F479322

General Info

Members Datasets Scaffolds Average Seq Length
755 530 521 241

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2574179768|2574430754
Length 262
Sequence SMPEASQPTFATVSDVLTPKPAGPGTVHGVGLGPGAADLLSVRADRLVRGARHVAYFRKAGRAGRARRIVDGMLREDVIEFAMEYPVTTEIALDDPRYNQQLSAFYASCIEHLHAITARGEDVVVLCEGDPFFYGSFMHLYSRLQGLVPVCVVPGITGMSGAWTVSGAPITWGDDTLTVLMATSSEEVLTRRIRDTDALVVMKVGRNLPKLRRAVAAAGREHEAWLVEYATMAEERVTRLVDVDKVTPYFSILLIHGQGRRP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
23 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
24 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
29 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
30 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
31 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
32 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
35 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
36 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
40 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
41 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
42 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
43 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
44 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
45 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
46 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
47 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
48 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
49 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
50 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
51 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
52 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
53 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
54 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
55 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
56 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
57 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
58 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
59 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
60 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
61 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
62 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
63 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
64 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
65 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
66 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
67 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
68 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
69 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
70 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
71 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
72 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
73 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
74 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
75 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
76 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
77 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
78 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
79 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
80 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
81 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
82 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
83 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
84 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
85 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
86 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
90 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
91 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
92 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
93 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
94 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
95 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
96 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
97 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
100 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
101 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
102 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
103 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
104 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
105 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
106 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
107 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
108 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
109 2906610324
110 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
111 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
112 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
113 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
114 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
115 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
116 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
117 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
118 2922368715
119 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
120 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
121 2922425934
122 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
123 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
124 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
125 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
126 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
127 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
128 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
129 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
130 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
131 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
132 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
133 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
134 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
135 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
136 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
137 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
138 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
139 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
140 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
141 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
142 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
143 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
144 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
145 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
146 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
147 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
148 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
149 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
150 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
151 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
152 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
153 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
154 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
155 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
156 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
157 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
158 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
159 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
160 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
161 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
162 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
163 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
164 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
165 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
166 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
167 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
168 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
169 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
170 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
171 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
172 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
173 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
174 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
175 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
176 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
177 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
178 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
179 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
180 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
181 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
182 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
183 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
184 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
185 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
186 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
187 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
188 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
189 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
190 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
191 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
192 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
193 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
194 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
195 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
196 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
197 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
198 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
199 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
200 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
201 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
202 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
203 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
204 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
205 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
206 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
207 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
208 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
209 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
210 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
211 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
212 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
213 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
214 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
215 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
216 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
217 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
218 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
219 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
220 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
221 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
222 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
223 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
224 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
225 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
226 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
227 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
228 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
229 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
230 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
231 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
232 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
233 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
234 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
235 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
236 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
237 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
238 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
239 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
240 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
241 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
242 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
243 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
245 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
246 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
247 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
248 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
249 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
250 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
251 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
252 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
253 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
254 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
259 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
260 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
261 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
262 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
263 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
264 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
265 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
266 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
267 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
268 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
269 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
270 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
271 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
272 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
274 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
280 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
283 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
316 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
317 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
318 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
319 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
321 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
325 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
326 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
327 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
328 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
329 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
330 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
331 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
332 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
333 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
334 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
340 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
341 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
342 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
343 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
344 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
345 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
346 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
347 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
348 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
349 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
350 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
353 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
354 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
355 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
356 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
357 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
358 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
359 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
360 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
365 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
366 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
367 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
368 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
369 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
372 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
378 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
379 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
380 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
381 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
382 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
383 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
384 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
385 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
386 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
387 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
388 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
389 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
392 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
393 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
394 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
395 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
396 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
397 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
398 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
404 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
405 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
406 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
407 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
408 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
409 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
410 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
411 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
412 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
413 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
414 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
415 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
416 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
417 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
418 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
419 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
420 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
421 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
422 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
423 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
424 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
425 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
431 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
432 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
433 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
434 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
435 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
436 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
439 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
440 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
441 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
442 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
443 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
444 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
445 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
446 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
447 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
448 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
449 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
450 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
451 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
452 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
453 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
454 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
455 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
456 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
457 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
460 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
461 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
462 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
463 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
464 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
465 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
466 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
467 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
468 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
469 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
470 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
471 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
472 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
473 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
474 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
475 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
476 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
477 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
478 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
479 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
480 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
481 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
482 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
483 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
484 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
485 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
486 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
487 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
488 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
489 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
490 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
491 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
492 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
493 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
496 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
497 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
498 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
499 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
500 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
501 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
502 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
503 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
504 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
505 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
506 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
507 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
508 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
509 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
510 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
511 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
512 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
513 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
514 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
515 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
516 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
517 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
518 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
519 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
520 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
521 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
522 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
523 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
524 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
525 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
526 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
527 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
528 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
529 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
530 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.15
Metatranscriptomes 0.13
Isolates 30.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 16.16
Nodule 21.72
Rhizoplane 4.64
Rhizosphere 38.94
Stem 0
Stem Tuber 0
Unclassified 17.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_891765 2162886007 Bacteria 4489
2 JGI25153J46596_10000775 3300003215 Bacteria 19594
3 JGI25153J46596_10001683 3300003215 Bacteria 13112
4 JGI25153J46596_10015897 3300003215 Bacteria 3041
5 JGI25160J50197_1000991 3300003354 Bacteria 14757
6 JGI25160J50197_1008973 3300003354 Bacteria 3754
7 JGI25160J50197_1029732 3300003354 Bacteria 1438
8 Ga0055530_10024967 3300003791 Bacteria 1680
9 Ga0055531_10007448 3300003794 Bacteria 5972
10 Ga0065165_1000420 3300005262 Bacteria 66966
11 Ga0065165_1000556 3300005262 Bacteria 55512
12 Ga0065165_1002861 3300005262 Bacteria 13344
13 Ga0065165_1018469 3300005262 Bacteria 2522
14 Ga0065704_10073969 3300005289 Bacteria 6631
15 Ga0065707_10182958 3300005295 Bacteria 1406
16 Ga0070658_10129261 3300005327 Bacteria 2104
17 Ga0070658_10291834 3300005327 Bacteria 1390
18 Ga0070670_100043222 3300005331 Bacteria 3873
19 Ga0070670_100158239 3300005331 Bacteria 1963
20 Ga0070666_10232277 3300005335 Bacteria 1303
21 Ga0070668_100000159 3300005347 Bacteria 42625
22 Ga0070668_100012970 3300005347 Bacteria 6205
23 Ga0070668_100042914 3300005347 Bacteria 3466
24 Ga0070668_100060893 3300005347 Bacteria 2924
25 Ga0070669_100000502 3300005353 Bacteria 29455
26 Ga0070669_100008694 3300005353 Bacteria 7243
27 Ga0070669_100047738 3300005353 Bacteria 3124
28 Ga0070675_100421684 3300005354 Bacteria 1193
29 Ga0070671_100002918 3300005355 Bacteria 13293
30 Ga0070671_100039396 3300005355 Bacteria 3922
31 Ga0070671_100072841 3300005355 Bacteria 2869
32 Ga0070667_100000120 3300005367 Bacteria 99936
33 Ga0070667_100113842 3300005367 Bacteria 2348
34 Ga0070667_100333724 3300005367 Bacteria 1370
35 Ga0070685_10413856 3300005466 Bacteria 936
36 Ga0070706_100111923 3300005467 Bacteria 2541
37 Ga0070698_100129760 3300005471 Bacteria 2477
38 Ga0070679_100061959 3300005530 Bacteria 3728
39 Ga0070697_100259244 3300005536 Bacteria 1488
40 Ga0068853_100001299 3300005539 Bacteria 17940
41 Ga0068853_100231198 3300005539 Bacteria 1692
42 Ga0070686_100195545 3300005544 Bacteria 1446
43 Ga0070665_100018399 3300005548 Bacteria 7002
44 Ga0068854_100155996 3300005578 Bacteria 1764
45 Ga0068856_100442332 3300005614 Bacteria 1320
46 Ga0068856_100486051 3300005614 Bacteria 1256
47 Ga0068859_100788986 3300005617 Bacteria 1038
48 Ga0068863_100000053 3300005841 Bacteria 125195
49 Ga0068863_100042120 3300005841 Bacteria 4339
50 Ga0068863_100516929 3300005841 Bacteria 1177
51 Ga0068860_100013340 3300005843 Bacteria 8057
52 Ga0068860_100081169 3300005843 Bacteria 3084
53 Ga0068862_100000778 3300005844 Bacteria 31642
54 Ga0068862_100084813 3300005844 Bacteria 2752
55 Ga0081540_1052167 3300005983 Bacteria 2016
56 Ga0075365_10085543 3300006038 Bacteria 2142
57 Ga0075365_10182055 3300006038 Bacteria 1469
58 Ga0075368_10000747 3300006042 Bacteria 9970
59 Ga0075363_100019180 3300006048 Bacteria 3416
60 Ga0075364_10014814 3300006051 Bacteria 4824
61 Ga0075364_10049523 3300006051 Bacteria 2741
62 Ga0075362_10034352 3300006177 Bacteria 2210
63 Ga0075367_10001262 3300006178 Bacteria 10667
64 Ga0075367_10144121 3300006178 Bacteria 1476
65 Ga0075369_10027581 3300006186 Bacteria 2375
66 Ga0075369_10104048 3300006186 Bacteria 1275
67 Ga0075366_10004909 3300006195 Bacteria 7216
68 Ga0075366_10005300 3300006195 Bacteria 6984
69 Ga0075370_10001829 3300006353 Bacteria 9519
70 Ga0075370_10119996 3300006353 Bacteria 1530
71 Ga0068871_100395503 3300006358 Bacteria 1230
72 Ga0075436_100496761 3300006914 Bacteria 892
73 Ga0097620_100789063 3300006931 Bacteria 1038
74 Ga0099825_1042350 3300006941 Bacteria 1264
75 Ga0099824_1005450 3300006942 Bacteria 17919
76 Ga0079104_1003511 3300006946 Bacteria 7236
77 Ga0099795_10002064 3300007788 Bacteria 4610
78 Ga0105251_10098742 3300009011 Bacteria 1336
79 Ga0105250_10013981 3300009092 Bacteria 3305
80 Ga0105240_10208799 3300009093 Bacteria 2283
81 Ga0105240_10396813 3300009093 Bacteria 1555
82 Ga0105247_10005744 3300009101 Bacteria 7768
83 Ga0105247_10109567 3300009101 Bacteria 1775
84 Ga0114129_10196764 3300009147 Bacteria 2733
85 Ga0105243_10578373 3300009148 Bacteria 1078
86 Ga0105241_10060960 3300009174 Bacteria 2904
87 Ga0105241_10073639 3300009174 Bacteria 2658
88 Ga0105241_10112845 3300009174 Bacteria 2178
89 Ga0105248_10050368 3300009177 Bacteria 4670
90 Ga0105248_10050394 3300009177 Bacteria 4669
91 Ga0105248_10097135 3300009177 Bacteria 3319
92 Ga0105237_10010021 3300009545 Bacteria 10112
93 Ga0105237_10017465 3300009545 Bacteria 7438
94 Ga0105237_10030642 3300009545 Bacteria 5462
95 Ga0105238_10284461 3300009551 Bacteria 1635
96 Ga0105238_10694460 3300009551 Bacteria 1029
97 Ga0105249_10000479 3300009553 Bacteria 37143
98 Ga0105148_100042 3300009978 Bacteria 18795
99 Ga0099796_10011546 3300010159 Bacteria 2467
100 Ga0105239_10022158 3300010375 Bacteria 7001
101 Ga0105239_10237764 3300010375 Bacteria 2044
102 Ga0105239_11006962 3300010375 Bacteria 958
103 Ga0157369_10593390 3300013105 Bacteria 1144
104 Ga0157374_10128458 3300013296 Bacteria 2451
105 Ga0157378_10057175 3300013297 Bacteria 3476
106 Ga0163163_10073023 3300014325 Bacteria 3421
107 Ga0157380_10225714 3300014326 Bacteria 1679
108 Ga0163161_10005250 3300017792 Bacteria 9015
109 Ga0163161_10576031 3300017792 Bacteria 925
110 Ga0214544_1000004 3300021320 Bacteria 455869
111 Ga0214542_1000001 3300021321 Bacteria 1018696
112 Ga0214542_1029915 3300021321 Bacteria 2177
113 Ga0214545_1000001 3300021324 Bacteria 1092817
114 Ga0214545_1023811 3300021324 Bacteria 3931
115 Ga0214543_1000006 3300021327 Bacteria 443395
116 Ga0209563_104631 3300025230 Bacteria 2604
117 Ga0207425_1016340 3300025245 Bacteria 1648
118 Ga0209677_101151 3300025253 Bacteria 12289
119 Ga0209233_1001516 3300025261 Bacteria 9113
120 Ga0209233_1002707 3300025261 Bacteria 6398
121 Ga0209233_1031659 3300025261 Bacteria 1232
122 Ga0209455_1001114 3300025272 Bacteria 13145
123 Ga0209673_1041055 3300025273 Bacteria 1318
124 Ga0209564_1027978 3300025295 Bacteria 1815
125 Ga0209758_1000024 3300025297 Bacteria 591966
126 Ga0209758_1000068 3300025297 Bacteria 286488
127 Ga0209758_1002049 3300025297 Bacteria 21606
128 Ga0209758_1005922 3300025297 Bacteria 9090
129 Ga0209758_1020096 3300025297 Bacteria 3179
130 Ga0209758_1032747 3300025297 Bacteria 2103
131 Ga0209050_1000299 3300025298 Bacteria 104017
132 Ga0209256_1008038 3300025299 Bacteria 4997
133 Ga0207426_1000120 3300025302 Bacteria 219117
134 Ga0207426_1000673 3300025302 Bacteria 41533
135 Ga0207426_1010122 3300025302 Bacteria 3683
136 Ga0207426_1015033 3300025302 Bacteria 2822
137 Ga0209257_1001327 3300025304 Bacteria 30091
138 Ga0209257_1063088 3300025304 Bacteria 1000
139 Ga0207696_1015915 3300025711 Bacteria 2532
140 Ga0207713_1064293 3300025735 Bacteria 1382
141 Ga0207710_10057690 3300025900 Bacteria 1754
142 Ga0207710_10072977 3300025900 Bacteria 1577
143 Ga0207688_10050140 3300025901 Bacteria 2336
144 Ga0207680_10001161 3300025903 Bacteria 12411
145 Ga0207647_10035303 3300025904 Bacteria 3187
146 Ga0207705_10227936 3300025909 Bacteria 1416
147 Ga0207684_10122127 3300025910 Bacteria 2233
148 Ga0207695_10000008 3300025913 Bacteria 1058268
149 Ga0207671_10028984 3300025914 Bacteria 4135
150 Ga0207671_10049564 3300025914 Bacteria 3109
151 Ga0207671_10070742 3300025914 Bacteria 2602
152 Ga0207652_10312493 3300025921 Bacteria 1418
153 Ga0207646_10415611 3300025922 Bacteria 1214
154 Ga0207681_10000358 3300025923 Bacteria 32494
155 Ga0207681_10006344 3300025923 Bacteria 7259
156 Ga0207681_10340062 3300025923 Bacteria 1199
157 Ga0207694_10170272 3300025924 Bacteria 1763
158 Ga0207694_10276747 3300025924 Bacteria 1378
159 Ga0207650_10424246 3300025925 Bacteria 1104
160 Ga0207644_10003443 3300025931 Bacteria 10228
161 Ga0207644_10015682 3300025931 Bacteria 5091
162 Ga0207706_10077856 3300025933 Bacteria 2916
163 Ga0207711_10063926 3300025941 Bacteria 3178
164 Ga0207711_10065464 3300025941 Bacteria 3142
165 Ga0207689_10113725 3300025942 Bacteria 2225
166 Ga0207667_10044360 3300025949 Bacteria 4712
167 Ga0207667_10148553 3300025949 Bacteria 2412
168 Ga0207667_10651660 3300025949 Bacteria 1059
169 Ga0207712_10000405 3300025961 Bacteria 37152
170 Ga0207668_10000027 3300025972 Bacteria 125575
171 Ga0207668_10000119 3300025972 Bacteria 55547
172 Ga0207668_10020385 3300025972 Bacteria 4211
173 Ga0207640_10482574 3300025981 Bacteria 1028
174 Ga0207640_10506313 3300025981 Bacteria 1006
175 Ga0207640_10629650 3300025981 Bacteria 912
176 Ga0207658_10000091 3300025986 Bacteria 99970
177 Ga0207658_10000972 3300025986 Bacteria 23654
178 Ga0207658_10303034 3300025986 Bacteria 1377
179 Ga0207639_10003038 3300026041 Bacteria 11299
180 Ga0207702_10222708 3300026078 Bacteria 1758
181 Ga0207702_10378177 3300026078 Bacteria 1361
182 Ga0207702_10383368 3300026078 Bacteria 1352
183 Ga0207641_10000093 3300026088 Bacteria 125747
184 Ga0207641_10027610 3300026088 Bacteria 4688
185 Ga0207641_10502767 3300026088 Bacteria 1177
186 Ga0207676_10571356 3300026095 Bacteria 1083
187 Ga0207674_10114880 3300026116 Bacteria 2664
188 Ga0207675_100288328 3300026118 Bacteria 1596
189 Ga0207698_10720621 3300026142 Bacteria 994
190 Ga0209281_1027858 3300027111 Bacteria 1031
191 Ga0209389_1000010 3300027296 Bacteria 223892
192 Ga0209389_1000149 3300027296 Bacteria 59631
193 Ga0209589_1000016 3300027357 Bacteria 223788
194 Ga0209489_100016 3300027361 Bacteria 223873
195 Ga0209489_116912 3300027361 Bacteria 3617
196 Ga0209489_116913 3300027361 Bacteria 3617
197 Ga0209700_100030 3300027363 Bacteria 212982
198 Ga0209813_10000012 3300027866 Bacteria 91374
199 Ga0268266_10006810 3300028379 Bacteria 10409
200 Ga0268265_10000633 3300028380 Bacteria 35043
201 Ga0268265_10045396 3300028380 Bacteria 3278
202 Ga0268265_10067570 3300028380 Bacteria 2768
203 Ga0268265_10410731 3300028380 Bacteria 1254
204 Ga0268264_10008606 3300028381 Bacteria 8479
205 Ga0268264_10058148 3300028381 Bacteria 3237
206 Ga0268264_10656444 3300028381 Bacteria 1038
207 Ga0307515_10000626 3300028794 Bacteria 82165
208 Ga0307513_10011751 3300031456 Bacteria 10858
209 Ga0307514_10000861 3300031649 Bacteria 48344
210 Ga0307405_10064861 3300031731 Bacteria 2323
211 Ga0307406_10267878 3300031901 Bacteria 1296
212 Ga0307412_10002798 3300031911 Bacteria 9692
213 Ga0307412_10067707 3300031911 Bacteria 2425
214 Ga0307412_10264674 3300031911 Bacteria 1342
215 Ga0307510_10069078 3300033180 Bacteria 3541
216 Ga0307510_10070985 3300033180 Bacteria 3473
217 Ga0307510_10184609 3300033180 Bacteria 1643
218 Ga0373937_0351190 3300036401 Bacteria 1397
219 Ga0372808_004723 3300036459 Bacteria 1757
220 Ga0373925_0533132 3300037068 Bacteria 965
221 Ga0395905_0009332 3300037471 Bacteria 9596
222 Ga0395905_0051815 3300037471 Bacteria 3844
223 Ga0395901_0323940 3300038443 Bacteria 1594
224 Ga0400483_054418 3300039062 Bacteria 2270
225 Ga0400483_158578 3300039062 Bacteria 1435
226 Ga0436365_1170893 3300039437 Bacteria 1189
227 Ga0436361_0149759 3300039447 Bacteria 1692
228 Ga0451793_1596515 3300041452 Bacteria 1250
229 Ga0450911_000342 3300042115 Bacteria 16356
230 Ga0466969_0004164 3300044656 Bacteria 7680
231 Ga0466972_0000148 3300044658 Bacteria 57158
232 Ga0466972_0003448 3300044658 Bacteria 7842
233 Ga0466972_0089104 3300044658 Bacteria 1464
234 Ga0466965_0078424 3300044683 Bacteria 1668
235 Ga0466966_0012261 3300044684 Bacteria 5679
236 Ga0466961_0000008 3300044693 Bacteria 142607
237 Ga0466963_0064278 3300044694 Bacteria 2458
238 Ga0466963_0114294 3300044694 Bacteria 1854
239 Ga0466964_0042755 3300044706 Bacteria 1837
240 Ga0466968_0038023 3300044735 Bacteria 2021
241 Ga0466960_0016548 3300044901 Bacteria 3202
242 Ga0466960_0051615 3300044901 Bacteria 1987
243 Ga0466959_0012592 3300045049 Bacteria 6117
244 Ga0451576_0002808 3300045051 Bacteria 25106
245 Ga0451576_0340093 3300045051 Bacteria 1571
246 Ga0451576_0438574 3300045051 Bacteria 1371
247 Ga0466967_0334346 3300045976 Bacteria 1463
248 Ga0495617_004580 3300046452 Bacteria 5007
249 Ga0495627_013822 3300046453 Bacteria 2834
250 Ga0495590_0014199 3300046457 Bacteria 2912
251 Ga0495629_0059289 3300046459 Bacteria 2675
252 Ga0495629_0133388 3300046459 Bacteria 1730
253 Ga0495629_0232134 3300046459 Bacteria 1272
254 Ga0495638_0000073 3300046460 Bacteria 164378
255 Ga0495638_0002880 3300046460 Bacteria 13779
256 Ga0495651_0001984 3300046462 Bacteria 15854
257 Ga0495651_0029080 3300046462 Bacteria 4310
258 Ga0495653_0019076 3300046463 Bacteria 5564
259 Ga0495650_0001348 3300046471 Bacteria 24429
260 Ga0495605_0051960 3300046474 Bacteria 1994
261 Ga0495605_0059353 3300046474 Bacteria 1837
262 Ga0495662_0050493 3300046476 Bacteria 2008
263 Ga0495664_0004905 3300046477 Bacteria 7318
264 Ga0495596_0003376 3300046500 Bacteria 8110
265 Ga0495607_0035060 3300046501 Bacteria 3039
266 Ga0495583_0000087 3300046506 Bacteria 164974
267 Ga0495606_0055071 3300046507 Bacteria 2573
268 Ga0495606_0061205 3300046507 Bacteria 2409
269 Ga0495608_0010094 3300046511 Bacteria 6586
270 Ga0495610_0000525 3300046512 Bacteria 38499
271 Ga0495610_0005333 3300046512 Bacteria 9174
272 Ga0495610_0022825 3300046512 Bacteria 3413
273 Ga0495610_0080777 3300046512 Bacteria 1494
274 Ga0495616_0012946 3300046513 Bacteria 4717
275 Ga0495628_0011313 3300046516 Bacteria 7548
276 Ga0495630_0596480 3300046517 Bacteria 847
277 Ga0495632_0000049 3300046519 Bacteria 134597
278 Ga0495632_0002653 3300046519 Bacteria 13424
279 Ga0495632_0218751 3300046519 Bacteria 862
280 Ga0495637_0009667 3300046520 Bacteria 4696
281 Ga0495637_0014164 3300046520 Bacteria 3766
282 Ga0495643_0000047 3300046522 Bacteria 217914
283 Ga0495643_0000797 3300046522 Bacteria 34862
284 Ga0495643_0020094 3300046522 Bacteria 3857
285 Ga0495648_0000049 3300046524 Bacteria 164366
286 Ga0495648_0013868 3300046524 Bacteria 5933
287 Ga0495648_0017576 3300046524 Bacteria 5106
288 Ga0495648_0032189 3300046524 Bacteria 3445
289 Ga0495648_0154408 3300046524 Bacteria 1194
290 Ga0495663_0000009 3300046525 Bacteria 256308
291 Ga0495652_0010482 3300046529 Bacteria 8398
292 Ga0495652_0035658 3300046529 Bacteria 4328
293 Ga0495654_0065893 3300046530 Bacteria 1728
294 Ga0495640_0016765 3300046533 Bacteria 5476
295 Ga0495640_0049025 3300046533 Bacteria 2915
296 Ga0495587_0004347 3300046536 Bacteria 9353
297 Ga0495597_0004357 3300046542 Bacteria 7805
298 Ga0495645_0001873 3300046543 Bacteria 14306
299 Ga0495622_0074660 3300046557 Bacteria 1563
300 Ga0495633_0000290 3300046558 Bacteria 57790
301 Ga0495633_0000319 3300046558 Bacteria 54580
302 Ga0495633_0100541 3300046558 Bacteria 1342
303 Ga0495633_0206301 3300046558 Bacteria 901
304 Ga0495667_0003300 3300046559 Bacteria 10818
305 Ga0495668_0113866 3300046616 Bacteria 1479
306 Ga0495634_0024720 3300046642 Bacteria 4211
307 Ga0495634_0148798 3300046642 Bacteria 1482
308 Ga0495634_0289931 3300046642 Bacteria 992
309 Ga0495611_0049441 3300046648 Bacteria 1892
310 Ga0495625_0004416 3300046660 Bacteria 13309
311 Ga0495635_0001999 3300046663 Bacteria 13856
312 Ga0495635_0009596 3300046663 Bacteria 6765
313 Ga0495588_0007284 3300046674 Bacteria 5028
314 Ga0495657_0001200 3300046675 Bacteria 22691
315 Ga0495599_0004074 3300046678 Bacteria 8611
316 Ga0495623_0012871 3300046679 Bacteria 5418
317 Ga0495646_0040750 3300046680 Bacteria 2858
318 Ga0495646_0042675 3300046680 Bacteria 2782
319 Ga0495613_0028267 3300046689 Bacteria 4171
320 Ga0495613_0185899 3300046689 Bacteria 1470
321 Ga0495624_0361859 3300046690 Bacteria 872
322 Ga0495671_0000038 3300046692 Bacteria 173693
323 Ga0495671_0000042 3300046692 Bacteria 165201
324 Ga0495649_0008912 3300046694 Bacteria 6004
325 Ga0495589_0076439 3300046794 Bacteria 1633
326 Ga0495600_0002291 3300046809 Bacteria 10909
327 Ga0495600_0275180 3300046809 Bacteria 1067
328 Ga0495604_0009383 3300047317 Bacteria 7739
329 Ga0495604_0111017 3300047317 Bacteria 1999
330 Ga0495674_0009389 3300047319 Bacteria 9296
331 Ga0495676_0084691 3300047321 Bacteria 2391
332 Ga0495680_0007048 3300047322 Bacteria 10359
333 Ga0495683_0010864 3300047323 Bacteria 4802
334 Ga0495683_0075570 3300047323 Bacteria 1650
335 Ga0495687_016477 3300047443 Bacteria 3715
336 Ga0495687_074941 3300047443 Bacteria 1344
337 Ga0495687_083004 3300047443 Bacteria 1249
338 Ga0495675_0001461 3300047444 Bacteria 14304
339 Ga0495673_0000111 3300047469 Bacteria 164974
340 Ga0495673_0108149 3300047469 Bacteria 1115
341 Ga0495673_0115234 3300047469 Bacteria 1070
342 Ga0495681_0000050 3300047470 Bacteria 109433
343 Ga0495681_0000953 3300047470 Bacteria 22221
344 Ga0495686_0000131 3300047472 Bacteria 152064
345 Ga0495686_0254795 3300047472 Bacteria 985
346 Ga0495593_0066345 3300047673 Bacteria 1881
347 Ga0495593_0268923 3300047673 Bacteria 853
348 Ga0495602_0016196 3300048088 Bacteria 7500
349 Ga0495614_0078427 3300048089 Bacteria 1429
350 Ga0495615_0000002 3300048090 Bacteria 167871
351 Ga0495626_0001710 3300048091 Bacteria 16808
352 Ga0496100_0331714 3300048903 Bacteria 1145
353 Ga0496101_0063166 3300048904 Bacteria 2695
354 Ga0496101_0386286 3300048904 Bacteria 1101
355 Ga0496102_0001289 3300048905 Bacteria 22550
356 Ga0496102_0014553 3300048905 Bacteria 6836
357 Ga0496102_0631320 3300048905 Bacteria 994
358 Ga0496103_0000723 3300048906 Bacteria 24417
359 Ga0496103_0011719 3300048906 Bacteria 5201
360 Ga0496104_0001038 3300048907 Bacteria 23748
361 Ga0496104_0021120 3300048907 Bacteria 5973
362 Ga0496104_0232302 3300048907 Bacteria 1756
363 Ga0496104_0640432 3300048907 Bacteria 972
364 Ga0496105_0001070 3300048908 Bacteria 18947
365 Ga0496105_0007451 3300048908 Bacteria 8471
366 Ga0496105_0029552 3300048908 Bacteria 4486
367 Ga0496107_0125584 3300048910 Bacteria 1892
368 Ga0496107_0420095 3300048910 Bacteria 994
369 Ga0496108_0202228 3300048911 Bacteria 1724
370 Ga0496108_0405095 3300048911 Bacteria 1191
371 Ga0496108_0425246 3300048911 Bacteria 1160
372 Ga0496109_0083360 3300048912 Bacteria 2948
373 Ga0496110_0079158 3300048913 Bacteria 2926
374 Ga0496110_0165804 3300048913 Bacteria 2003
375 Ga0496110_0241914 3300048913 Bacteria 1642
376 Ga0496112_0005313 3300048915 Bacteria 11115
377 Ga0496112_0048480 3300048915 Bacteria 4164
378 Ga0496113_0000519 3300048916 Bacteria 19033
379 Ga0496113_0015207 3300048916 Bacteria 5281
380 Ga0496113_0061925 3300048916 Bacteria 2824
381 Ga0496114_0594528 3300048917 Bacteria 976
382 Ga0496115_0031252 3300048918 Bacteria 4194
383 Ga0496116_0000060 3300048919 Bacteria 272219
384 Ga0496116_0022454 3300048919 Bacteria 4728
385 Ga0496116_0166777 3300048919 Bacteria 1199
386 Ga0496117_0001164 3300048920 Bacteria 39543
387 Ga0496117_0298983 3300048920 Bacteria 853
388 Ga0496118_0019810 3300048921 Bacteria 6000
389 Ga0496118_0023183 3300048921 Bacteria 5400
390 Ga0496118_0070937 3300048921 Bacteria 2511
391 Ga0496118_0070938 3300048921 Bacteria 2511
392 Ga0496118_0313882 3300048921 Bacteria 854
393 Ga0496119_0003597 3300048922 Bacteria 15945
394 Ga0496119_0011321 3300048922 Bacteria 7406
395 Ga0496119_0031381 3300048922 Bacteria 3565
396 Ga0496119_0151276 3300048922 Bacteria 1243
397 Ga0496120_0006689 3300048923 Bacteria 8777
398 Ga0496120_0022344 3300048923 Bacteria 3981
399 Ga0496121_0000017 3300048924 Bacteria 546415
400 Ga0496121_0001779 3300048924 Bacteria 34950
401 Ga0496121_0011514 3300048924 Bacteria 9802
402 Ga0496121_0035076 3300048924 Bacteria 4501
403 Ga0496121_0043707 3300048924 Bacteria 3875
404 Ga0496121_0059460 3300048924 Bacteria 3151
405 Ga0496121_0063034 3300048924 Bacteria 3032
406 Ga0496121_0093883 3300048924 Bacteria 2335
407 Ga0496121_0166887 3300048924 Bacteria 1603
408 Ga0496121_0172987 3300048924 Bacteria 1566
409 Ga0496121_0276643 3300048924 Bacteria 1151
410 Ga0496121_0311517 3300048924 Bacteria 1064
411 Ga0496121_0365795 3300048924 Bacteria 956
412 Ga0496122_0001106 3300048925 Bacteria 46592
413 Ga0496122_0001302 3300048925 Bacteria 41169
414 Ga0496122_0001656 3300048925 Bacteria 34600
415 Ga0496122_0078710 3300048925 Bacteria 2308
416 Ga0496122_0127770 3300048925 Bacteria 1623
417 Ga0496123_0000457 3300048926 Bacteria 71921
418 Ga0496123_0001454 3300048926 Bacteria 32962
419 Ga0496123_0003614 3300048926 Bacteria 17136
420 Ga0496123_0005223 3300048926 Bacteria 13192
421 Ga0496123_0015170 3300048926 Bacteria 6338
422 Ga0496123_0048070 3300048926 Bacteria 2874
423 Ga0496124_0000204 3300048927 Bacteria 116976
424 Ga0496124_0000988 3300048927 Bacteria 45089
425 Ga0496124_0002175 3300048927 Bacteria 26179
426 Ga0496124_0002877 3300048927 Bacteria 21757
427 Ga0496124_0007980 3300048927 Bacteria 11142
428 Ga0496124_0010058 3300048927 Bacteria 9649
429 Ga0496124_0062229 3300048927 Bacteria 3124
430 Ga0496124_0268464 3300048927 Bacteria 1251
431 Ga0496125_0003958 3300048928 Bacteria 17459
432 Ga0496125_0004293 3300048928 Bacteria 16548
433 Ga0496125_0017253 3300048928 Bacteria 6896
434 Ga0496125_0090717 3300048928 Bacteria 2292
435 Ga0496125_0097804 3300048928 Bacteria 2173
436 Ga0496125_0101131 3300048928 Bacteria 2123
437 Ga0496125_0109237 3300048928 Bacteria 2009
438 Ga0496125_0116566 3300048928 Bacteria 1918
439 Ga0496126_0000066 3300048929 Bacteria 252188
440 Ga0496126_0034196 3300048929 Bacteria 4775
441 Ga0496126_0119292 3300048929 Bacteria 2289
442 Ga0501198_033018 3300049649 Bacteria 871
443 Ga0501223_000031 3300049663 Bacteria 51024
444 Ga0501233_000027 3300049668 Bacteria 19963
445 Ga0501225_0001726 3300049705 Bacteria 6842
446 Ga0501225_0006588 3300049705 Bacteria 3389
447 Ga0501225_0039660 3300049705 Bacteria 1298
448 nmdc:mga03683_95844_c1 3300050489 Bacteria 1299
449 nmdc:mga03n38_130459_c1 3300050490 Bacteria 1245
450 nmdc:mga03n38_46090_c1 3300050490 Bacteria 1923
451 nmdc:mga00v17_135649_c1 3300050491 Bacteria 1575
452 nmdc:mga00v17_67343_c1 3300050491 Bacteria 2212
453 nmdc:mga0yw44_35184_c1 3300050492 Bacteria 2941
454 nmdc:mga0k408_272726_c1 3300050493 Bacteria 1010
455 nmdc:mga0k408_4184_c1 3300050493 Bacteria 7658
456 nmdc:mga06z11_108_c1 3300050494 Bacteria 33977
457 nmdc:mga06z11_18525_c1 3300050494 Bacteria 3182
458 nmdc:mga04h51_11_c1 3300050495 Bacteria 101578
459 nmdc:mga04h51_16089_c1 3300050495 Bacteria 2167
460 nmdc:mga07m45_3791_c1 3300050496 Bacteria 7316
461 nmdc:mga07m45_41409_c1 3300050496 Bacteria 2580
462 nmdc:mga05p37_167700_c1 3300050507 Bacteria 2679
463 nmdc:mga08x19_103817_c1 3300050514 Bacteria 1888
464 nmdc:mga0sz30_34311_c2 3300050516 Bacteria 827
465 Ga0500610_0030564 3300053079 Bacteria 2731
466 Ga0500635_0000497 3300053080 Bacteria 10901
467 Ga0500635_0034923 3300053080 Bacteria 1650
468 Ga0495595_0139141 3300053084 Bacteria 1190
469 Ga0500643_000007 3300053087 Bacteria 462836
470 Ga0500643_007226 3300053087 Bacteria 4521
471 Ga0500644_0075920 3300053088 Bacteria 1223
472 Ga0500644_0141749 3300053088 Bacteria 956
473 Ga0500647_0023075 3300053091 Bacteria 2916
474 Ga0500583_0070954 3300053092 Bacteria 1665
475 Ga0500651_0054309 3300053093 Bacteria 2511
476 Ga0500566_0000613 3300053094 Bacteria 20005
477 Ga0500566_0048519 3300053094 Bacteria 2434
478 Ga0500641_0179247 3300053096 Bacteria 910
479 Ga0500554_076941 3300053102 Bacteria 1094
480 Ga0500555_003600 3300053103 Bacteria 4412
481 Ga0500557_000009 3300053105 Bacteria 125806
482 Ga0500562_009630 3300053108 Bacteria 2442
483 Ga0500572_036605 3300053111 Bacteria 1402
484 Ga0500595_000111 3300053119 Bacteria 55013
485 Ga0500608_000420 3300053122 Bacteria 16146
486 Ga0500608_057718 3300053122 Bacteria 1859
487 Ga0500618_000755 3300053125 Bacteria 18296
488 Ga0500618_047674 3300053125 Bacteria 974
489 Ga0500626_044699 3300053128 Bacteria 1999
490 Ga0500642_0000154 3300053130 Bacteria 28564
491 Ga0500642_0021161 3300053130 Bacteria 2571
492 Ga0500655_000008 3300053133 Bacteria 67575
493 Ga0500658_0030410 3300053134 Bacteria 2106
494 Ga0500559_0000335 3300053136 Bacteria 35252
495 Ga0500559_0003742 3300053136 Bacteria 7393
496 Ga0500559_0115931 3300053136 Bacteria 1243
497 Ga0500564_004667 3300053138 Bacteria 5513
498 Ga0500573_0059303 3300053140 Bacteria 2193
499 Ga0500577_0020593 3300053142 Bacteria 2160
500 Ga0500590_000889 3300053148 Bacteria 11325
501 Ga0500590_123462 3300053148 Bacteria 1209
502 Ga0500603_000222 3300053150 Bacteria 15001
503 Ga0500604_0009791 3300053151 Bacteria 2555
504 Ga0500622_0107920 3300053156 Bacteria 1363
505 Ga0500624_000021 3300053157 Bacteria 117511
506 Ga0500624_000221 3300053157 Bacteria 21108
507 Ga0500638_000096 3300053162 Bacteria 16139
508 Ga0500636_0000228 3300053177 Bacteria 30746
509 Ga0500636_0040378 3300053177 Bacteria 2759
510 Ga0500636_0157597 3300053177 Bacteria 1241
511 Ga0500637_0000708 3300053178 Bacteria 13298
512 Ga0500637_0001960 3300053178 Bacteria 8942
513 Ga0500637_0083980 3300053178 Bacteria 1841
514 Ga0500567_004223 3300053723 Bacteria 6519
515 Ga0500567_133659 3300053723 Bacteria 965
516 Ga0500625_000012 3300053729 Bacteria 127269
517 Ga0500625_000053 3300053729 Bacteria 23355
518 Ga0500645_011994 3300053730 Bacteria 2811
519 Ga0500601_000488 3300053737 Bacteria 6175
520 Ga0500661_000582 3300055283 Bacteria 6821
521 Ga0500661_017617 3300055283 Bacteria 1275

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0051960 Ga0495605_0051960_14_655 208
2 iso_pu_bacteria 8019678201 8019685142 210
3 3300048903 Ga0496100_0331714 Ga0496100_0331714_11_670 214
4 iso_pu_bacteria 2922386360 2922386623 218
5 iso_pu_bacteria 8016603502 8016609648 218
6 iso_pu_bacteria 8019530166 8019533967 218
7 3300038443 Ga0395901_0323940 Ga0395901_0323940_17_700 222
8 3300046642 Ga0495634_0148798 Ga0495634_0148798_789_1472 222
9 3300053084 Ga0495595_0139141 Ga0495595_0139141_467_1150 222
10 3300053096 Ga0500641_0179247 Ga0500641_0179247_213_896 222
11 3300039062 Ga0400483_054418 Ga0400483_054418_585_1259 223
12 3300046457 Ga0495590_0014199 Ga0495590_0014199_1617_2303 223
13 3300006051 Ga0075364_10014814 Ga0075364_100148143 227
14 iso_pu_bacteria 2898795034 2898798064 230
15 iso_pu_bacteria 2899259804 2899261409 232
16 iso_pu_bacteria 2507262055 2507507980 234
17 iso_pu_bacteria 2508501009 2508542087 234
18 iso_pu_bacteria 2508501042 2508692366 234
19 iso_pu_bacteria 2508501128 2509151082 234
20 iso_pu_bacteria 2511231028 2511397998 234
21 iso_pu_bacteria 2513237092 2513622573 234
22 iso_pu_bacteria 2513237094 2513639406 234
23 iso_pu_bacteria 2513237095 2513647191 234
24 iso_pu_bacteria 2513237096 2513653749 234
25 iso_pu_bacteria 2513237098 2513671731 234
26 iso_pu_bacteria 2513237137 2513856186 234
27 iso_pu_bacteria 2513237139 2513877607 234
28 iso_pu_bacteria 2513237145 2513918089 234
29 iso_pu_bacteria 2513237161 2514009752 234
30 iso_pu_bacteria 2515154112 2515626867 234
31 iso_pu_bacteria 2517572143 2517891673 234
32 iso_pu_bacteria 2524023205 2524442498 234
33 iso_pu_bacteria 2524023210 2524470176 234
34 iso_pu_bacteria 2528768022 2528850835 234
35 iso_pu_bacteria 2617270735 2617346476 234
36 iso_pu_bacteria 2617270741 2617378581 234
37 iso_pu_bacteria 2667528175 2671118556 234
38 iso_pu_bacteria 2744054633 2745075600 234
39 iso_pu_bacteria 2791355196 2793060791 234
40 iso_pu_bacteria 2791355197 2793067045 234
41 iso_pu_bacteria 2802429603 2805918383 234
42 iso_pu_bacteria 2816332527 2818236228 234
43 iso_pu_bacteria 2824600985 2824605319 234
44 iso_pu_bacteria 2824609381 2824615569 234
45 iso_pu_bacteria 2824617872 2824626462 234
46 iso_pu_bacteria 2824626560 2824634781 234
47 iso_pu_bacteria 2824635225 2824643738 234
48 iso_pu_bacteria 2824653114 2824656697 234
49 iso_pu_bacteria 2824661429 2824670625 234
50 iso_pu_bacteria 2824671348 2824678725 234
51 iso_pu_bacteria 2824679649 2824686920 234
52 iso_pu_bacteria 2824687955 2824696146 234
53 iso_pu_bacteria 2824696289 2824703496 234
54 iso_pu_bacteria 2824704595 2824714373 234
55 iso_pu_bacteria 2824714736 2824723582 234
56 iso_pu_bacteria 2824723954 2824732586 234
57 iso_pu_bacteria 2824732956 2824740392 234
58 iso_pu_bacteria 2824746037 2824752806 234
59 iso_pu_bacteria 2824753945 2824763329 234
60 iso_pu_bacteria 2824763712 2824773088 234
61 iso_pu_bacteria 2824773399 2824774736 234
62 iso_pu_bacteria 2838122688 2838122984 234
63 iso_pu_bacteria 2841941048 2841944731 234
64 iso_pu_bacteria 2841949485 2841955977 234
65 iso_pu_bacteria 2841957949 2841960029 234
66 iso_pu_bacteria 2841966195 2841969886 234
67 iso_pu_bacteria 2841974524 2841978684 234
68 iso_pu_bacteria 2841983080 2841984190 234
69 iso_pu_bacteria 2842038055 2842040331 234
70 iso_pu_bacteria 2842045827 2842046725 234
71 iso_pu_bacteria 2844315083 2844319697 234
72 iso_pu_bacteria 2847930680 2847937018 234
73 iso_pu_bacteria 2847939898 2847947418 234
74 iso_pu_bacteria 2849076700 2849078690 234
75 iso_pu_bacteria 2854681122 2854683475 234
76 iso_pu_bacteria 2857509624 2857513101 234
77 iso_pu_bacteria 2874590934 2874599073 234
78 iso_pu_bacteria 2874612657 2874617248 234
79 iso_pu_bacteria 2874620515 2874626618 234
80 iso_pu_bacteria 2874628541 2874635339 234
81 iso_pu_bacteria 2874645413 2874650482 234
82 iso_pu_bacteria 2876761206 2876764339 234
83 iso_pu_bacteria 2876771140 2876779112 234
84 iso_pu_bacteria 2876818435 2876822716 234
85 iso_pu_bacteria 2879074833 2879082905 234
86 iso_pu_bacteria 2879099564 2879106054 234
87 iso_pu_bacteria 2879127579 2879133030 234
88 iso_pu_bacteria 2879142872 2879149317 234
89 iso_pu_bacteria 2881364244 2881368111 234
90 iso_pu_bacteria 2881665667 2881667805 234
91 iso_pu_bacteria 2885366525 2885369585 234
92 iso_pu_bacteria 2885374607 2885381003 234
93 iso_pu_bacteria 2885383462 2885389128 234
94 iso_pu_bacteria 2885409591 2885414792 234
95 iso_pu_bacteria 2888378607 2888385118 234
96 iso_pu_bacteria 2888388044 2888393109 234
97 iso_pu_bacteria 2888419890 2888425265 234
98 iso_pu_bacteria 2891088606 2891089732 234
99 iso_pu_bacteria 2903727486 2903730622 234
100 iso_pu_bacteria 2903748898 2903755795 234
101 iso_pu_bacteria 2903768456 2903776259 234
102 iso_pu_bacteria 2904666416 2904671959 234
103 iso_pu_bacteria 2904711408 2904712317 234
104 iso_pu_bacteria 2906602504 2906609570 234
105 iso_pu_bacteria 2906610324 2906616846 234
106 iso_pu_bacteria 2906626472 2906628883 234
107 iso_pu_bacteria 2906635258 2906642887 234
108 iso_pu_bacteria 2906643746 2906649869 234
109 iso_pu_bacteria 2906660503 2906667177 234
110 iso_pu_bacteria 2908739725 2908742033 234
111 iso_pu_bacteria 2908775508 2908780825 234
112 iso_pu_bacteria 2922368715 2922372766 234
113 iso_pu_bacteria 2922393267 2922397410 234
114 iso_pu_bacteria 2922425934 2922431081 234
115 iso_pu_bacteria 2929615660 2929620588 234
116 iso_pu_bacteria 2929624759 2929626482 234
117 iso_pu_bacteria 2932784394 2932784651 234
118 iso_pu_bacteria 2932794094 2932795447 234
119 iso_pu_bacteria 2932801729 2932807959 234
120 iso_pu_bacteria 2932809354 2932809631 234
121 iso_pu_bacteria 2932818245 2932818626 234
122 iso_pu_bacteria 2932828146 2932828419 234
123 iso_pu_bacteria 2933577622 2933582505 234
124 iso_pu_bacteria 2935608549 2935609524 234
125 iso_pu_bacteria 2935616580 2935617392 234
126 iso_pu_bacteria 2935630451 2935636923 234
127 iso_pu_bacteria 2935638405 2935639126 234
128 iso_pu_bacteria 2935648319 2935652325 234
129 iso_pu_bacteria 2935656913 2935660907 234
130 iso_pu_bacteria 2935665750 2935666022 234
131 iso_pu_bacteria 2935675223 2935675670 234
132 iso_pu_bacteria 2935684952 2935685321 234
133 iso_pu_bacteria 2935694250 2935698570 234
134 iso_pu_bacteria 2935703347 2935704133 234
135 iso_pu_bacteria 2935713505 2935713874 234
136 iso_pu_bacteria 2935722832 2935724493 234
137 iso_pu_bacteria 2935732158 2935733149 234
138 iso_pu_bacteria 2935741537 2935742528 234
139 iso_pu_bacteria 2935750917 2935751286 234
140 iso_pu_bacteria 2935760218 2935765943 234
141 iso_pu_bacteria 2935769743 2935769924 234
142 iso_pu_bacteria 2935777560 2935782056 234
143 iso_pu_bacteria 2935785616 2935785834 234
144 iso_pu_bacteria 2935793552 2935794238 234
145 iso_pu_bacteria 2935801545 2935802216 234
146 iso_pu_bacteria 2935810662 2935811040 234
147 iso_pu_bacteria 2935819856 2935822686 234
148 iso_pu_bacteria 2935827899 2935828621 234
149 iso_pu_bacteria 2935837841 2935839997 234
150 iso_pu_bacteria 2935847175 2935848268 234
151 iso_pu_bacteria 2935855204 2935856017 234
152 iso_pu_bacteria 2935864058 2935866039 234
153 iso_pu_bacteria 2935873716 2935877636 234
154 iso_pu_bacteria 2935883170 2935883653 234
155 iso_pu_bacteria 2935908558 2935909929 234
156 iso_pu_bacteria 2935916978 2935917655 234
157 iso_pu_bacteria 2935926038 2935927409 234
158 iso_pu_bacteria 2935934488 2935936746 234
159 iso_pu_bacteria 2935942939 2935944951 234
160 iso_pu_bacteria 2935951376 2935953388 234
161 iso_pu_bacteria 2935959822 2935961119 234
162 iso_pu_bacteria 2935967501 2935970228 234
163 iso_pu_bacteria 2935975950 2935981049 234
164 iso_pu_bacteria 2935984226 2935986796 234
165 iso_pu_bacteria 2935992306 2935992580 234
166 iso_pu_bacteria 2936002035 2936002452 234
167 iso_pu_bacteria 2936011229 2936014963 234
168 iso_pu_bacteria 2936019824 2936022056 234
169 iso_pu_bacteria 2936028420 2936032744 234
170 iso_pu_bacteria 2936037263 2936037541 234
171 iso_pu_bacteria 2936046547 2936050704 234
172 iso_pu_bacteria 2936055302 2936059519 234
173 iso_pu_bacteria 2940556831 2940557912 234
174 iso_pu_bacteria 2941507105 2941513621 234
175 iso_pu_bacteria 2941515067 2941521523 234
176 iso_pu_bacteria 2941523033 2941529277 234
177 iso_pu_bacteria 2941531003 2941536755 234
178 iso_pu_bacteria 2941538514 2941540663 234
179 iso_pu_bacteria 3005483717 3005485071 234
180 iso_pu_bacteria 3005506211 3005507410 234
181 iso_pu_bacteria 3005594810 3005599925 234
182 iso_pu_bacteria 3005710791 3005715519 234
183 iso_pu_bacteria 3005718088 3005722855 234
184 iso_pu_bacteria 8006964411 8006970929 234
185 iso_pu_bacteria 8006994254 8006999336 234
186 iso_pu_bacteria 8016511872 8016521098 234
187 iso_pu_bacteria 8016522445 8016528994 234
188 iso_pu_bacteria 8016530956 8016534195 234
189 iso_pu_bacteria 8016548790 8016554716 234
190 iso_pu_bacteria 8016557553 8016563088 234
191 iso_pu_bacteria 8016566248 8016572537 234
192 iso_pu_bacteria 8016575299 8016576705 234
193 iso_pu_bacteria 8016583857 8016593789 234
194 iso_pu_bacteria 8016595262 8016600845 234
195 iso_pu_bacteria 8016613128 8016615280 234
196 iso_pu_bacteria 8016622563 8016625928 234
197 iso_pu_bacteria 8016630954 8016639510 234
198 iso_pu_bacteria 8017057580 8017064509 234
199 iso_pu_bacteria 8019538911 8019545704 234
200 iso_pu_bacteria 8019555841 8019565713 234
201 iso_pu_bacteria 8019565922 8019575804 234
202 iso_pu_bacteria 8019576017 8019583874 234
203 iso_pu_bacteria 8019586578 8019591685 234
204 iso_pu_bacteria 8019597564 8019599651 234
205 iso_pu_bacteria 8019619141 8019619485 234
206 iso_pu_bacteria 8019629233 8019633636 234
207 iso_pu_bacteria 8019638758 8019646269 234
208 iso_pu_bacteria 8019648815 8019649021 234
209 iso_pu_bacteria 8019659431 8019661514 234
210 iso_pu_bacteria 8019668869 8019671047 234
211 iso_pu_bacteria 8019687851 8019690735 234
212 iso_pu_bacteria 8055742211 8055745450 234
213 iso_pu_bacteria 8056967851 8056968712 234
214 iso_pu_bacteria 8057132660 8057133606 234
215 iso_pu_bacteria 2899275550 2899276857 235
216 3300005331 Ga0070670_100043222 Ga0070670_1000432222 236
217 3300005353 Ga0070669_100047738 Ga0070669_1000477382 236
218 3300005355 Ga0070671_100072841 Ga0070671_1000728413 236
219 3300005367 Ga0070667_100333724 Ga0070667_1003337242 236
220 3300005466 Ga0070685_10413856 Ga0070685_104138562 236
221 3300009978 Ga0105148_100042 Ga0105148_10004217 236
222 3300014326 Ga0157380_10225714 Ga0157380_102257142 236
223 3300017792 Ga0163161_10576031 Ga0163161_105760311 236
224 3300025986 Ga0207658_10303034 Ga0207658_103030342 236
225 3300048911 Ga0496108_0405095 Ga0496108_0405095_302_1018 236
226 3300048913 Ga0496110_0165804 Ga0496110_0165804_660_1376 236
227 3300048916 Ga0496113_0015207 Ga0496113_0015207_2165_2881 236
228 3300049705 Ga0501225_0001726 Ga0501225_0001726_5826_6542 236
229 iso_pu_bacteria 2919138771 2919140962 236
230 3300050491 nmdc:mga00v17_135649_c1 nmdc:mga00v17_135649_c1_571_1296 237
231 iso_pu_bacteria 2599185354 2600200274 237
232 iso_pu_bacteria 2599185359 2600226156 237
233 iso_pu_bacteria 2751185897 2753763949 237
234 iso_pu_bacteria 2818991466 2819712798 237
235 iso_pu_bacteria 2840878972 2840882981 237
236 iso_pu_bacteria 2919679072 2919682022 237
237 iso_pu_bacteria 2928027323 2928030439 237
238 iso_pu_bacteria 2928526807 2928527389 237
239 iso_pu_bacteria 2928968154 2928969125 237
240 iso_pu_bacteria 2946787523 2946788597 237
241 iso_pu_bacteria 2984555340 2984557366 237
242 iso_pu_bacteria 2984564862 2984568237 237
243 iso_pu_bacteria 2990265787 2990267978 237
244 iso_pu_bacteria 2993356040 2993359317 237
245 iso_pu_bacteria 2993693658 2993697003 237
246 3300003215 JGI25153J46596_10000775 JGI25153J46596_1000077514 238
247 3300003215 JGI25153J46596_10001683 JGI25153J46596_100016836 238
248 3300003215 JGI25153J46596_10015897 JGI25153J46596_100158974 238
249 3300003354 JGI25160J50197_1000991 JGI25160J50197_10009915 238
250 3300003354 JGI25160J50197_1008973 JGI25160J50197_10089735 238
251 3300003354 JGI25160J50197_1029732 JGI25160J50197_10297321 238
252 3300003794 Ga0055531_10007448 Ga0055531_100074482 238
253 3300005262 Ga0065165_1000420 Ga0065165_100042051 238
254 3300005262 Ga0065165_1000556 Ga0065165_100055642 238
255 3300005262 Ga0065165_1002861 Ga0065165_10028616 238
256 3300005262 Ga0065165_1018469 Ga0065165_10184693 238
257 3300005295 Ga0065707_10182958 Ga0065707_101829582 238
258 3300005327 Ga0070658_10129261 Ga0070658_101292612 238
259 3300005327 Ga0070658_10291834 Ga0070658_102918342 238
260 3300005331 Ga0070670_100158239 Ga0070670_1001582392 238
261 3300005335 Ga0070666_10232277 Ga0070666_102322771 238
262 3300005347 Ga0070668_100000159 Ga0070668_10000015919 238
263 3300005347 Ga0070668_100042914 Ga0070668_1000429144 238
264 3300005347 Ga0070668_100060893 Ga0070668_1000608932 238
265 3300005353 Ga0070669_100008694 Ga0070669_1000086945 238
266 3300005354 Ga0070675_100421684 Ga0070675_1004216842 238
267 3300005355 Ga0070671_100039396 Ga0070671_1000393962 238
268 3300005367 Ga0070667_100000120 Ga0070667_10000012035 238
269 3300005467 Ga0070706_100111923 Ga0070706_1001119233 238
270 3300005471 Ga0070698_100129760 Ga0070698_1001297603 238
271 3300005530 Ga0070679_100061959 Ga0070679_1000619592 238
272 3300005536 Ga0070697_100259244 Ga0070697_1002592441 238
273 3300005539 Ga0068853_100231198 Ga0068853_1002311982 238
274 3300005544 Ga0070686_100195545 Ga0070686_1001955452 238
275 3300005614 Ga0068856_100442332 Ga0068856_1004423321 238
276 3300005614 Ga0068856_100486051 Ga0068856_1004860511 238
277 3300005617 Ga0068859_100788986 Ga0068859_1007889862 238
278 3300005841 Ga0068863_100000053 Ga0068863_10000005336 238
279 3300005841 Ga0068863_100042120 Ga0068863_1000421205 238
280 3300005843 Ga0068860_100013340 Ga0068860_1000133404 238
281 3300005844 Ga0068862_100000778 Ga0068862_10000077822 238
282 3300005844 Ga0068862_100084813 Ga0068862_1000848133 238
283 3300005983 Ga0081540_1052167 Ga0081540_10521672 238
284 3300006038 Ga0075365_10085543 Ga0075365_100855433 238
285 3300006038 Ga0075365_10182055 Ga0075365_101820552 238
286 3300006048 Ga0075363_100019180 Ga0075363_1000191803 238
287 3300006051 Ga0075364_10049523 Ga0075364_100495232 238
288 3300006177 Ga0075362_10034352 Ga0075362_100343522 238
289 3300006178 Ga0075367_10144121 Ga0075367_101441212 238
290 3300006186 Ga0075369_10027581 Ga0075369_100275813 238
291 3300006186 Ga0075369_10104048 Ga0075369_101040481 238
292 3300006195 Ga0075366_10004909 Ga0075366_100049099 238
293 3300006195 Ga0075366_10005300 Ga0075366_100053004 238
294 3300006353 Ga0075370_10119996 Ga0075370_101199962 238
295 3300006358 Ga0068871_100395503 Ga0068871_1003955032 238
296 3300006914 Ga0075436_100496761 Ga0075436_1004967611 238
297 3300006931 Ga0097620_100789063 Ga0097620_1007890632 238
298 3300006941 Ga0099825_1042350 Ga0099825_10423502 238
299 3300006942 Ga0099824_1005450 Ga0099824_100545016 238
300 3300009093 Ga0105240_10208799 Ga0105240_102087991 238
301 3300009093 Ga0105240_10396813 Ga0105240_103968132 238
302 3300009101 Ga0105247_10005744 Ga0105247_100057446 238
303 3300009101 Ga0105247_10109567 Ga0105247_101095672 238
304 3300009148 Ga0105243_10578373 Ga0105243_105783731 238
305 3300009174 Ga0105241_10060960 Ga0105241_100609603 238
306 3300009174 Ga0105241_10073639 Ga0105241_100736393 238
307 3300009174 Ga0105241_10112845 Ga0105241_101128452 238
308 3300009177 Ga0105248_10050368 Ga0105248_100503683 238
309 3300009177 Ga0105248_10050394 Ga0105248_100503943 238
310 3300009545 Ga0105237_10010021 Ga0105237_1001002111 238
311 3300009545 Ga0105237_10030642 Ga0105237_100306424 238
312 3300009551 Ga0105238_10284461 Ga0105238_102844613 238
313 3300009553 Ga0105249_10000479 Ga0105249_1000047925 238
314 3300010375 Ga0105239_10022158 Ga0105239_100221583 238
315 3300010375 Ga0105239_10237764 Ga0105239_102377642 238
316 3300010375 Ga0105239_11006962 Ga0105239_110069621 238
317 3300014325 Ga0163163_10073023 Ga0163163_100730232 238
318 3300021320 Ga0214544_1000004 Ga0214544_1000004209 238
319 3300021321 Ga0214542_1000001 Ga0214542_1000001144 238
320 3300021321 Ga0214542_1029915 Ga0214542_10299153 238
321 3300021324 Ga0214545_1000001 Ga0214545_1000001211 238
322 3300021324 Ga0214545_1023811 Ga0214545_10238111 238
323 3300021327 Ga0214543_1000006 Ga0214543_1000006208 238
324 3300025230 Ga0209563_104631 Ga0209563_1046313 238
325 3300025245 Ga0207425_1016340 Ga0207425_10163403 238
326 3300025253 Ga0209677_101151 Ga0209677_1011519 238
327 3300025261 Ga0209233_1001516 Ga0209233_10015163 238
328 3300025261 Ga0209233_1002707 Ga0209233_10027075 238
329 3300025261 Ga0209233_1031659 Ga0209233_10316592 238
330 3300025272 Ga0209455_1001114 Ga0209455_10011146 238
331 3300025273 Ga0209673_1041055 Ga0209673_10410551 238
332 3300025295 Ga0209564_1027978 Ga0209564_10279783 238
333 3300025297 Ga0209758_1000024 Ga0209758_1000024537 238
334 3300025297 Ga0209758_1000068 Ga0209758_1000068309 238
335 3300025297 Ga0209758_1002049 Ga0209758_100204913 238
336 3300025297 Ga0209758_1005922 Ga0209758_10059228 238
337 3300025297 Ga0209758_1020096 Ga0209758_10200962 238
338 3300025297 Ga0209758_1032747 Ga0209758_10327472 238
339 3300025299 Ga0209256_1008038 Ga0209256_10080384 238
340 3300025302 Ga0207426_1000120 Ga0207426_100012043 238
341 3300025302 Ga0207426_1000673 Ga0207426_100067313 238
342 3300025302 Ga0207426_1010122 Ga0207426_10101222 238
343 3300025302 Ga0207426_1015033 Ga0207426_10150332 238
344 3300025304 Ga0209257_1001327 Ga0209257_100132718 238
345 3300025304 Ga0209257_1063088 Ga0209257_10630881 238
346 3300025900 Ga0207710_10057690 Ga0207710_100576902 238
347 3300025900 Ga0207710_10072977 Ga0207710_100729772 238
348 3300025901 Ga0207688_10050140 Ga0207688_100501403 238
349 3300025903 Ga0207680_10001161 Ga0207680_100011619 238
350 3300025904 Ga0207647_10035303 Ga0207647_100353033 238
351 3300025909 Ga0207705_10227936 Ga0207705_102279362 238
352 3300025910 Ga0207684_10122127 Ga0207684_101221272 238
353 3300025913 Ga0207695_10000008 Ga0207695_10000008491 238
354 3300025914 Ga0207671_10049564 Ga0207671_100495643 238
355 3300025914 Ga0207671_10070742 Ga0207671_100707423 238
356 3300025921 Ga0207652_10312493 Ga0207652_103124932 238
357 3300025922 Ga0207646_10415611 Ga0207646_104156111 238
358 3300025923 Ga0207681_10006344 Ga0207681_100063444 238
359 3300025923 Ga0207681_10340062 Ga0207681_103400622 238
360 3300025924 Ga0207694_10170272 Ga0207694_101702722 238
361 3300025925 Ga0207650_10424246 Ga0207650_104242462 238
362 3300025931 Ga0207644_10015682 Ga0207644_100156823 238
363 3300025933 Ga0207706_10077856 Ga0207706_100778563 238
364 3300025941 Ga0207711_10063926 Ga0207711_100639263 238
365 3300025941 Ga0207711_10065464 Ga0207711_100654643 238
366 3300025942 Ga0207689_10113725 Ga0207689_101137253 238
367 3300025949 Ga0207667_10044360 Ga0207667_100443602 238
368 3300025949 Ga0207667_10148553 Ga0207667_101485533 238
369 3300025949 Ga0207667_10651660 Ga0207667_106516602 238
370 3300025961 Ga0207712_10000405 Ga0207712_1000040525 238
371 3300025972 Ga0207668_10000027 Ga0207668_1000002736 238
372 3300025972 Ga0207668_10000119 Ga0207668_100001197 238
373 3300025981 Ga0207640_10482574 Ga0207640_104825742 238
374 3300025986 Ga0207658_10000091 Ga0207658_1000009135 238
375 3300026078 Ga0207702_10222708 Ga0207702_102227083 238
376 3300026078 Ga0207702_10378177 Ga0207702_103781772 238
377 3300026078 Ga0207702_10383368 Ga0207702_103833682 238
378 3300026088 Ga0207641_10000093 Ga0207641_1000009386 238
379 3300026088 Ga0207641_10027610 Ga0207641_100276105 238
380 3300026095 Ga0207676_10571356 Ga0207676_105713562 238
381 3300026118 Ga0207675_100288328 Ga0207675_1002883283 238
382 3300026142 Ga0207698_10720621 Ga0207698_107206212 238
383 3300027296 Ga0209389_1000010 Ga0209389_1000010116 238
384 3300027296 Ga0209389_1000149 Ga0209389_100014936 238
385 3300027357 Ga0209589_1000016 Ga0209589_100001698 238
386 3300027361 Ga0209489_100016 Ga0209489_100016116 238
387 3300027361 Ga0209489_116912 Ga0209489_1169122 238
388 3300027361 Ga0209489_116913 Ga0209489_1169132 238
389 3300027363 Ga0209700_100030 Ga0209700_100030180 238
390 3300028380 Ga0268265_10000633 Ga0268265_1000063313 238
391 3300028380 Ga0268265_10067570 Ga0268265_100675703 238
392 3300028380 Ga0268265_10410731 Ga0268265_104107312 238
393 3300028381 Ga0268264_10008606 Ga0268264_100086066 238
394 3300028381 Ga0268264_10656444 Ga0268264_106564442 238
395 3300028794 Ga0307515_10000626 Ga0307515_100006262 238
396 3300031456 Ga0307513_10011751 Ga0307513_100117517 238
397 3300031649 Ga0307514_10000861 Ga0307514_1000086128 238
398 3300031731 Ga0307405_10064861 Ga0307405_100648612 238
399 3300031901 Ga0307406_10267878 Ga0307406_102678782 238
400 3300033180 Ga0307510_10069078 Ga0307510_100690784 238
401 3300033180 Ga0307510_10070985 Ga0307510_100709852 238
402 3300033180 Ga0307510_10184609 Ga0307510_101846092 238
403 3300036401 Ga0373937_0351190 Ga0373937_0351190_13_744 238
404 3300036459 Ga0372808_004723 Ga0372808_004723_380_1111 238
405 3300037068 Ga0373925_0533132 Ga0373925_0533132_120_851 238
406 3300037471 Ga0395905_0009332 Ga0395905_0009332_3316_4047 238
407 3300037471 Ga0395905_0051815 Ga0395905_0051815_2762_3493 238
408 3300039437 Ga0436365_1170893 Ga0436365_1170893_352_1083 238
409 3300039447 Ga0436361_0149759 Ga0436361_0149759_217_948 238
410 3300041452 Ga0451793_1596515 Ga0451793_1596515_378_1109 238
411 3300042115 Ga0450911_000342 Ga0450911_000342_3212_3943 238
412 3300044656 Ga0466969_0004164 Ga0466969_0004164_5757_6488 238
413 3300044658 Ga0466972_0000148 Ga0466972_0000148_13448_14179 238
414 3300044658 Ga0466972_0003448 Ga0466972_0003448_897_1628 238
415 3300044658 Ga0466972_0089104 Ga0466972_0089104_516_1247 238
416 3300044683 Ga0466965_0078424 Ga0466965_0078424_198_929 238
417 3300044684 Ga0466966_0012261 Ga0466966_0012261_444_1175 238
418 3300044693 Ga0466961_0000008 Ga0466961_0000008_68374_69105 238
419 3300044694 Ga0466963_0064278 Ga0466963_0064278_1144_1875 238
420 3300044694 Ga0466963_0114294 Ga0466963_0114294_364_1095 238
421 3300044706 Ga0466964_0042755 Ga0466964_0042755_303_1034 238
422 3300044735 Ga0466968_0038023 Ga0466968_0038023_53_784 238
423 3300044901 Ga0466960_0016548 Ga0466960_0016548_1230_1961 238
424 3300044901 Ga0466960_0051615 Ga0466960_0051615_404_1135 238
425 3300045049 Ga0466959_0012592 Ga0466959_0012592_4710_5441 238
426 3300045976 Ga0466967_0334346 Ga0466967_0334346_507_1238 238
427 3300046459 Ga0495629_0059289 Ga0495629_0059289_1311_2042 238
428 3300046459 Ga0495629_0133388 Ga0495629_0133388_432_1163 238
429 3300046459 Ga0495629_0232134 Ga0495629_0232134_225_956 238
430 3300046460 Ga0495638_0002880 Ga0495638_0002880_9567_10298 238
431 3300046462 Ga0495651_0001984 Ga0495651_0001984_4481_5212 238
432 3300046462 Ga0495651_0029080 Ga0495651_0029080_1293_2024 238
433 3300046463 Ga0495653_0019076 Ga0495653_0019076_1831_2562 238
434 3300046471 Ga0495650_0001348 Ga0495650_0001348_20367_21089 238
435 3300046474 Ga0495605_0059353 Ga0495605_0059353_717_1448 238
436 3300046476 Ga0495662_0050493 Ga0495662_0050493_1227_1958 238
437 3300046477 Ga0495664_0004905 Ga0495664_0004905_562_1293 238
438 3300046507 Ga0495606_0055071 Ga0495606_0055071_1213_1944 238
439 3300046511 Ga0495608_0010094 Ga0495608_0010094_5447_6178 238
440 3300046512 Ga0495610_0080777 Ga0495610_0080777_262_993 238
441 3300046516 Ga0495628_0011313 Ga0495628_0011313_3940_4671 238
442 3300046517 Ga0495630_0596480 Ga0495630_0596480_13_744 238
443 3300046519 Ga0495632_0000049 Ga0495632_0000049_86177_86908 238
444 3300046519 Ga0495632_0218751 Ga0495632_0218751_114_845 238
445 3300046520 Ga0495637_0014164 Ga0495637_0014164_263_994 238
446 3300046522 Ga0495643_0000047 Ga0495643_0000047_64442_65173 238
447 3300046522 Ga0495643_0020094 Ga0495643_0020094_1553_2284 238
448 3300046524 Ga0495648_0013868 Ga0495648_0013868_4671_5402 238
449 3300046524 Ga0495648_0017576 Ga0495648_0017576_4172_4903 238
450 3300046524 Ga0495648_0154408 Ga0495648_0154408_36_767 238
451 3300046525 Ga0495663_0000009 Ga0495663_0000009_141817_142548 238
452 3300046529 Ga0495652_0010482 Ga0495652_0010482_2168_2899 238
453 3300046529 Ga0495652_0035658 Ga0495652_0035658_2410_3141 238
454 3300046533 Ga0495640_0016765 Ga0495640_0016765_2965_3696 238
455 3300046533 Ga0495640_0049025 Ga0495640_0049025_36_767 238
456 3300046536 Ga0495587_0004347 Ga0495587_0004347_957_1688 238
457 3300046542 Ga0495597_0004357 Ga0495597_0004357_4089_4820 238
458 3300046543 Ga0495645_0001873 Ga0495645_0001873_5177_5908 238
459 3300046557 Ga0495622_0074660 Ga0495622_0074660_213_944 238
460 3300046558 Ga0495633_0000290 Ga0495633_0000290_8461_9192 238
461 3300046558 Ga0495633_0000319 Ga0495633_0000319_31180_31911 238
462 3300046559 Ga0495667_0003300 Ga0495667_0003300_5447_6178 238
463 3300046642 Ga0495634_0024720 Ga0495634_0024720_1501_2232 238
464 3300046642 Ga0495634_0289931 Ga0495634_0289931_34_765 238
465 3300046648 Ga0495611_0049441 Ga0495611_0049441_381_1112 238
466 3300046663 Ga0495635_0001999 Ga0495635_0001999_10079_10810 238
467 3300046663 Ga0495635_0009596 Ga0495635_0009596_3783_4514 238
468 3300046674 Ga0495588_0007284 Ga0495588_0007284_327_1058 238
469 3300046675 Ga0495657_0001200 Ga0495657_0001200_15940_16671 238
470 3300046678 Ga0495599_0004074 Ga0495599_0004074_1307_2038 238
471 3300046679 Ga0495623_0012871 Ga0495623_0012871_3997_4728 238
472 3300046680 Ga0495646_0040750 Ga0495646_0040750_1092_1823 238
473 3300046680 Ga0495646_0042675 Ga0495646_0042675_1560_2291 238
474 3300046689 Ga0495613_0028267 Ga0495613_0028267_3366_4097 238
475 3300046689 Ga0495613_0185899 Ga0495613_0185899_571_1302 238
476 3300046690 Ga0495624_0361859 Ga0495624_0361859_129_860 238
477 3300046692 Ga0495671_0000038 Ga0495671_0000038_108521_109252 238
478 3300046694 Ga0495649_0008912 Ga0495649_0008912_394_1125 238
479 3300046794 Ga0495589_0076439 Ga0495589_0076439_460_1191 238
480 3300046809 Ga0495600_0002291 Ga0495600_0002291_5667_6398 238
481 3300046809 Ga0495600_0275180 Ga0495600_0275180_200_931 238
482 3300047317 Ga0495604_0009383 Ga0495604_0009383_2538_3269 238
483 3300047317 Ga0495604_0111017 Ga0495604_0111017_86_817 238
484 3300047319 Ga0495674_0009389 Ga0495674_0009389_4598_5329 238
485 3300047321 Ga0495676_0084691 Ga0495676_0084691_420_1151 238
486 3300047322 Ga0495680_0007048 Ga0495680_0007048_5688_6419 238
487 3300047323 Ga0495683_0010864 Ga0495683_0010864_468_1199 238
488 3300047323 Ga0495683_0075570 Ga0495683_0075570_403_1134 238
489 3300047443 Ga0495687_016477 Ga0495687_016477_2165_2896 238
490 3300047443 Ga0495687_074941 Ga0495687_074941_329_1060 238
491 3300047444 Ga0495675_0001461 Ga0495675_0001461_3669_4400 238
492 3300047469 Ga0495673_0108149 Ga0495673_0108149_249_980 238
493 3300047469 Ga0495673_0115234 Ga0495673_0115234_61_792 238
494 3300047470 Ga0495681_0000953 Ga0495681_0000953_4883_5614 238
495 3300047472 Ga0495686_0254795 Ga0495686_0254795_121_852 238
496 3300047673 Ga0495593_0066345 Ga0495593_0066345_762_1493 238
497 3300047673 Ga0495593_0268923 Ga0495593_0268923_16_747 238
498 3300048088 Ga0495602_0016196 Ga0495602_0016196_2458_3189 238
499 3300048089 Ga0495614_0078427 Ga0495614_0078427_61_792 238
500 3300048904 Ga0496101_0063166 Ga0496101_0063166_1824_2555 238
501 3300048905 Ga0496102_0014553 Ga0496102_0014553_1365_2096 238
502 3300048905 Ga0496102_0631320 Ga0496102_0631320_25_756 238
503 3300048906 Ga0496103_0011719 Ga0496103_0011719_3301_4032 238
504 3300048907 Ga0496104_0021120 Ga0496104_0021120_1061_1792 238
505 3300048907 Ga0496104_0232302 Ga0496104_0232302_336_1067 238
506 3300048907 Ga0496104_0640432 Ga0496104_0640432_64_795 238
507 3300048908 Ga0496105_0001070 Ga0496105_0001070_11535_12266 238
508 3300048908 Ga0496105_0029552 Ga0496105_0029552_3194_3925 238
509 3300048910 Ga0496107_0125584 Ga0496107_0125584_292_1023 238
510 3300048910 Ga0496107_0420095 Ga0496107_0420095_130_861 238
511 3300048911 Ga0496108_0202228 Ga0496108_0202228_684_1415 238
512 3300048911 Ga0496108_0425246 Ga0496108_0425246_204_935 238
513 3300048912 Ga0496109_0083360 Ga0496109_0083360_316_1047 238
514 3300048913 Ga0496110_0079158 Ga0496110_0079158_29_760 238
515 3300048915 Ga0496112_0048480 Ga0496112_0048480_1459_2190 238
516 3300048916 Ga0496113_0061925 Ga0496113_0061925_956_1687 238
517 3300048917 Ga0496114_0594528 Ga0496114_0594528_112_843 238
518 3300048918 Ga0496115_0031252 Ga0496115_0031252_1902_2633 238
519 3300048919 Ga0496116_0022454 Ga0496116_0022454_3839_4570 238
520 3300048921 Ga0496118_0019810 Ga0496118_0019810_5117_5848 238
521 3300048921 Ga0496118_0023183 Ga0496118_0023183_2831_3562 238
522 3300048921 Ga0496118_0313882 Ga0496118_0313882_91_822 238
523 3300048922 Ga0496119_0011321 Ga0496119_0011321_6185_6916 238
524 3300048922 Ga0496119_0031381 Ga0496119_0031381_1990_2721 238
525 3300048922 Ga0496119_0151276 Ga0496119_0151276_363_1094 238
526 3300048924 Ga0496121_0000017 Ga0496121_0000017_314112_314834 238
527 3300048924 Ga0496121_0011514 Ga0496121_0011514_8837_9568 238
528 3300048924 Ga0496121_0035076 Ga0496121_0035076_123_854 238
529 3300048924 Ga0496121_0059460 Ga0496121_0059460_1595_2326 238
530 3300048924 Ga0496121_0063034 Ga0496121_0063034_1476_2207 238
531 3300048924 Ga0496121_0093883 Ga0496121_0093883_1230_1961 238
532 3300048924 Ga0496121_0166887 Ga0496121_0166887_655_1386 238
533 3300048924 Ga0496121_0276643 Ga0496121_0276643_86_817 238
534 3300048924 Ga0496121_0311517 Ga0496121_0311517_56_787 238
535 3300048924 Ga0496121_0365795 Ga0496121_0365795_80_811 238
536 3300048925 Ga0496122_0127770 Ga0496122_0127770_475_1206 238
537 3300048927 Ga0496124_0268464 Ga0496124_0268464_67_798 238
538 3300048928 Ga0496125_0004293 Ga0496125_0004293_2684_3415 238
539 3300048928 Ga0496125_0090717 Ga0496125_0090717_697_1428 238
540 3300048928 Ga0496125_0097804 Ga0496125_0097804_1361_2092 238
541 3300048929 Ga0496126_0034196 Ga0496126_0034196_1838_2569 238
542 3300048929 Ga0496126_0119292 Ga0496126_0119292_925_1656 238
543 3300049663 Ga0501223_000031 Ga0501223_000031_41298_42020 238
544 3300049705 Ga0501225_0006588 Ga0501225_0006588_1268_1990 238
545 3300050489 nmdc:mga03683_95844_c1 nmdc:mga03683_95844_c1_269_1000 238
546 3300050490 nmdc:mga03n38_130459_c1 nmdc:mga03n38_130459_c1_239_970 238
547 3300050491 nmdc:mga00v17_67343_c1 nmdc:mga00v17_67343_c1_462_1193 238
548 3300050492 nmdc:mga0yw44_35184_c1 nmdc:mga0yw44_35184_c1_438_1169 238
549 3300050493 nmdc:mga0k408_272726_c1 nmdc:mga0k408_272726_c1_111_842 238
550 3300050493 nmdc:mga0k408_4184_c1 nmdc:mga0k408_4184_c1_1036_1767 238
551 3300050494 nmdc:mga06z11_18525_c1 nmdc:mga06z11_18525_c1_1773_2504 238
552 3300050495 nmdc:mga04h51_16089_c1 nmdc:mga04h51_16089_c1_214_945 238
553 3300050496 nmdc:mga07m45_41409_c1 nmdc:mga07m45_41409_c1_1111_1842 238
554 3300050514 nmdc:mga08x19_103817_c1 nmdc:mga08x19_103817_c1_35_766 238
555 3300050516 nmdc:mga0sz30_34311_c2 nmdc:mga0sz30_34311_c2_19_750 238
556 3300053079 Ga0500610_0030564 Ga0500610_0030564_1115_1846 238
557 3300053080 Ga0500635_0000497 Ga0500635_0000497_2463_3194 238
558 3300053080 Ga0500635_0034923 Ga0500635_0034923_540_1271 238
559 3300053087 Ga0500643_000007 Ga0500643_000007_449962_450693 238
560 3300053088 Ga0500644_0141749 Ga0500644_0141749_75_806 238
561 3300053091 Ga0500647_0023075 Ga0500647_0023075_1671_2402 238
562 3300053092 Ga0500583_0070954 Ga0500583_0070954_754_1485 238
563 3300053093 Ga0500651_0054309 Ga0500651_0054309_716_1447 238
564 3300053094 Ga0500566_0000613 Ga0500566_0000613_6810_7541 238
565 3300053103 Ga0500555_003600 Ga0500555_003600_1554_2285 238
566 3300053105 Ga0500557_000009 Ga0500557_000009_78063_78794 238
567 3300053108 Ga0500562_009630 Ga0500562_009630_459_1190 238
568 3300053111 Ga0500572_036605 Ga0500572_036605_433_1164 238
569 3300053122 Ga0500608_057718 Ga0500608_057718_237_968 238
570 3300053125 Ga0500618_000755 Ga0500618_000755_4649_5371 238
571 3300053128 Ga0500626_044699 Ga0500626_044699_1019_1750 238
572 3300053130 Ga0500642_0000154 Ga0500642_0000154_2097_2828 238
573 3300053130 Ga0500642_0021161 Ga0500642_0021161_52_783 238
574 3300053134 Ga0500658_0030410 Ga0500658_0030410_1312_2043 238
575 3300053136 Ga0500559_0115931 Ga0500559_0115931_50_781 238
576 3300053142 Ga0500577_0020593 Ga0500577_0020593_1068_1799 238
577 3300053148 Ga0500590_123462 Ga0500590_123462_339_1070 238
578 3300053150 Ga0500603_000222 Ga0500603_000222_7558_8289 238
579 3300053151 Ga0500604_0009791 Ga0500604_0009791_839_1570 238
580 3300053177 Ga0500636_0000228 Ga0500636_0000228_16235_16966 238
581 3300053177 Ga0500636_0157597 Ga0500636_0157597_77_808 238
582 3300053178 Ga0500637_0000708 Ga0500637_0000708_372_1103 238
583 3300053178 Ga0500637_0083980 Ga0500637_0083980_702_1433 238
584 3300053723 Ga0500567_133659 Ga0500567_133659_109_840 238
585 3300053729 Ga0500625_000053 Ga0500625_000053_19620_20351 238
586 3300053730 Ga0500645_011994 Ga0500645_011994_726_1457 238
587 3300053737 Ga0500601_000488 Ga0500601_000488_373_1104 238
588 3300055283 Ga0500661_017617 Ga0500661_017617_236_967 238
589 iso_pu_bacteria 2834578030 2834579061 238
590 iso_pu_bacteria 2879163058 2879165910 238
591 3300006042 Ga0075368_10000747 Ga0075368_100007477 239
592 3300006178 Ga0075367_10001262 Ga0075367_100012623 239
593 3300006353 Ga0075370_10001829 Ga0075370_100018297 239
594 3300006946 Ga0079104_1003511 Ga0079104_10035113 239
595 3300009147 Ga0114129_10196764 Ga0114129_101967643 239
596 3300013297 Ga0157378_10057175 Ga0157378_100571754 239
597 3300027111 Ga0209281_1027858 Ga0209281_10278582 239
598 3300046452 Ga0495617_004580 Ga0495617_004580_2556_3284 239
599 3300046453 Ga0495627_013822 Ga0495627_013822_279_1007 239
600 3300046512 Ga0495610_0022825 Ga0495610_0022825_299_1027 239
601 3300046520 Ga0495637_0009667 Ga0495637_0009667_3791_4519 239
602 3300046558 Ga0495633_0100541 Ga0495633_0100541_261_989 239
603 3300047470 Ga0495681_0000050 Ga0495681_0000050_93433_94161 239
604 3300047472 Ga0495686_0000131 Ga0495686_0000131_63335_64054 239
605 3300048923 Ga0496120_0022344 Ga0496120_0022344_2996_3721 239
606 3300050490 nmdc:mga03n38_46090_c1 nmdc:mga03n38_46090_c1_310_1029 239
607 3300050494 nmdc:mga06z11_108_c1 nmdc:mga06z11_108_c1_12448_13167 239
608 3300050495 nmdc:mga04h51_11_c1 nmdc:mga04h51_11_c1_17351_18070 239
609 3300050496 nmdc:mga07m45_3791_c1 nmdc:mga07m45_3791_c1_2881_3600 239
610 3300050507 nmdc:mga05p37_167700_c1 nmdc:mga05p37_167700_c1_809_1537 239
611 3300053094 Ga0500566_0048519 Ga0500566_0048519_1092_1826 239
612 3300053102 Ga0500554_076941 Ga0500554_076941_21_755 239
613 3300053119 Ga0500595_000111 Ga0500595_000111_14645_15379 239
614 3300053125 Ga0500618_047674 Ga0500618_047674_30_755 239
615 3300053162 Ga0500638_000096 Ga0500638_000096_5801_6535 239
616 3300053178 Ga0500637_0001960 Ga0500637_0001960_1236_1970 239
617 3300055283 Ga0500661_000582 Ga0500661_000582_5524_6258 239
618 iso_pu_bacteria 2738541275 2738712229 239
619 iso_pu_bacteria 2738541301 2738850654 239
620 iso_pu_bacteria 2738541304 2738866383 239
621 iso_pu_bacteria 2738543022 2739298901 239
622 iso_pu_bacteria 2738543033 2739360579 239
623 3300007788 Ga0099795_10002064 Ga0099795_100020644 240
624 3300010159 Ga0099796_10011546 Ga0099796_100115463 240
625 3300013296 Ga0157374_10128458 Ga0157374_101284583 240
626 3300027866 Ga0209813_10000012 Ga0209813_1000001210 240
627 3300039062 Ga0400483_158578 Ga0400483_158578_442_1167 240
628 3300046501 Ga0495607_0035060 Ga0495607_0035060_650_1372 240
629 3300046524 Ga0495648_0032189 Ga0495648_0032189_566_1288 240
630 3300048924 Ga0496121_0001779 Ga0496121_0001779_12048_12785 240
631 3300049649 Ga0501198_033018 Ga0501198_033018_11_742 240
632 3300049668 Ga0501233_000027 Ga0501233_000027_14068_14799 240
633 3300049705 Ga0501225_0039660 Ga0501225_0039660_517_1248 240
634 3300009545 Ga0105237_10017465 Ga0105237_100174654 241
635 3300013105 Ga0157369_10593390 Ga0157369_105933902 241
636 3300025914 Ga0207671_10028984 Ga0207671_100289843 241
637 3300025981 Ga0207640_10629650 Ga0207640_106296501 241
638 3300031911 Ga0307412_10002798 Ga0307412_100027986 241
639 3300031911 Ga0307412_10067707 Ga0307412_100677073 241
640 3300045051 Ga0451576_0002808 Ga0451576_0002808_3022_3765 241
641 3300046460 Ga0495638_0000073 Ga0495638_0000073_96658_97407 241
642 3300046500 Ga0495596_0003376 Ga0495596_0003376_5952_6701 241
643 3300046506 Ga0495583_0000087 Ga0495583_0000087_96618_97352 241
644 3300046507 Ga0495606_0061205 Ga0495606_0061205_1147_1896 241
645 3300046512 Ga0495610_0000525 Ga0495610_0000525_20596_21330 241
646 3300046512 Ga0495610_0005333 Ga0495610_0005333_3731_4480 241
647 3300046513 Ga0495616_0012946 Ga0495616_0012946_1722_2456 241
648 3300046519 Ga0495632_0002653 Ga0495632_0002653_7908_8657 241
649 3300046522 Ga0495643_0000797 Ga0495643_0000797_22757_23491 241
650 3300046524 Ga0495648_0000049 Ga0495648_0000049_96658_97407 241
651 3300046558 Ga0495633_0206301 Ga0495633_0206301_157_882 241
652 3300046616 Ga0495668_0113866 Ga0495668_0113866_517_1266 241
653 3300046660 Ga0495625_0004416 Ga0495625_0004416_4940_5674 241
654 3300046692 Ga0495671_0000042 Ga0495671_0000042_96845_97579 241
655 3300047469 Ga0495673_0000111 Ga0495673_0000111_67623_68357 241
656 3300048090 Ga0495615_0000002 Ga0495615_0000002_96266_97000 241
657 3300048091 Ga0495626_0001710 Ga0495626_0001710_5965_6714 241
658 3300048919 Ga0496116_0000060 Ga0496116_0000060_61559_62284 241
659 3300048920 Ga0496117_0298983 Ga0496117_0298983_17_742 241
660 3300048925 Ga0496122_0001106 Ga0496122_0001106_7126_7851 241
661 3300048925 Ga0496122_0001656 Ga0496122_0001656_18694_19428 241
662 3300048925 Ga0496122_0078710 Ga0496122_0078710_492_1217 241
663 3300048926 Ga0496123_0000457 Ga0496123_0000457_47103_47828 241
664 3300048926 Ga0496123_0003614 Ga0496123_0003614_3524_4258 241
665 3300048926 Ga0496123_0005223 Ga0496123_0005223_4425_5150 241
666 3300048926 Ga0496123_0015170 Ga0496123_0015170_4905_5630 241
667 3300048926 Ga0496123_0048070 Ga0496123_0048070_1462_2187 241
668 3300048927 Ga0496124_0000204 Ga0496124_0000204_30490_31215 241
669 3300048927 Ga0496124_0002175 Ga0496124_0002175_10413_11138 241
670 3300048927 Ga0496124_0002877 Ga0496124_0002877_5769_6494 241
671 3300048927 Ga0496124_0010058 Ga0496124_0010058_2742_3467 241
672 3300048927 Ga0496124_0062229 Ga0496124_0062229_966_1700 241
673 3300048928 Ga0496125_0017253 Ga0496125_0017253_283_1008 241
674 3300048928 Ga0496125_0101131 Ga0496125_0101131_1017_1742 241
675 3300048928 Ga0496125_0109237 Ga0496125_0109237_523_1257 241
676 3300048928 Ga0496125_0116566 Ga0496125_0116566_597_1322 241
677 3300053087 Ga0500643_007226 Ga0500643_007226_1905_2630 241
678 3300053088 Ga0500644_0075920 Ga0500644_0075920_118_852 241
679 3300053148 Ga0500590_000889 Ga0500590_000889_9195_9920 241
680 3300053156 Ga0500622_0107920 Ga0500622_0107920_499_1224 241
681 3300053157 Ga0500624_000021 Ga0500624_000021_81711_82436 241
682 3300053157 Ga0500624_000221 Ga0500624_000221_14934_15659 241
683 3300053177 Ga0500636_0040378 Ga0500636_0040378_1829_2554 241
684 iso_pu_bacteria 2512564014 2512642192 241
685 iso_pu_bacteria 2818991438 2819552054 241
686 2162886007 SwRhRL2b_contig_891765 SwRhRL2b_0885.00003270 242
687 3300003791 Ga0055530_10024967 Ga0055530_100249672 242
688 3300005289 Ga0065704_10073969 Ga0065704_100739693 242
689 3300005347 Ga0070668_100012970 Ga0070668_1000129704 242
690 3300005353 Ga0070669_100000502 Ga0070669_10000050211 242
691 3300005355 Ga0070671_100002918 Ga0070671_10000291813 242
692 3300005367 Ga0070667_100113842 Ga0070667_1001138423 242
693 3300005539 Ga0068853_100001299 Ga0068853_10000129919 242
694 3300005548 Ga0070665_100018399 Ga0070665_1000183992 242
695 3300005578 Ga0068854_100155996 Ga0068854_1001559962 242
696 3300005841 Ga0068863_100516929 Ga0068863_1005169292 242
697 3300005843 Ga0068860_100081169 Ga0068860_1000811693 242
698 3300009011 Ga0105251_10098742 Ga0105251_100987422 242
699 3300009092 Ga0105250_10013981 Ga0105250_100139812 242
700 3300009177 Ga0105248_10097135 Ga0105248_100971352 242
701 3300009551 Ga0105238_10694460 Ga0105238_106944602 242
702 3300017792 Ga0163161_10005250 Ga0163161_100052508 242
703 3300025298 Ga0209050_1000299 Ga0209050_100029941 242
704 3300025711 Ga0207696_1015915 Ga0207696_10159153 242
705 3300025735 Ga0207713_1064293 Ga0207713_10642932 242
706 3300025923 Ga0207681_10000358 Ga0207681_1000035819 242
707 3300025924 Ga0207694_10276747 Ga0207694_102767472 242
708 3300025931 Ga0207644_10003443 Ga0207644_1000344311 242
709 3300025972 Ga0207668_10020385 Ga0207668_100203854 242
710 3300025981 Ga0207640_10506313 Ga0207640_105063132 242
711 3300025986 Ga0207658_10000972 Ga0207658_100009722 242
712 3300026041 Ga0207639_10003038 Ga0207639_100030388 242
713 3300026088 Ga0207641_10502767 Ga0207641_105027672 242
714 3300026116 Ga0207674_10114880 Ga0207674_101148802 242
715 3300028379 Ga0268266_10006810 Ga0268266_100068107 242
716 3300028380 Ga0268265_10045396 Ga0268265_100453962 242
717 3300028381 Ga0268264_10058148 Ga0268264_100581483 242
718 3300031911 Ga0307412_10264674 Ga0307412_102646742 242
719 3300045051 Ga0451576_0340093 Ga0451576_0340093_77_817 242
720 3300045051 Ga0451576_0438574 Ga0451576_0438574_248_994 242
721 3300046530 Ga0495654_0065893 Ga0495654_0065893_585_1331 242
722 3300047443 Ga0495687_083004 Ga0495687_083004_135_881 242
723 3300048904 Ga0496101_0386286 Ga0496101_0386286_225_953 242
724 3300048905 Ga0496102_0001289 Ga0496102_0001289_14493_15221 242
725 3300048906 Ga0496103_0000723 Ga0496103_0000723_92_820 242
726 3300048907 Ga0496104_0001038 Ga0496104_0001038_368_1096 242
727 3300048908 Ga0496105_0007451 Ga0496105_0007451_6220_6948 242
728 3300048913 Ga0496110_0241914 Ga0496110_0241914_831_1559 242
729 3300048915 Ga0496112_0005313 Ga0496112_0005313_5752_6480 242
730 3300048916 Ga0496113_0000519 Ga0496113_0000519_6201_6929 242
731 3300048919 Ga0496116_0166777 Ga0496116_0166777_117_845 242
732 3300048920 Ga0496117_0001164 Ga0496117_0001164_15214_15942 242
733 3300048921 Ga0496118_0070937 Ga0496118_0070937_26_754 242
734 3300048921 Ga0496118_0070938 Ga0496118_0070938_1758_2486 242
735 3300048922 Ga0496119_0003597 Ga0496119_0003597_9921_10649 242
736 3300048923 Ga0496120_0006689 Ga0496120_0006689_39_767 242
737 3300048924 Ga0496121_0043707 Ga0496121_0043707_1390_2118 242
738 3300048924 Ga0496121_0172987 Ga0496121_0172987_328_1056 242
739 3300048925 Ga0496122_0001302 Ga0496122_0001302_34961_35689 242
740 3300048926 Ga0496123_0001454 Ga0496123_0001454_26754_27482 242
741 3300048927 Ga0496124_0000988 Ga0496124_0000988_37892_38620 242
742 3300048927 Ga0496124_0007980 Ga0496124_0007980_5776_6513 242
743 3300048928 Ga0496125_0003958 Ga0496125_0003958_6693_7421 242
744 3300048929 Ga0496126_0000066 Ga0496126_0000066_18339_19067 242
745 3300053122 Ga0500608_000420 Ga0500608_000420_4240_4986 242
746 3300053133 Ga0500655_000008 Ga0500655_000008_37599_38345 242
747 3300053136 Ga0500559_0000335 Ga0500559_0000335_23387_24124 242
748 3300053136 Ga0500559_0003742 Ga0500559_0003742_4244_4990 242
749 3300053138 Ga0500564_004667 Ga0500564_004667_2284_3030 242
750 3300053140 Ga0500573_0059303 Ga0500573_0059303_872_1618 242
751 3300053723 Ga0500567_004223 Ga0500567_004223_3085_3831 242
752 3300053729 Ga0500625_000012 Ga0500625_000012_68912_69658 242
753 iso_pu_bacteria 2574179768 2574430754 242
754 iso_pu_bacteria 2928100450 2928102717 242
755 iso_pu_bacteria 2928959182 2928959198 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

26

242

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7786 4 135
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7668 4 135
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.671 4 134
7eyu-assembly1.cif.gz_A fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf-n65t mutant with andiconin d 0.6654 156 184
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.656 4 134
ID Description Score Start End Superfamily
af_P9WGB3_138_244_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9338 140 241 3.30.950.10
af_P9WGB3_5_136_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9153 5 136 3.40.1010.10
af_P9WGB3_5_136_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9087 5 136 3.40.1010.10
af_P9WGB3_138_244_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8838 140 241 3.30.950.10
af_Q58181_4_127_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8689 6 136 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A0X8X8X3-F1-model_v4 Cobalt-precorrin-2 C20-methyltransferase 0.9654 3 134 GO:0008168
GO:0009236
GO:0032259
AF-A0A529ZBY4-F1-model_v4 Precorrin-2 C(20)-methyltransferase (EC 2.1.1.130) 0.9619 162 237 GO:0009236
GO:0030788
GO:0032259
AF-A0A533IW23-F1-model_v4 deleted 0.9585 5 119
AF-A0A2S8NAY1-F1-model_v4 deleted 0.9558 152 231
AF-A0A4Q5SVS4-F1-model_v4 Precorrin-3B C(17)-methyltransferase (EC 2.1.1.131) 0.9553 140 242 GO:0009236
GO:0030789
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.64 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map