584_0000161 | 3300036712 | Bacteria | 31222 |
| 511 | Ga0316584_0004045 | 3300036712 | Bacteria | 9651 |
| 512 | Ga0316584_0006407 | 3300036712 | Bacteria | 7968 |
| 513 | Ga0316584_0011111 | 3300036712 | Bacteria | 6315 |
| 514 | Ga0316584_0021002 | 3300036712 | Bacteria | 4742 |
| 515 | Ga0316584_0035682 | 3300036712 | Bacteria | 3690 |
| 516 | Ga0316584_0042074 | 3300036712 | Bacteria | 3406 |
| 517 | Ga0316584_0053946 | 3300036712 | Bacteria | 3008 |
| 518 | Ga0316584_0107666 | 3300036712 | Bacteria | 2086 |
| 519 | Ga0316584_0108799 | 3300036712 | Bacteria | 2074 |
| 520 | Ga0316584_0141617 | 3300036712 | Bacteria | 1793 |
| 521 | Ga0316584_0161945 | 3300036712 | Bacteria | 1662 |
| 522 | Ga0316584_0509316 | 3300036712 | Bacteria | 845 |
| 523 | Ga0373925_0009561 | 3300037068 | Bacteria | 7062 |
| 524 | Ga0373925_0656219 | 3300037068 | Bacteria | 865 |
| 525 | Ga0395900_0288242 | 3300037418 | Bacteria | 1631 |
| 526 | Ga0395905_0005426 | 3300037471 | Bacteria | 13027 |
| 527 | Ga0395905_0532611 | 3300037471 | Bacteria | 1075 |
| 528 | Ga0316581_0000595 | 3300037588 | Bacteria | 7147 |
| 529 | Ga0316581_0003022 | 3300037588 | Bacteria | 4141 |
| 530 | Ga0316581_0003775 | 3300037588 | Bacteria | 3806 |
| 531 | Ga0316581_0004957 | 3300037588 | Bacteria | 3431 |
| 532 | Ga0316581_0046255 | 3300037588 | Bacteria | 1330 |
| 533 | Ga0316581_0048409 | 3300037588 | Bacteria | 1301 |
| 534 | Ga0436364_0198679 | 3300037853 | Bacteria | 2531 |
| 535 | Ga0395901_0006659 | 3300038443 | Bacteria | 11675 |
| 536 | Ga0395901_0042233 | 3300038443 | Bacteria | 4727 |
| 537 | Ga0237819_07077 | 3300038705 | Bacteria | 1636 |
| 538 | Ga0400483_061585 | 3300039062 | Bacteria | 3334 |
| 539 | Ga0400483_148375 | 3300039062 | Bacteria | 4862 |
| 540 | Ga0400489_11819 | 3300039093 | Bacteria | 9617 |
| 541 | Ga0400489_15711 | 3300039093 | Bacteria | 10276 |
| 542 | Ga0400489_25754 | 3300039093 | Bacteria | 2785 |
| 543 | Ga0400489_25858 | 3300039093 | Bacteria | 2449 |
| 544 | Ga0400489_65167 | 3300039093 | Bacteria | 4627 |
| 545 | Ga0400489_79360 | 3300039093 | Bacteria | 1814 |
| 546 | Ga0400487_17497 | 3300039110 | Bacteria | 2777 |
| 547 | Ga0436365_0301490 | 3300039437 | Bacteria | 5906 |
| 548 | Ga0436365_0637502 | 3300039437 | Bacteria | 1658 |
| 549 | Ga0436365_0873465 | 3300039437 | Bacteria | 246686 |
| 550 | Ga0436363_0280714 | 3300039450 | Bacteria | 4273 |
| 551 | Ga0451577_0000197 | 3300042876 | Bacteria | 126180 |
| 552 | Ga0451577_0017683 | 3300042876 | Bacteria | 6581 |
| 553 | Ga0451577_0032219 | 3300042876 | Bacteria | 4723 |
| 554 | Ga0451577_0078601 | 3300042876 | Bacteria | 2941 |
| 555 | Ga0451577_0099754 | 3300042876 | Bacteria | 2594 |
| 556 | Ga0451577_0130933 | 3300042876 | Bacteria | 2250 |
| 557 | Ga0451577_0152294 | 3300042876 | Bacteria | 2081 |
| 558 | Ga0451577_0421566 | 3300042876 | Unclassified | 1212 |
| 559 | Ga0451577_0496472 | 3300042876 | Bacteria | 1108 |
| 560 | Ga0466969_0016606 | 3300044656 | Bacteria | 3850 |
| 561 | Ga0453683_0000169 | 3300044673 | Bacteria | 90993 |
| 562 | Ga0453683_0018122 | 3300044673 | Bacteria | 4522 |
| 563 | Ga0453683_0060567 | 3300044673 | Bacteria | 2367 |
| 564 | Ga0453683_0159473 | 3300044673 | Bacteria | 1427 |
| 565 | Ga0466966_0010205 | 3300044684 | Bacteria | 6231 |
| 566 | Ga0466961_0041464 | 3300044693 | Bacteria | 2951 |
| 567 | Ga0466963_0217592 | 3300044694 | Bacteria | 1337 |
| 568 | Ga0453684_0000393 | 3300044712 | Bacteria | 179711 |
| 569 | Ga0453684_0000476 | 3300044712 | Bacteria | 159159 |
| 570 | Ga0453684_0002622 | 3300044712 | Bacteria | 42982 |
| 571 | Ga0453684_0004500 | 3300044712 | Bacteria | 29290 |
| 572 | Ga0453684_0006175 | 3300044712 | Bacteria | 23014 |
| 573 | Ga0453684_0006191 | 3300044712 | Bacteria | 22950 |
| 574 | Ga0453684_0014058 | 3300044712 | Bacteria | 12878 |
| 575 | Ga0453684_0021256 | 3300044712 | Bacteria | 9710 |
| 576 | Ga0453684_0027265 | 3300044712 | Bacteria | 8200 |
| 577 | Ga0453684_0044560 | 3300044712 | Bacteria | 5933 |
| 578 | Ga0453684_0059927 | 3300044712 | Bacteria | 4902 |
| 579 | Ga0453684_0099289 | 3300044712 | Bacteria | 3566 |
| 580 | Ga0453684_0203964 | 3300044712 | Unclassified | 2303 |
| 581 | Ga0453684_0291254 | 3300044712 | Unclassified | 1859 |
| 582 | Ga0453684_0644187 | 3300044712 | Bacteria | 1157 |
| 583 | Ga0453684_0653455 | 3300044712 | Bacteria | 1147 |
| 584 | Ga0466971_0110696 | 3300044719 | Bacteria | 1267 |
| 585 | Ga0466957_0030389 | 3300044842 | Bacteria | 3225 |
| 586 | Ga0451576_0000145 | 3300045051 | Bacteria | 179711 |
| 587 | Ga0451576_0001182 | 3300045051 | Bacteria | 46819 |
| 588 | Ga0451576_0013401 | 3300045051 | Bacteria | 9172 |
| 589 | Ga0451576_0130784 | 3300045051 | Unclassified | 2616 |
| 590 | Ga0451576_0245881 | 3300045051 | Bacteria | 1869 |
| 591 | Ga0451576_0275935 | 3300045051 | Bacteria | 1757 |
| 592 | Ga0451576_0435570 | 3300045051 | Bacteria | 1376 |
| 593 | Ga0451576_0794360 | 3300045051 | Bacteria | 994 |
| 594 | Ga0466967_0001023 | 3300045976 | Bacteria | 15334 |
| 595 | Ga0466967_0015155 | 3300045976 | Bacteria | 6034 |
| 596 | Ga0466967_0055352 | 3300045976 | Bacteria | 3494 |
| 597 | Ga0495592_0016891 | 3300046454 | Bacteria | 5542 |
| 598 | Ga0495592_0097606 | 3300046454 | Bacteria | 2098 |
| 599 | Ga0495603_0004951 | 3300046455 | Bacteria | 7972 |
| 600 | Ga0495629_0022693 | 3300046459 | Bacteria | 4473 |
| 601 | Ga0495629_0025318 | 3300046459 | Bacteria | 4219 |
| 602 | Ga0495651_0000069 | 3300046462 | Bacteria | 75854 |
| 603 | Ga0495651_0031688 | 3300046462 | Bacteria | 4122 |
| 604 | Ga0495653_0000117 | 3300046463 | Bacteria | 65854 |
| 605 | Ga0495653_0152105 | 3300046463 | Unclassified | 1616 |
| 606 | Ga0495580_0135068 | 3300046472 | Bacteria | 1710 |
| 607 | Ga0495582_0035148 | 3300046473 | Bacteria | 2755 |
| 608 | Ga0495639_0001030 | 3300046475 | Bacteria | 12572 |
| 609 | Ga0495639_0048900 | 3300046475 | Archaea | 1918 |
| 610 | Ga0495662_0195821 | 3300046476 | Bacteria | 996 |
| 611 | Ga0495664_0070386 | 3300046477 | Bacteria | 2089 |
| 612 | Ga0495594_0003012 | 3300046499 | Bacteria | 8729 |
| 613 | Ga0495594_0027621 | 3300046499 | Bacteria | 3059 |
| 614 | Ga0495608_0000103 | 3300046511 | Bacteria | 60432 |
| 615 | Ga0495628_0000082 | 3300046516 | Bacteria | 74118 |
| 616 | Ga0495628_0051656 | 3300046516 | Bacteria | 3250 |
| 617 | Ga0495630_0000666 | 3300046517 | Bacteria | 24813 |
| 618 | Ga0495630_0001791 | 3300046517 | Bacteria | 14992 |
| 619 | Ga0495643_0000173 | 3300046522 | Bacteria | 102549 |
| 620 | Ga0495643_0085957 | 3300046522 | Bacteria | 1630 |
| 621 | Ga0495652_0001484 | 3300046529 | Bacteria | 25898 |
| 622 | Ga0495652_0363922 | 3300046529 | Bacteria | 1033 |
| 623 | Ga0495665_0001803 | 3300046531 | Bacteria | 11535 |
| 624 | Ga0495665_0231779 | 3300046531 | Bacteria | 953 |
| 625 | Ga0495640_0079520 | 3300046533 | Bacteria | 2183 |
| 626 | Ga0495640_0205076 | 3300046533 | Bacteria | 1248 |
| 627 | Ga0495586_0048222 | 3300046535 | Bacteria | 2301 |
| 628 | Ga0495587_0000147 | 3300046536 | Bacteria | 52763 |
| 629 | Ga0495587_0000298 | 3300046536 | Bacteria | 35411 |
| 630 | Ga0495645_0000061 | 3300046543 | Bacteria | 79047 |
| 631 | Ga0495645_0001109 | 3300046543 | Bacteria | 18211 |
| 632 | Ga0495622_0133847 | 3300046557 | Bacteria | 1128 |
| 633 | Ga0495667_0000269 | 3300046559 | Bacteria | 33726 |
| 634 | Ga0495667_0014755 | 3300046559 | Bacteria | 5280 |
| 635 | Ga0495635_0000071 | 3300046663 | Bacteria | 63128 |
| 636 | Ga0495659_0055110 | 3300046664 | Bacteria | 1456 |
| 637 | Ga0495588_0033049 | 3300046674 | Bacteria | 2611 |
| 638 | Ga0495588_0038331 | 3300046674 | Bacteria | 2437 |
| 639 | Ga0495588_0040339 | 3300046674 | Bacteria | 2381 |
| 640 | Ga0495657_0000366 | 3300046675 | Bacteria | 41737 |
| 641 | Ga0495657_0167592 | 3300046675 | Bacteria | 1355 |
| 642 | Ga0495657_0204942 | 3300046675 | Bacteria | 1201 |
| 643 | Ga0495599_0000859 | 3300046678 | Bacteria | 16977 |
| 644 | Ga0495599_0002136 | 3300046678 | Bacteria | 11486 |
| 645 | Ga0495623_0000193 | 3300046679 | Bacteria | 38845 |
| 646 | Ga0495623_0002351 | 3300046679 | Bacteria | 12585 |
| 647 | Ga0495646_0007102 | 3300046680 | Bacteria | 7114 |
| 648 | Ga0495658_0000148 | 3300046683 | Bacteria | 39132 |
| 649 | Ga0495613_0023440 | 3300046689 | Bacteria | 4598 |
| 650 | Ga0495613_0074533 | 3300046689 | Bacteria | 2471 |
| 651 | Ga0495613_0156658 | 3300046689 | Bacteria | 1622 |
| 652 | Ga0495613_0400515 | 3300046689 | Bacteria | 936 |
| 653 | Ga0495613_0421768 | 3300046689 | Bacteria | 908 |
| 654 | Ga0495600_0000133 | 3300046809 | Bacteria | 42147 |
| 655 | Ga0495600_0017358 | 3300046809 | Bacteria | 4578 |
| 656 | Ga0495581_0001652 | 3300047315 | Bacteria | 12429 |
| 657 | Ga0495581_0016039 | 3300047315 | Bacteria | 4354 |
| 658 | Ga0495604_0000028 | 3300047317 | Bacteria | 141804 |
| 659 | Ga0495604_0216741 | 3300047317 | Bacteria | 1320 |
| 660 | Ga0495674_0001137 | 3300047319 | Bacteria | 25628 |
| 661 | Ga0495674_0011474 | 3300047319 | Bacteria | 8360 |
| 662 | Ga0495674_0084975 | 3300047319 | Bacteria | 2711 |
| 663 | Ga0495674_0149657 | 3300047319 | Bacteria | 1958 |
| 664 | Ga0495674_0396217 | 3300047319 | Bacteria | 1115 |
| 665 | Ga0495680_0019973 | 3300047322 | Bacteria | 5647 |
| 666 | Ga0495680_0157174 | 3300047322 | Bacteria | 1653 |
| 667 | Ga0495675_0001753 | 3300047444 | Bacteria | 12986 |
| 668 | Ga0495675_0003478 | 3300047444 | Bacteria | 9483 |
| 669 | Ga0495675_0160652 | 3300047444 | Bacteria | 1384 |
| 670 | Ga0495684_0000044 | 3300047471 | Bacteria | 93511 |
| 671 | Ga0495684_0011174 | 3300047471 | Bacteria | 6938 |
| 672 | Ga0495684_0280920 | 3300047471 | Bacteria | 1201 |
| 673 | Ga0495593_0000211 | 3300047673 | Bacteria | 30695 |
| 674 | Ga0495602_0000414 | 3300048088 | Bacteria | 40006 |
| 675 | Ga0495614_0000092 | 3300048089 | Bacteria | 30125 |
| 676 | Ga0496101_0383372 | 3300048904 | Bacteria | 1106 |
| 677 | Ga0496104_0027959 | 3300048907 | Bacteria | 5223 |
| 678 | Ga0496104_0120774 | 3300048907 | Bacteria | 2516 |
| 679 | Ga0496104_0146474 | 3300048907 | Bacteria | 2268 |
| 680 | Ga0496109_0203162 | 3300048912 | Bacteria | 1863 |
| 681 | Ga0496112_0000747 | 3300048915 | Bacteria | 22703 |
| 682 | Ga0496112_0105623 | 3300048915 | Bacteria | 2786 |
| 683 | Ga0496113_0066915 | 3300048916 | Bacteria | 2723 |
| 684 | Ga0496113_0167168 | 3300048916 | Bacteria | 1741 |
| 685 | Ga0496114_0004489 | 3300048917 | Bacteria | 10832 |
| 686 | Ga0496114_0029255 | 3300048917 | Bacteria | 4526 |
| 687 | Ga0501291_027508 | 3300049514 | Unclassified | 942 |
| 688 | Ga0501300_001855 | 3300049523 | Bacteria | 3148 |
| 689 | Ga0501033_0007612 | 3300049570 | Bacteria | 8422 |
| 690 | Ga0501034_0074375 | 3300049571 | Bacteria | 3406 |
| 691 | Ga0501034_0085121 | 3300049571 | Bacteria | 3163 |
| 692 | Ga0501036_0221377 | 3300049572 | Bacteria | 1589 |
| 693 | Ga0501037_0046411 | 3300049573 | Bacteria | 3186 |
| 694 | Ga0501039_0139866 | 3300049575 | Bacteria | 1902 |
| 695 | Ga0501043_0015605 | 3300049579 | Bacteria | 5954 |
| 696 | Ga0501047_0046690 | 3300049581 | Bacteria | 4185 |
| 697 | Ga0501047_0060492 | 3300049581 | Bacteria | 3655 |
| 698 | Ga0501070_0168510 | 3300049586 | Bacteria | 1804 |
| 699 | Ga0501073_0010701 | 3300049589 | Bacteria | 6720 |
| 700 | Ga0501198_011727 | 3300049649 | Bacteria | 1311 |
| 701 | Ga0501207_007528 | 3300049654 | Unclassified | 1554 |
| 702 | Ga0501217_003247 | 3300049661 | Unclassified | 3274 |
| 703 | Ga0501223_002407 | 3300049663 | Bacteria | 4169 |
| 704 | Ga0501236_000948 | 3300049670 | Unclassified | 3272 |
| 705 | Ga0501247_003384 | 3300049677 | Bacteria | 1707 |
| 706 | Ga0501035_0000350 | 3300049822 | Bacteria | 52924 |
| 707 | Ga0501035_0322267 | 3300049822 | Bacteria | 1298 |
| 708 | Ga0501044_0002550 | 3300049823 | Bacteria | 20752 |
| 709 | Ga0501044_0141704 | 3300049823 | Bacteria | 2392 |
| 710 | nmdc:mga05p37_17980_c1 | 3300050507 | Bacteria | 8536 |
| 711 | nmdc:mga05p37_278740_c1 | 3300050507 | Unclassified | 1995 |
| 712 | nmdc:mga09592_111741_c1 | 3300050508 | Bacteria | 2344 |
| 713 | nmdc:mga09592_114514_c1 | 3300050508 | Bacteria | 2314 |
| 714 | nmdc:mga09592_4560_c1 | 3300050508 | Bacteria | 11211 |
| 715 | nmdc:mga09592_487762_c1 | 3300050508 | Bacteria | 1061 |
| 716 | nmdc:mga09592_62178_c1 | 3300050508 | Bacteria | 3158 |
| 717 | nmdc:mga0qj67_80637_c1 | 3300050509 | Bacteria | 2608 |
| 718 | nmdc:mga06r32_218316_c1 | 3300050510 | Bacteria | 1895 |
| 719 | nmdc:mga06r32_24579_c1 | 3300050510 | Bacteria | 5595 |
| 720 | nmdc:mga06r32_330694_c1 | 3300050510 | Bacteria | 1509 |
| 721 | nmdc:mga06r32_70754_c1 | 3300050510 | Bacteria | 3375 |
| 722 | nmdc:mga08y16_15747_c1 | 3300050511 | Bacteria | 7952 |
| 723 | nmdc:mga08y16_24197_c1 | 3300050511 | Bacteria | 6410 |
| 724 | nmdc:mga08y16_35168_c1 | 3300050511 | Bacteria | 5262 |
| 725 | nmdc:mga08y16_534244_c1 | 3300050511 | Bacteria | 1188 |
| 726 | nmdc:mga08y16_72264_c1 | 3300050511 | Bacteria | 3595 |
| 727 | nmdc:mga0rr50_171825_c1 | 3300050513 | Bacteria | 1766 |
| 728 | nmdc:mga0rr50_418636_c1 | 3300050513 | Bacteria | 1133 |
| 729 | nmdc:mga0rr50_7858_c1 | 3300050513 | Bacteria | 6614 |
| 730 | nmdc:mga08x19_16_c1 | 3300050514 | Bacteria | 348119 |
| 731 | nmdc:mga0a205_155306_c1 | 3300050515 | Bacteria | 2187 |
| 732 | Ga0495601_0002281 | 3300053077 | Bacteria | 10825 |
| 733 | Ga0495601_0018513 | 3300053077 | Bacteria | 4241 |
| 734 | Ga0495612_0005137 | 3300053078 | Bacteria | 5411 |
| 735 | Ga0495612_0045946 | 3300053078 | Bacteria | 1788 |
| 736 | Ga0495595_0137216 | 3300053084 | Bacteria | 1198 |
| 737 | Ga0495619_0005505 | 3300053085 | Bacteria | 8032 |
| 738 | Ga0495619_0117199 | 3300053085 | Bacteria | 1824 |
| 739 | Ga0500645_038186 | 3300053730 | Bacteria | 1426 |
| 740 | Ga0501084_0012175 | 3300054114 | Bacteria | 7120 |
| 741 | Ga0501084_0061704 | 3300054114 | Bacteria | 3139 |
| 742 | Ga0590071_003932 | 3300059421 | Bacteria | 3637 |
| 743 | Ga0590075_001339 | 3300059424 | Bacteria | 6196 |
| 744 | Ga0501082_0151461 | 3300060353 | Unclassified | 2015 |
| 745 | Ga0501082_0306759 | 3300060353 | Bacteria | 1382 |
| 746 | 2617916016 | 2617270889 | Bacteria | 9064343 |
| 747 | 2739244792 | 2738543012 | Bacteria | 7115078 |
| 748 | 2831428391 | 2831426010 | Bacteria | 8662725 |
| 749 | 2848697274 | 2848694841 | Bacteria | 9205737 |
| 750 | 2849668275 | 2849660919 | Bacteria | 8251853 |
| 751 | 2886632920 | 2886627955 | Bacteria | 7618130 |
| 752 | 2913849126 | 2913844669 | Bacteria | 8381711 |
| 753 | 2913919487 | 2913912277 | Bacteria | 9037797 |
| 754 | 2913944107 | 2913939268 | Bacteria | 8559644 |
| 755 | 2977235548 | 2977232053 | Bacteria | 5485925 |
| 756 | 642604269 | 642555144 | Bacteria | 9059191 |
| 757 | Ga0316584_0097102 | |||
| 758 | SwRhRL3b_contig_3755293 | |||
| 759 | SwRhRL3b_contig_457262 | |||
| 760 | SwRhRL2b_contig_3385910 | |||
| 761 | rootL2_10066076 | |||
| 762 | Ga0065704_10071963 | |||
| 763 | Ga0065707_10102778 | |||
| 764 | Ga0070676_10219599 | |||
| 765 | Ga0070683_100002131 | |||
| 766 | Ga0070683_100020655 | |||
| 767 | Ga0070683_100053685 | |||
| 768 | Ga0070683_100182180 | |||
| 769 | Ga0070690_100002800 | |||
| 770 | Ga0070690_100089427 | |||
| 771 | Ga0070670_100029948 | |||
| 772 | Ga0070670_100360616 | |||
| 773 | Ga0068869_100173820 | |||
| 774 | Ga0068869_100174660 | |||
| 775 | Ga0070666_10080599 | |||
| 776 | Ga0070680_100056327 | |||
| 777 | Ga0070682_100015565 | |||
| 778 | Ga0068868_100011793 | |||
| 779 | Ga0068868_100022889 | |||
| 780 | Ga0070689_100011455 | |||
| 781 | Ga0070689_100047355 | |||
| 782 | Ga0070689_100125171 | |||
| 783 | Ga0070691_10008408 | |||
| 784 | Ga0070691_10052672 | |||
| 785 | Ga0070691_10075052 | |||
| 786 | Ga0070687_100035862 | |||
| 787 | Ga0070687_100326772 | |||
| 788 | Ga0070692_10043668 | |||
| 789 | Ga0070668_100004428 | |||
| 790 | Ga0070669_100002653 | |||
| 791 | Ga0070669_100012904 | |||
| 792 | Ga0070669_100050280 | |||
| 793 | Ga0070675_100001221 | |||
| 794 | Ga0070675_100240610 | |||
| 795 | Ga0070674_100009404 | |||
| 796 | Ga0070673_100016861 | |||
| 797 | Ga0070688_100004105 | |||
| 798 | Ga0070659_100000542 | |||
| 799 | Ga0070659_100023719 | |||
| 800 | Ga0070667_100051069 | |||
| 801 | Ga0070667_100062597 | |||
| 802 | Ga0070709_10005957 | |||
| 803 | Ga0070709_10009752 | |||
| 804 | Ga0070709_10292755 | |||
| 805 | Ga0070714_100018322 | |||
| 806 | Ga0070714_100022127 | |||
| 807 | Ga0070714_100100065 | |||
| 808 | Ga0070713_100000644 | |||
| 809 | Ga0070713_100010845 | |||
| 810 | Ga0070713_100025732 | |||
| 811 | Ga0070713_100028119 | |||
| 812 | Ga0070713_100107080 | |||
| 813 | Ga0070710_10075547 | |||
| 814 | Ga0070701_10001338 | |||
| 815 | Ga0070711_100091702 | |||
| 816 | Ga0070711_100347243 | |||
| 817 | Ga0070705_100009893 | |||
| 818 | Ga0070705_100084690 | |||
| 819 | Ga0070705_100122437 | |||
| 820 | Ga0070700_100002973 | |||
| 821 | Ga0070708_100000017 | |||
| 822 | Ga0070708_100081484 | |||
| 823 | Ga0070708_100351505 | |||
| 824 | Ga0070662_100001369 | |||
| 825 | Ga0070662_100003796 | |||
| 826 | Ga0070662_100031467 | |||
| 827 | Ga0070662_100161464 | |||
| 828 | Ga0070681_10075128 | |||
| 829 | Ga0070681_10201521 | |||
| 830 | Ga0070681_10381144 | |||
| 831 | Ga0068867_100049818 | |||
| 832 | Ga0068867_100061905 | |||
| 833 | Ga0068867_100083187 | |||
| 834 | Ga0070685_10008046 | |||
| 835 | Ga0070706_100011641 | |||
| 836 | Ga0070706_100023800 | |||
| 837 | Ga0070706_100094274 | |||
| 838 | Ga0070706_100387088 | |||
| 839 | Ga0070707_100000423 | |||
| 840 | Ga0070707_100001659 | |||
| 841 | Ga0070707_100028523 | |||
| 842 | Ga0070707_100189540 | |||
| 843 | Ga0070707_100268261 | |||
| 844 | Ga0070707_100281795 | |||
| 845 | Ga0070698_100005376 | |||
| 846 | Ga0070699_100179205 | |||
| 847 | Ga0070699_100715738 | |||
| 848 | Ga0070679_100019988 | |||
| 849 | Ga0070679_100043999 | |||
| 850 | Ga0070679_100283711 | |||
| 851 | Ga0070679_100463909 | |||
| 852 | Ga0070679_100545343 | |||
| 853 | Ga0070684_100000189 | |||
| 854 | Ga0070684_100008507 | |||
| 855 | Ga0070684_100025423 | |||
| 856 | Ga0070684_100168777 | |||
| 857 | Ga0070684_100199609 | |||
| 858 | Ga0070697_100040456 | |||
| 859 | Ga0070697_100388051 | |||
| 860 | Ga0070672_100006852 | |||
| 861 | Ga0070672_100116410 | |||
| 862 | Ga0070686_100000084 | |||
| 863 | Ga0070686_100001150 | |||
| 864 | Ga0070686_100102271 | |||
| 865 | Ga0070695_100102571 | |||
| 866 | Ga0070695_100222609 | |||
| 867 | Ga0070693_100049850 | |||
| 868 | Ga0068855_100025404 | |||
| 869 | Ga0068855_100033409 | |||
| 870 | Ga0068855_100244652 | |||
| 871 | Ga0070664_100039798 | |||
| 872 | Ga0070664_100114907 | |||
| 873 | Ga0070664_100141229 | |||
| 874 | Ga0068857_100000218 | |||
| 875 | Ga0068857_100011133 | |||
| 876 | Ga0068857_100015248 | |||
| 877 | Ga0068857_100034632 | |||
| 878 | Ga0068854_100104386 | |||
| 879 | Ga0068856_100007078 | |||
| 880 | Ga0068856_100090475 | |||
| 881 | Ga0068856_100105701 | |||
| 882 | Ga0070702_100110745 | |||
| 883 | Ga0068859_100020526 | |||
| 884 | Ga0068859_100151775 | |||
| 885 | Ga0068859_100162979 | |||
| 886 | Ga0068864_100014517 | |||
| 887 | Ga0068866_10070649 | |||
| 888 | Ga0068861_100004794 | |||
| 889 | Ga0068861_100006018 | |||
| 890 | Ga0068861_100698749 | |||
| 891 | Ga0068870_10030117 | |||
| 892 | Ga0068870_10105378 | |||
| 893 | Ga0068863_100033711 | |||
| 894 | Ga0068858_100009561 | |||
| 895 | Ga0068860_100095097 | |||
| 896 | Ga0068860_100128421 | |||
| 897 | Ga0068860_100698707 | |||
| 898 | Ga0068862_100003693 | |||
| 899 | Ga0068862_100010149 | |||
| 900 | Ga0068862_100093053 | |||
| 901 | Ga0068862_100334123 | |||
| 902 | Ga0068862_100401610 | |||
| 903 | Ga0081538_10004934 | |||
| 904 | Ga0081538_10058411 | |||
| 905 | Ga0081539_10006724 | |||
| 906 | Ga0070717_10002194 | |||
| 907 | Ga0070717_10006759 | |||
| 908 | Ga0070717_10054225 | |||
| 909 | Ga0070717_10188747 | |||
| 910 | Ga0070712_100011781 | |||
| 911 | Ga0070712_100260264 | |||
| 912 | Ga0075367_10025988 | |||
| 913 | Ga0097621_100027954 | |||
| 914 | Ga0068871_100186364 | |||
| 915 | Ga0075428_100121338 | |||
| 916 | Ga0075431_100005824 | |||
| 917 | Ga0075431_100059879 | |||
| 918 | Ga0075431_100060424 | |||
| 919 | Ga0075431_100075773 | |||
| 920 | Ga0075431_100198546 | |||
| 921 | Ga0075431_100280113 | |||
| 922 | Ga0075433_10257777 | |||
| 923 | Ga0075433_10352332 | |||
| 924 | Ga0075434_100564178 | |||
| 925 | Ga0075429_100018221 | |||
| 926 | Ga0075429_100045416 | |||
| 927 | Ga0075429_100114920 | |||
| 928 | Ga0075429_100181422 | |||
| 929 | Ga0075429_100217311 | |||
| 930 | Ga0068865_100002531 | |||
| 931 | Ga0075436_100000008 | |||
| 932 | Ga0097620_100020525 | |||
| 933 | Ga0097620_100162972 | |||
| 934 | Ga0075435_100011176 | |||
| 935 | Ga0075435_100565414 | |||
| 936 | Ga0105240_10299268 | |||
| 937 | Ga0111539_10034067 | |||
| 938 | Ga0111539_10037944 | |||
| 939 | Ga0111539_10277950 | |||
| 940 | Ga0111539_10278763 | |||
| 941 | Ga0111539_10310152 | |||
| 942 | Ga0111539_10522275 | |||
| 943 | Ga0105245_10000992 | |||
| 944 | Ga0105245_10013041 | |||
| 945 | Ga0105245_10196402 | |||
| 946 | Ga0114129_10003771 | |||
| 947 | Ga0114129_10339861 | |||
| 948 | Ga0114129_11061829 | |||
| 949 | Ga0105243_10344884 | |||
| 950 | Ga0105241_10058808 | |||
| 951 | Ga0105241_10158174 | |||
| 952 | Ga0105242_10355554 | |||
| 953 | Ga0105248_10030735 | |||
| 954 | Ga0105248_10256521 | |||
| 955 | Ga0105248_10435225 | |||
| 956 | Ga0105237_10093925 | |||
| 957 | Ga0105238_10087373 | |||
| 958 | Ga0105249_10004305 | |||
| 959 | Ga0105249_10084088 | |||
| 960 | Ga0105249_10181183 | |||
| 961 | Ga0105249_10374951 | |||
| 962 | Ga0105239_10034069 | |||
| 963 | Ga0157371_10104266 | |||
| 964 | Ga0157370_10002998 | |||
| 965 | Ga0157369_10004434 | |||
| 966 | Ga0157374_10102074 | |||
| 967 | Ga0157378_10087918 | |||
| 968 | Ga0157378_10102726 | |||
| 969 | Ga0163162_10235506 | |||
| 970 | Ga0163162_10312581 | |||
| 971 | Ga0163162_10344924 | |||
| 972 | Ga0163162_10489675 | |||
| 973 | Ga0157372_10004438 | |||
| 974 | Ga0157372_10013512 | |||
| 975 | Ga0157372_10042341 | |||
| 976 | Ga0157372_10166661 | |||
| 977 | Ga0157372_10420877 | |||
| 978 | Ga0157375_10011814 | |||
| 979 | Ga0157375_10024029 | |||
| 980 | Ga0157375_10064145 | |||
| 981 | Ga0157375_10300631 | |||
| 982 | Ga0163163_10399910 | |||
| 983 | Ga0157380_10004685 | |||
| 984 | Ga0157380_10072086 | |||
| 985 | Ga0157380_10284018 | |||
| 986 | Ga0157380_10473288 | |||
| 987 | Ga0157376_10017643 | |||
| 988 | Ga0206349_1021214 | |||
| 989 | Ga0206351_10214976 | |||
| 990 | Ga0213874_10038735 | |||
| 991 | Ga0213876_10000422 | |||
| 992 | Ga0213875_10043471 | |||
| 993 | Ga0224712_10003705 | |||
| 994 | Ga0224712_10017120 | |||
| 995 | Ga0207666_1006577 | |||
| 996 | Ga0207697_10166163 | |||
| 997 | Ga0207692_10108241 | |||
| 998 | Ga0207642_10029077 | |||
| 999 | Ga0207680_10253945 | |||
| 1000 | Ga0207647_10120299 | |||
| 1001 | Ga0207699_10002389 | |||
| 1002 | Ga0207699_10029634 | |||
| 1003 | Ga0207645_10004858 | |||
| 1004 | Ga0207643_10093499 | |||
| 1005 | Ga0207684_10004086 | |||
| 1006 | Ga0207684_10006772 | |||
| 1007 | Ga0207684_10028825 | |||
| 1008 | Ga0207684_10177950 | |||
| 1009 | Ga0207707_10008698 | |||
| 1010 | Ga0207707_10010052 | |||
| 1011 | Ga0207707_10123864 | |||
| 1012 | Ga0207707_10295321 | |||
| 1013 | Ga0207695_10005313 | |||
| 1014 | Ga0207693_10015487 | |||
| 1015 | Ga0207660_10021678 | |||
| 1016 | Ga0207662_10007422 | |||
| 1017 | Ga0207662_10024684 | |||
| 1018 | Ga0207657_10071102 | |||
| 1019 | Ga0207652_10022504 | |||
| 1020 | Ga0207652_10038989 | |||
| 1021 | Ga0207652_10073005 | |||
| 1022 | Ga0207652_10224120 | |||
| 1023 | Ga0207652_10491624 | |||
| 1024 | Ga0207646_10000759 | |||
| 1025 | Ga0207646_10021798 | |||
| 1026 | Ga0207646_10128685 | |||
| 1027 | Ga0207681_10005309 | |||
| 1028 | Ga0207681_10034967 | |||
| 1029 | Ga0207694_10068221 | |||
| 1030 | Ga0207650_10014997 | |||
| 1031 | Ga0207659_10015233 | |||
| 1032 | Ga0207687_10003713 | |||
| 1033 | Ga0207687_10005579 | |||
| 1034 | Ga0207700_10005353 | |||
| 1035 | Ga0207700_10011557 | |||
| 1036 | Ga0207700_10017851 | |||
| 1037 | Ga0207700_10069468 | |||
| 1038 | Ga0207700_10089194 | |||
| 1039 | Ga0207700_10116617 | |||
| 1040 | Ga0207700_10178804 | |||
| 1041 | Ga0207664_10014420 | |||
| 1042 | Ga0207664_10128168 | |||
| 1043 | Ga0207690_10000668 | |||
| 1044 | Ga0207690_10010808 | |||
| 1045 | Ga0207706_10013624 | |||
| 1046 | Ga0207706_10039015 | |||
| 1047 | Ga0207706_10093627 | |||
| 1048 | Ga0207709_10637680 | |||
| 1049 | Ga0207670_10003568 | |||
| 1050 | Ga0207670_10151340 | |||
| 1051 | Ga0207669_10000882 | |||
| 1052 | Ga0207669_10164729 | |||
| 1053 | Ga0207704_10002528 | |||
| 1054 | Ga0207691_10003103 | |||
| 1055 | Ga0207711_10164990 | |||
| 1056 | Ga0207689_10011603 | |||
| 1057 | Ga0207689_10147892 | |||
| 1058 | Ga0207661_10005786 | |||
| 1059 | Ga0207661_10023436 | |||
| 1060 | Ga0207661_10050549 | |||
| 1061 | Ga0207661_10106323 | |||
| 1062 | Ga0207679_10013719 | |||
| 1063 | Ga0207679_10051245 | |||
| 1064 | Ga0207667_10023459 | |||
| 1065 | Ga0207651_10047297 | |||
| 1066 | Ga0207712_10058827 | |||
| 1067 | Ga0207712_10151853 | |||
| 1068 | Ga0207668_10015516 | |||
| 1069 | Ga0207668_10203942 | |||
| 1070 | Ga0207658_10010275 | |||
| 1071 | Ga0207677_10080500 | |||
| 1072 | Ga0207703_10030733 | |||
| 1073 | Ga0207708_10001712 | |||
| 1074 | Ga0207708_10094193 | |||
| 1075 | Ga0207708_10095028 | |||
| 1076 | Ga0207702_10002092 | |||
| 1077 | Ga0207702_10002412 | |||
| 1078 | Ga0207702_10171962 | |||
| 1079 | Ga0207702_10302182 | |||
| 1080 | Ga0207641_10027946 | |||
| 1081 | Ga0207641_10899119 | |||
| 1082 | Ga0207648_10018221 | |||
| 1083 | Ga0207648_10027889 | |||
| 1084 | Ga0207676_10003054 | |||
| 1085 | Ga0207676_10420612 | |||
| 1086 | Ga0207674_10000120 | |||
| 1087 | Ga0207674_10000366 | |||
| 1088 | Ga0207674_10006207 | |||
| 1089 | Ga0207674_10089473 | |||
| 1090 | Ga0207675_100002168 | |||
| 1091 | Ga0207675_100012609 | |||
| 1092 | Ga0207675_100192701 | |||
| 1093 | Ga0207675_100337858 | |||
| 1094 | Ga0207428_10075243 | |||
| 1095 | Ga0268265_10003865 | |||
| 1096 | Ga0268265_10094969 | |||
| 1097 | Ga0268265_10167452 | |||
| 1098 | Ga0268265_10841856 | |||
| 1099 | Ga0268264_10075298 | |||
| 1100 | Ga0268264_10150506 | |||
| 1101 | Ga0268264_10560515 | |||
| 1102 | Ga0265334_10048236 | |||
| 1103 | Ga0265318_10000178 | |||
| 1104 | Ga0265318_10018767 | |||
| 1105 | Ga0265323_10004508 | |||
| 1106 | Ga0265323_10013823 | |||
| 1107 | Ga0265323_10041946 | |||
| 1108 | Ga0265336_10023827 | |||
| 1109 | Ga0265338_10005521 | |||
| 1110 | Ga0265338_10056870 | |||
| 1111 | Ga0265330_10000164 | |||
| 1112 | Ga0265330_10000645 | |||
| 1113 | Ga0265330_10000982 | |||
| 1114 | Ga0265330_10001395 | |||
| 1115 | Ga0265330_10007773 | |||
| 1116 | Ga0265330_10024432 | |||
| 1117 | Ga0265332_10000226 | |||
| 1118 | Ga0265332_10017126 | |||
| 1119 | Ga0265332_10022056 | |||
| 1120 | Ga0265328_10000594 | |||
| 1121 | Ga0265320_10000158 | |||
| 1122 | Ga0265320_10003882 | |||
| 1123 | Ga0265320_10005336 | |||
| 1124 | Ga0265325_10000338 | |||
| 1125 | Ga0265329_10000550 | |||
| 1126 | Ga0265329_10000905 | |||
| 1127 | Ga0265329_10002438 | |||
| 1128 | Ga0265329_10044046 | |||
| 1129 | Ga0265340_10009098 | |||
| 1130 | Ga0265340_10026018 | |||
| 1131 | Ga0265339_10012831 | |||
| 1132 | Ga0265339_10029579 | |||
| 1133 | Ga0265339_10044607 | |||
| 1134 | Ga0265339_10127295 | |||
| 1135 | Ga0265331_10000283 | |||
| 1136 | Ga0265316_10000530 | |||
| 1137 | Ga0265316_10000837 | |||
| 1138 | Ga0265316_10000918 | |||
| 1139 | Ga0265316_10000968 | |||
| 1140 | Ga0265316_10001094 | |||
| 1141 | Ga0265316_10001828 | |||
| 1142 | Ga0265316_10003413 | |||
| 1143 | Ga0265316_10008905 | |||
| 1144 | Ga0265316_10011363 | |||
| 1145 | Ga0265316_10014446 | |||
| 1146 | Ga0265316_10041565 | |||
| 1147 | Ga0265316_10137200 | |||
| 1148 | Ga0265316_10474058 | |||
| 1149 | Ga0307408_100048383 | |||
| 1150 | Ga0307408_100141051 | |||
| 1151 | Ga0265313_10000434 | |||
| 1152 | Ga0265313_10000516 | |||
| 1153 | Ga0265313_10003119 | |||
| 1154 | Ga0265313_10069335 | |||
| 1155 | Ga0316575_10002464 | |||
| 1156 | Ga0316579_10064493 | |||
| 1157 | Ga0316579_10115633 | |||
| 1158 | Ga0265314_10000427 | |||
| 1159 | Ga0265314_10003291 | |||
| 1160 | Ga0265314_10004747 | |||
| 1161 | Ga0265314_10013708 | |||
| 1162 | Ga0265314_10028744 | |||
| 1163 | Ga0265314_10203891 | |||
| 1164 | Ga0265342_10000091 | |||
| 1165 | Ga0265342_10000236 | |||
| 1166 | Ga0265342_10000495 | |||
| 1167 | Ga0265342_10001020 | |||
| 1168 | Ga0265342_10002502 | |||
| 1169 | Ga0265342_10004150 | |||
| 1170 | Ga0265342_10004929 | |||
| 1171 | Ga0265342_10069145 | |||
| 1172 | Ga0265342_10101930 | |||
| 1173 | Ga0316576_10007551 | |||
| 1174 | Ga0316576_10007959 | |||
| 1175 | Ga0316576_10067782 | |||
| 1176 | Ga0316576_10233435 | |||
| 1177 | Ga0316578_10012016 | |||
| 1178 | Ga0316578_10064514 | |||
| 1179 | Ga0316578_10093335 | |||
| 1180 | Ga0316578_10174165 | |||
| 1181 | Ga0316577_10010055 | |||
| 1182 | Ga0316577_10013010 | |||
| 1183 | Ga0316577_10015694 | |||
| 1184 | Ga0316577_10018126 | |||
| 1185 | Ga0316577_10027251 | |||
| 1186 | Ga0316577_10035035 | |||
| 1187 | Ga0316577_10038636 | |||
| 1188 | Ga0316577_10061014 | |||
| 1189 | Ga0316577_10076812 | |||
| 1190 | Ga0316577_10084872 | |||
| 1191 | Ga0316577_10168613 | |||
| 1192 | Ga0316577_10204286 | |||
| 1193 | Ga0316577_10205991 | |||
| 1194 | Ga0307413_10113642 | |||
| 1195 | Ga0307410_10182846 | |||
| 1196 | Ga0307407_10025229 | |||
| 1197 | Ga0307407_10178993 | |||
| 1198 | Ga0307412_10062051 | |||
| 1199 | Ga0307409_100551314 | |||
| 1200 | Ga0307416_100043038 | |||
| 1201 | Ga0307411_10063582 | |||
| 1202 | Ga0307415_100187466 | |||
| 1203 | Ga0307415_100304119 | |||
| 1204 | Ga0316580_10044971 | |||
| 1205 | Ga0373926_0009943 | |||
| 1206 | Ga0373926_0047916 | |||
| 1207 | Ga0373934_0005155 | |||
| 1208 | Ga0373934_0010621 | |||
| 1209 | Ga0373944_0009883 | |||
| 1210 | Ga0373923_0003831 | |||
| 1211 | Ga0373945_0001777 | |||
| 1212 | Ga0373945_0079117 | |||
| 1213 | Ga0373953_0091555 | |||
| 1214 | Ga0373953_0100575 | |||
| 1215 | Ga0373953_0169520 | |||
| 1216 | Ga0373954_0008997 | |||
| 1217 | Ga0373954_0040372 | |||
| 1218 | Ga0373954_0061910 | |||
| 1219 | Ga0373954_0068112 | |||
| 1220 | Ga0373956_0001279 | |||
| 1221 | Ga0373956_0077885 | |||
| 1222 | Ga0373957_0024042 | |||
| 1223 | Ga0373957_0031047 | |||
| 1224 | Ga0373957_0042289 | |||
| 1225 | Ga0373957_0056881 | |||
| 1226 | Ga0373943_0041765 | |||
| 1227 | Ga0373946_0028653 | |||
| 1228 | Ga0373955_0003339 | |||
| 1229 | Ga0373955_0005225 | |||
| 1230 | Ga0316574_0005803 | |||
| 1231 | Ga0316574_0036074 | |||
| 1232 | Ga0316574_0058020 | |||
| 1233 | Ga0316574_0350007 | |||
| 1234 | Ga0373924_0002966 | |||
| 1235 | Ga0373931_0080503 | |||
| 1236 | Ga0373935_0140391 | |||
| 1237 | Ga0373927_0004165 | |||
| 1238 | Ga0373927_0021679 | |||
| 1239 | Ga0373933_0000071 | |||
| 1240 | Ga0373933_0002827 | |||
| 1241 | Ga0373933_0006888 | |||
| 1242 | Ga0373933_0026940 | |||
| 1243 | Ga0373933_0145970 | |||
| 1244 | Ga0373947_0000536 | |||
| 1245 | Ga0373947_0003376 | |||
| 1246 | Ga0373937_0000141 | |||
| 1247 | Ga0373937_0001599 | |||
| 1248 | Ga0373937_0010952 | |||
| 1249 | Ga0373937_0055944 | |||
| 1250 | Ga0373937_0199663 | |||
| 1251 | Ga0373937_0237430 | |||
| 1252 | Ga0316582_0001573 | |||
| 1253 | Ga0316582_0001967 | |||
| 1254 | Ga0316582_0002907 | |||
| 1255 | Ga0316582_0012828 | |||
| 1256 | Ga0316582_0015539 | |||
| 1257 | Ga0316582_0033750 | |||
| 1258 | Ga0316582_0084932 | |||
| 1259 | Ga0316582_0086300 | |||
| 1260 | Ga0316582_0108532 | |||
| 1261 | Ga0316582_0117457 | |||
| 1262 | Ga0316582_0196503 | |||
| 1263 | Ga0316582_0234567 | |||
| 1264 | Ga0316582_0248734 | |||
| 1265 | Ga0316582_0379225 | |||
| 1266 | Ga0316584_0000161 | |||
| 1267 | Ga0316584_0004045 | |||
| 1268 | Ga0316584_0006407 | |||
| 1269 | Ga0316584_0011111 | |||
| 1270 | Ga0316584_0021002 | |||
| 1271 | Ga0316584_0035682 | |||
| 1272 | Ga0316584_0042074 | |||
| 1273 | Ga0316584_0053946 | |||
| 1274 | Ga0316584_0107666 | |||
| 1275 | Ga0316584_0108799 | |||
| 1276 | Ga0316584_0141617 | |||
| 1277 | Ga0316584_0161945 | |||
| 1278 | Ga0316584_0509316 | |||
| 1279 | Ga0373925_0009561 | |||
| 1280 | Ga0373925_0656219 | |||
| 1281 | Ga0395900_0288242 | |||
| 1282 | Ga0395905_0005426 | |||
| 1283 | Ga0395905_0532611 | |||
| 1284 | Ga0316581_0000595 | |||
| 1285 | Ga0316581_0003022 | |||
| 1286 | Ga0316581_0003775 | |||
| 1287 | Ga0316581_0004957 | |||
| 1288 | Ga0316581_0046255 | |||
| 1289 | Ga0316581_0048409 | |||
| 1290 | Ga0436364_0198679 | |||
| 1291 | Ga0395901_0006659 | |||
| 1292 | Ga0395901_0042233 | |||
| 1293 | Ga0237819_07077 | |||
| 1294 | Ga0400483_061585 | |||
| 1295 | Ga0400483_148375 | |||
| 1296 | Ga0400489_11819 | |||
| 1297 | Ga0400489_15711 | |||
| 1298 | Ga0400489_25754 | |||
| 1299 | Ga0400489_25858 | |||
| 1300 | Ga0400489_65167 | |||
| 1301 | Ga0400489_79360 | |||
| 1302 | Ga0400487_17497 | |||
| 1303 | Ga0436365_0301490 | |||
| 1304 | Ga0436365_0637502 | |||
| 1305 | Ga0436365_0873465 | |||
| 1306 | Ga0436363_0280714 | |||
| 1307 | Ga0451577_0000197 | |||
| 1308 | Ga0451577_0017683 | |||
| 1309 | Ga0451577_0032219 | |||
| 1310 | Ga0451577_0078601 | |||
| 1311 | Ga0451577_0099754 | |||
| 1312 | Ga0451577_0130933 | |||
| 1313 | Ga0451577_0152294 | |||
| 1314 | Ga0451577_0421566 | |||
| 1315 | Ga0451577_0496472 | |||
| 1316 | Ga0466969_0016606 | |||
| 1317 | Ga0453683_0000169 | |||
| 1318 | Ga0453683_0018122 | |||
| 1319 | Ga0453683_0060567 | |||
| 1320 | Ga0453683_0159473 | |||
| 1321 | Ga0466966_0010205 | |||
| 1322 | Ga0466961_0041464 | |||
| 1323 | Ga0466963_0217592 | |||
| 1324 | Ga0453684_0000393 | |||
| 1325 | Ga0453684_0000476 | |||
| 1326 | Ga0453684_0002622 | |||
| 1327 | Ga0453684_0004500 | |||
| 1328 | Ga0453684_0006175 | |||
| 1329 | Ga0453684_0006191 | |||
| 1330 | Ga0453684_0014058 | |||
| 1331 | Ga0453684_0021256 | |||
| 1332 | Ga0453684_0027265 | |||
| 1333 | Ga0453684_0044560 | |||
| 1334 | Ga0453684_0059927 | |||
| 1335 | Ga0453684_0099289 | |||
| 1336 | Ga0453684_0203964 | |||
| 1337 | Ga0453684_0291254 | |||
| 1338 | Ga0453684_0644187 | |||
| 1339 | Ga0453684_0653455 | |||
| 1340 | Ga0466971_0110696 | |||
| 1341 | Ga0466957_0030389 | |||
| 1342 | Ga0451576_0000145 | |||
| 1343 | Ga0451576_0001182 | |||
| 1344 | Ga0451576_0013401 | |||
| 1345 | Ga0451576_0130784 | |||
| 1346 | Ga0451576_0245881 | |||
| 1347 | Ga0451576_0275935 | |||
| 1348 | Ga0451576_0435570 | |||
| 1349 | Ga0451576_0794360 | |||
| 1350 | Ga0466967_0001023 | |||
| 1351 | Ga0466967_0015155 | |||
| 1352 | Ga0466967_0055352 | |||
| 1353 | Ga0495592_0016891 | |||
| 1354 | Ga0495592_0097606 | |||
| 1355 | Ga0495603_0004951 | |||
| 1356 | Ga0495629_0022693 | |||
| 1357 | Ga0495629_0025318 | |||
| 1358 | Ga0495651_0000069 | |||
| 1359 | Ga0495651_0031688 | |||
| 1360 | Ga0495653_0000117 | |||
| 1361 | Ga0495653_0152105 | |||
| 1362 | Ga0495580_0135068 | |||
| 1363 | Ga0495582_0035148 | |||
| 1364 | Ga0495639_0001030 | |||
| 1365 | Ga0495639_0048900 | |||
| 1366 | Ga0495662_0195821 | |||
| 1367 | Ga0495664_0070386 | |||
| 1368 | Ga0495594_0003012 | |||
| 1369 | Ga0495594_0027621 | |||
| 1370 | Ga0495608_0000103 | |||
| 1371 | Ga0495628_0000082 | |||
| 1372 | Ga0495628_0051656 | |||
| 1373 | Ga0495630_0000666 | |||
| 1374 | Ga0495630_0001791 | |||
| 1375 | Ga0495643_0000173 | |||
| 1376 | Ga0495643_0085957 | |||
| 1377 | Ga0495652_0001484 | |||
| 1378 | Ga0495652_0363922 | |||
| 1379 | Ga0495665_0001803 | |||
| 1380 | Ga0495665_0231779 | |||
| 1381 | Ga0495640_0079520 | |||
| 1382 | Ga0495640_0205076 | |||
| 1383 | Ga0495586_0048222 | |||
| 1384 | Ga0495587_0000147 | |||
| 1385 | Ga0495587_0000298 | |||
| 1386 | Ga0495645_0000061 | |||
| 1387 | Ga0495645_0001109 | |||
| 1388 | Ga0495622_0133847 | |||
| 1389 | Ga0495667_0000269 | |||
| 1390 | Ga0495667_0014755 | |||
| 1391 | Ga0495635_0000071 | |||
| 1392 | Ga0495659_0055110 | |||
| 1393 | Ga0495588_0033049 | |||
| 1394 | Ga0495588_0038331 | |||
| 1395 | Ga0495588_0040339 | |||
| 1396 | Ga0495657_0000366 | |||
| 1397 | Ga0495657_0167592 | |||
| 1398 | Ga0495657_0204942 | |||
| 1399 | Ga0495599_0000859 | |||
| 1400 | Ga0495599_0002136 | |||
| 1401 | Ga0495623_0000193 | |||
| 1402 | Ga0495623_0002351 | |||
| 1403 | Ga0495646_0007102 | |||
| 1404 | Ga0495658_0000148 | |||
| 1405 | Ga0495613_0023440 | |||
| 1406 | Ga0495613_0074533 | |||
| 1407 | Ga0495613_0156658 | |||
| 1408 | Ga0495613_0400515 | |||
| 1409 | Ga0495613_0421768 | |||
| 1410 | Ga0495600_0000133 | |||
| 1411 | Ga0495600_0017358 | |||
| 1412 | Ga0495581_0001652 | |||
| 1413 | Ga0495581_0016039 | |||
| 1414 | Ga0495604_0000028 | |||
| 1415 | Ga0495604_0216741 | |||
| 1416 | Ga0495674_0001137 | |||
| 1417 | Ga0495674_0011474 | |||
| 1418 | Ga0495674_0084975 | |||
| 1419 | Ga0495674_0149657 | |||
| 1420 | Ga0495674_0396217 | |||
| 1421 | Ga0495680_0019973 | |||
| 1422 | Ga0495680_0157174 | |||
| 1423 | Ga0495675_0001753 | |||
| 1424 | Ga0495675_0003478 | |||
| 1425 | Ga0495675_0160652 | |||
| 1426 | Ga0495684_0000044 | |||
| 1427 | Ga0495684_0011174 | |||
| 1428 | Ga0495684_0280920 | |||
| 1429 | Ga0495593_0000211 | |||
| 1430 | Ga0495602_0000414 | |||
| 1431 | Ga0495614_0000092 | |||
| 1432 | Ga0496101_0383372 | |||
| 1433 | Ga0496104_0027959 | |||
| 1434 | Ga0496104_0120774 | |||
| 1435 | Ga0496104_0146474 | |||
| 1436 | Ga0496109_0203162 | |||
| 1437 | Ga0496112_0000747 | |||
| 1438 | Ga0496112_0105623 | |||
| 1439 | Ga0496113_0066915 | |||
| 1440 | Ga0496113_0167168 | |||
| 1441 | Ga0496114_0004489 | |||
| 1442 | Ga0496114_0029255 | |||
| 1443 | Ga0501291_027508 | |||
| 1444 | Ga0501300_001855 | |||
| 1445 | Ga0501033_0007612 | |||
| 1446 | Ga0501034_0074375 | |||
| 1447 | Ga0501034_0085121 | |||
| 1448 | Ga0501036_0221377 | |||
| 1449 | Ga0501037_0046411 | |||
| 1450 | Ga0501039_0139866 | |||
| 1451 | Ga0501043_0015605 | |||
| 1452 | Ga0501047_0046690 | |||
| 1453 | Ga0501047_0060492 | |||
| 1454 | Ga0501070_0168510 | |||
| 1455 | Ga0501073_0010701 | |||
| 1456 | Ga0501198_011727 | |||
| 1457 | Ga0501207_007528 | |||
| 1458 | Ga0501217_003247 | |||
| 1459 | Ga0501223_002407 | |||
| 1460 | Ga0501236_000948 | |||
| 1461 | Ga0501247_003384 | |||
| 1462 | Ga0501035_0000350 | |||
| 1463 | Ga0501035_0322267 | |||
| 1464 | Ga0501044_0002550 | |||
| 1465 | Ga0501044_0141704 | |||
| 1466 | nmdc:mga05p37_17980_c1 | |||
| 1467 | nmdc:mga05p37_278740_c1 | |||
| 1468 | nmdc:mga09592_111741_c1 | |||
| 1469 | nmdc:mga09592_114514_c1 | |||
| 1470 | nmdc:mga09592_4560_c1 | |||
| 1471 | nmdc:mga09592_487762_c1 | |||
| 1472 | nmdc:mga09592_62178_c1 | |||
| 1473 | nmdc:mga0qj67_80637_c1 | |||
| 1474 | nmdc:mga06r32_218316_c1 | |||
| 1475 | nmdc:mga06r32_24579_c1 | |||
| 1476 | nmdc:mga06r32_330694_c1 | |||
| 1477 | nmdc:mga06r32_70754_c1 | |||
| 1478 | nmdc:mga08y16_15747_c1 | |||
| 1479 | nmdc:mga08y16_24197_c1 | |||
| 1480 | nmdc:mga08y16_35168_c1 | |||
| 1481 | nmdc:mga08y16_534244_c1 | |||
| 1482 | nmdc:mga08y16_72264_c1 | |||
| 1483 | nmdc:mga0rr50_171825_c1 | |||
| 1484 | nmdc:mga0rr50_418636_c1 | |||
| 1485 | nmdc:mga0rr50_7858_c1 | |||
| 1486 | nmdc:mga08x19_16_c1 | |||
| 1487 | nmdc:mga0a205_155306_c1 | |||
| 1488 | Ga0495601_0002281 | |||
| 1489 | Ga0495601_0018513 | |||
| 1490 | Ga0495612_0005137 | |||
| 1491 | Ga0495612_0045946 | |||
| 1492 | Ga0495595_0137216 | |||
| 1493 | Ga0495619_0005505 | |||
| 1494 | Ga0495619_0117199 | |||
| 1495 | Ga0500645_038186 | |||
| 1496 | Ga0501084_0012175 | |||
| 1497 | Ga0501084_0061704 | |||
| 1498 | Ga0590071_003932 | |||
| 1499 | Ga0590075_001339 | |||
| 1500 | Ga0501082_0151461 | |||
| 1501 | Ga0501082_0306759 | |||
| 1502 | 2617916016 | |||
| 1503 | 2739244792 | |||
| 1504 | 2831428391 | |||
| 1505 | 2848697274 | |||
| 1506 | 2849668275 | |||
| 1507 | 2886632920 | |||
| 1508 | 2913849126 | |||
| 1509 | 2913919487 | |||
| 1510 | 2913944107 | |||
| 1511 | 2977235548 | |||
| 1512 | 642604269 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iuy-assembly2.cif.gz_G | crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c | 0.9538 | 9 | 275 |
| 7djs-assembly1.cif.gz_C | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9505 | 15 | 274 |
| 6ixm-assembly1.cif.gz_B | crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad | 0.9461 | 12 | 274 |
| 4iuy-assembly2.cif.gz_G | crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c | 0.9428 | 9 | 275 |
| 3sj7-assembly1.cif.gz_A-2 | structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph | 0.9409 | 15 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9461 | 12 | 274 | 3.40.50.720 |
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9425 | 10 | 274 | 3.40.50.720 |
| 4iboB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9396 | 9 | 274 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.939 | 10 | 274 | 3.40.50.720 |
| 4weoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9365 | 11 | 272 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9Q6U3-F1-model_v4 | deleted | 0.9939 | 74 | 278 |
|
| AF-A0A7C5NXC8-F1-model_v4 | SDR family oxidoreductase | 0.991 | 126 | 278 |
GO:0016616
|
| AF-A0A535GZA2-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9885 | 86 | 210 |
GO:0005829
GO:0016491 |
| AF-A0A800BV48-F1-model_v4 | SDR family oxidoreductase | 0.9852 | 4 | 278 |
GO:0016616
GO:0030497 |
| AF-A0A7X9Q6U3-F1-model_v4 | deleted | 0.9844 | 74 | 278 |
|