F479322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 755 | 530 | 521 | 241 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2574179768|2574430754 |
| Length | 262 |
| Sequence | SMPEASQPTFATVSDVLTPKPAGPGTVHGVGLGPGAADLLSVRADRLVRGARHVAYFRKAGRAGRARRIVDGMLREDVIEFAMEYPVTTEIALDDPRYNQQLSAFYASCIEHLHAITARGEDVVVLCEGDPFFYGSFMHLYSRLQGLVPVCVVPGITGMSGAWTVSGAPITWGDDTLTVLMATSSEEVLTRRIRDTDALVVMKVGRNLPKLRRAVAAAGREHEAWLVEYATMAEERVTRLVDVDKVTPYFSILLIHGQGRRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 23 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 24 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 29 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 30 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 31 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 32 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 35 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 36 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 37 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 40 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 41 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 42 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 43 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 44 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 45 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 46 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 47 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 48 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 49 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 50 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 51 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 52 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 53 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 54 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 55 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 56 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 57 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 58 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 59 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 60 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 61 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 62 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 63 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 64 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 65 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 66 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 67 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 68 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 69 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 70 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 71 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 72 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 73 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 74 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 75 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 76 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 77 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 78 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 79 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 80 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 81 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 82 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 83 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 84 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 85 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 86 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 90 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 91 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 92 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 93 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 94 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 95 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 96 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 97 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 98 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 99 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 100 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 101 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 102 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 103 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 104 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 105 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 106 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 107 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 108 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 109 | 2906610324 | |||
| 110 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 111 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 112 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 113 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 114 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 115 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 116 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 117 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 118 | 2922368715 | |||
| 119 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 120 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 121 | 2922425934 | |||
| 122 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 123 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 124 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 125 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 126 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 127 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 128 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 129 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 130 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 131 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 132 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 133 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 134 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 135 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 136 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 137 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 138 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 139 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 140 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 141 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 142 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 143 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 144 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 145 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 146 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 147 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 148 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 149 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 150 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 151 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 152 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 153 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 154 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 155 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 156 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 157 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 158 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 159 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 160 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 161 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 162 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 163 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 164 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 165 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 166 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 167 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 168 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 169 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 170 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 171 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 172 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 173 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 174 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 175 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 176 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 177 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 178 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 179 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 180 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 181 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 182 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 183 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 184 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 185 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 186 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 187 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 188 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 189 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 190 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 191 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 192 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 193 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 194 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 195 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 196 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 197 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 198 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 199 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 200 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 201 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 202 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 203 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 204 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 205 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 206 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 207 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 208 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 209 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 218 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 221 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 223 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 226 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 227 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 228 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 229 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 230 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 231 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 232 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 233 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 234 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 235 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 236 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 237 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 238 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 239 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 240 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 241 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 242 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 243 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 245 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 246 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 247 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 248 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 260 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 261 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 269 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 270 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 271 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 272 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 316 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 317 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 318 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 319 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 320 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 325 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 326 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 327 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 328 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 329 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 330 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 331 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 333 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 334 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 335 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 336 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 340 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 341 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 344 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 345 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 346 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 347 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 348 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 349 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 350 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 351 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 352 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 353 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 421 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 422 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 423 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 429 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 430 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 431 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 432 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 433 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 434 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 435 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 436 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 437 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 438 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 439 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 440 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 441 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 442 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 443 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 444 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 446 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 447 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 449 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 452 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 459 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 460 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 462 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 463 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 464 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 465 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 466 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 468 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 469 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 470 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 471 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 472 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 473 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 474 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 475 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 478 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 479 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 481 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 483 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 484 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 485 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 486 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 488 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 489 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 492 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 493 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 496 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 497 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 498 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 499 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 500 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 501 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 502 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 503 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 504 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 505 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 506 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 507 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 508 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 509 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 510 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 511 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 512 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 513 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 514 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 515 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 516 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 517 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 518 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 519 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 520 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 521 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 522 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 523 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 524 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 525 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 526 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 527 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 528 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 529 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 530 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.15 |
| Metatranscriptomes | 0.13 |
| Isolates | 30.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.66 |
| Bulb | 0 |
| Endosphere | 16.16 |
| Nodule | 21.72 |
| Rhizoplane | 4.64 |
| Rhizosphere | 38.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_891765 | 2162886007 | Bacteria | 4489 |
| 2 | JGI25153J46596_10000775 | 3300003215 | Bacteria | 19594 |
| 3 | JGI25153J46596_10001683 | 3300003215 | Bacteria | 13112 |
| 4 | JGI25153J46596_10015897 | 3300003215 | Bacteria | 3041 |
| 5 | JGI25160J50197_1000991 | 3300003354 | Bacteria | 14757 |
| 6 | JGI25160J50197_1008973 | 3300003354 | Bacteria | 3754 |
| 7 | JGI25160J50197_1029732 | 3300003354 | Bacteria | 1438 |
| 8 | Ga0055530_10024967 | 3300003791 | Bacteria | 1680 |
| 9 | Ga0055531_10007448 | 3300003794 | Bacteria | 5972 |
| 10 | Ga0065165_1000420 | 3300005262 | Bacteria | 66966 |
| 11 | Ga0065165_1000556 | 3300005262 | Bacteria | 55512 |
| 12 | Ga0065165_1002861 | 3300005262 | Bacteria | 13344 |
| 13 | Ga0065165_1018469 | 3300005262 | Bacteria | 2522 |
| 14 | Ga0065704_10073969 | 3300005289 | Bacteria | 6631 |
| 15 | Ga0065707_10182958 | 3300005295 | Bacteria | 1406 |
| 16 | Ga0070658_10129261 | 3300005327 | Bacteria | 2104 |
| 17 | Ga0070658_10291834 | 3300005327 | Bacteria | 1390 |
| 18 | Ga0070670_100043222 | 3300005331 | Bacteria | 3873 |
| 19 | Ga0070670_100158239 | 3300005331 | Bacteria | 1963 |
| 20 | Ga0070666_10232277 | 3300005335 | Bacteria | 1303 |
| 21 | Ga0070668_100000159 | 3300005347 | Bacteria | 42625 |
| 22 | Ga0070668_100012970 | 3300005347 | Bacteria | 6205 |
| 23 | Ga0070668_100042914 | 3300005347 | Bacteria | 3466 |
| 24 | Ga0070668_100060893 | 3300005347 | Bacteria | 2924 |
| 25 | Ga0070669_100000502 | 3300005353 | Bacteria | 29455 |
| 26 | Ga0070669_100008694 | 3300005353 | Bacteria | 7243 |
| 27 | Ga0070669_100047738 | 3300005353 | Bacteria | 3124 |
| 28 | Ga0070675_100421684 | 3300005354 | Bacteria | 1193 |
| 29 | Ga0070671_100002918 | 3300005355 | Bacteria | 13293 |
| 30 | Ga0070671_100039396 | 3300005355 | Bacteria | 3922 |
| 31 | Ga0070671_100072841 | 3300005355 | Bacteria | 2869 |
| 32 | Ga0070667_100000120 | 3300005367 | Bacteria | 99936 |
| 33 | Ga0070667_100113842 | 3300005367 | Bacteria | 2348 |
| 34 | Ga0070667_100333724 | 3300005367 | Bacteria | 1370 |
| 35 | Ga0070685_10413856 | 3300005466 | Bacteria | 936 |
| 36 | Ga0070706_100111923 | 3300005467 | Bacteria | 2541 |
| 37 | Ga0070698_100129760 | 3300005471 | Bacteria | 2477 |
| 38 | Ga0070679_100061959 | 3300005530 | Bacteria | 3728 |
| 39 | Ga0070697_100259244 | 3300005536 | Bacteria | 1488 |
| 40 | Ga0068853_100001299 | 3300005539 | Bacteria | 17940 |
| 41 | Ga0068853_100231198 | 3300005539 | Bacteria | 1692 |
| 42 | Ga0070686_100195545 | 3300005544 | Bacteria | 1446 |
| 43 | Ga0070665_100018399 | 3300005548 | Bacteria | 7002 |
| 44 | Ga0068854_100155996 | 3300005578 | Bacteria | 1764 |
| 45 | Ga0068856_100442332 | 3300005614 | Bacteria | 1320 |
| 46 | Ga0068856_100486051 | 3300005614 | Bacteria | 1256 |
| 47 | Ga0068859_100788986 | 3300005617 | Bacteria | 1038 |
| 48 | Ga0068863_100000053 | 3300005841 | Bacteria | 125195 |
| 49 | Ga0068863_100042120 | 3300005841 | Bacteria | 4339 |
| 50 | Ga0068863_100516929 | 3300005841 | Bacteria | 1177 |
| 51 | Ga0068860_100013340 | 3300005843 | Bacteria | 8057 |
| 52 | Ga0068860_100081169 | 3300005843 | Bacteria | 3084 |
| 53 | Ga0068862_100000778 | 3300005844 | Bacteria | 31642 |
| 54 | Ga0068862_100084813 | 3300005844 | Bacteria | 2752 |
| 55 | Ga0081540_1052167 | 3300005983 | Bacteria | 2016 |
| 56 | Ga0075365_10085543 | 3300006038 | Bacteria | 2142 |
| 57 | Ga0075365_10182055 | 3300006038 | Bacteria | 1469 |
| 58 | Ga0075368_10000747 | 3300006042 | Bacteria | 9970 |
| 59 | Ga0075363_100019180 | 3300006048 | Bacteria | 3416 |
| 60 | Ga0075364_10014814 | 3300006051 | Bacteria | 4824 |
| 61 | Ga0075364_10049523 | 3300006051 | Bacteria | 2741 |
| 62 | Ga0075362_10034352 | 3300006177 | Bacteria | 2210 |
| 63 | Ga0075367_10001262 | 3300006178 | Bacteria | 10667 |
| 64 | Ga0075367_10144121 | 3300006178 | Bacteria | 1476 |
| 65 | Ga0075369_10027581 | 3300006186 | Bacteria | 2375 |
| 66 | Ga0075369_10104048 | 3300006186 | Bacteria | 1275 |
| 67 | Ga0075366_10004909 | 3300006195 | Bacteria | 7216 |
| 68 | Ga0075366_10005300 | 3300006195 | Bacteria | 6984 |
| 69 | Ga0075370_10001829 | 3300006353 | Bacteria | 9519 |
| 70 | Ga0075370_10119996 | 3300006353 | Bacteria | 1530 |
| 71 | Ga0068871_100395503 | 3300006358 | Bacteria | 1230 |
| 72 | Ga0075436_100496761 | 3300006914 | Bacteria | 892 |
| 73 | Ga0097620_100789063 | 3300006931 | Bacteria | 1038 |
| 74 | Ga0099825_1042350 | 3300006941 | Bacteria | 1264 |
| 75 | Ga0099824_1005450 | 3300006942 | Bacteria | 17919 |
| 76 | Ga0079104_1003511 | 3300006946 | Bacteria | 7236 |
| 77 | Ga0099795_10002064 | 3300007788 | Bacteria | 4610 |
| 78 | Ga0105251_10098742 | 3300009011 | Bacteria | 1336 |
| 79 | Ga0105250_10013981 | 3300009092 | Bacteria | 3305 |
| 80 | Ga0105240_10208799 | 3300009093 | Bacteria | 2283 |
| 81 | Ga0105240_10396813 | 3300009093 | Bacteria | 1555 |
| 82 | Ga0105247_10005744 | 3300009101 | Bacteria | 7768 |
| 83 | Ga0105247_10109567 | 3300009101 | Bacteria | 1775 |
| 84 | Ga0114129_10196764 | 3300009147 | Bacteria | 2733 |
| 85 | Ga0105243_10578373 | 3300009148 | Bacteria | 1078 |
| 86 | Ga0105241_10060960 | 3300009174 | Bacteria | 2904 |
| 87 | Ga0105241_10073639 | 3300009174 | Bacteria | 2658 |
| 88 | Ga0105241_10112845 | 3300009174 | Bacteria | 2178 |
| 89 | Ga0105248_10050368 | 3300009177 | Bacteria | 4670 |
| 90 | Ga0105248_10050394 | 3300009177 | Bacteria | 4669 |
| 91 | Ga0105248_10097135 | 3300009177 | Bacteria | 3319 |
| 92 | Ga0105237_10010021 | 3300009545 | Bacteria | 10112 |
| 93 | Ga0105237_10017465 | 3300009545 | Bacteria | 7438 |
| 94 | Ga0105237_10030642 | 3300009545 | Bacteria | 5462 |
| 95 | Ga0105238_10284461 | 3300009551 | Bacteria | 1635 |
| 96 | Ga0105238_10694460 | 3300009551 | Bacteria | 1029 |
| 97 | Ga0105249_10000479 | 3300009553 | Bacteria | 37143 |
| 98 | Ga0105148_100042 | 3300009978 | Bacteria | 18795 |
| 99 | Ga0099796_10011546 | 3300010159 | Bacteria | 2467 |
| 100 | Ga0105239_10022158 | 3300010375 | Bacteria | 7001 |
| 101 | Ga0105239_10237764 | 3300010375 | Bacteria | 2044 |
| 102 | Ga0105239_11006962 | 3300010375 | Bacteria | 958 |
| 103 | Ga0157369_10593390 | 3300013105 | Bacteria | 1144 |
| 104 | Ga0157374_10128458 | 3300013296 | Bacteria | 2451 |
| 105 | Ga0157378_10057175 | 3300013297 | Bacteria | 3476 |
| 106 | Ga0163163_10073023 | 3300014325 | Bacteria | 3421 |
| 107 | Ga0157380_10225714 | 3300014326 | Bacteria | 1679 |
| 108 | Ga0163161_10005250 | 3300017792 | Bacteria | 9015 |
| 109 | Ga0163161_10576031 | 3300017792 | Bacteria | 925 |
| 110 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 111 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 112 | Ga0214542_1029915 | 3300021321 | Bacteria | 2177 |
| 113 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 114 | Ga0214545_1023811 | 3300021324 | Bacteria | 3931 |
| 115 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 116 | Ga0209563_104631 | 3300025230 | Bacteria | 2604 |
| 117 | Ga0207425_1016340 | 3300025245 | Bacteria | 1648 |
| 118 | Ga0209677_101151 | 3300025253 | Bacteria | 12289 |
| 119 | Ga0209233_1001516 | 3300025261 | Bacteria | 9113 |
| 120 | Ga0209233_1002707 | 3300025261 | Bacteria | 6398 |
| 121 | Ga0209233_1031659 | 3300025261 | Bacteria | 1232 |
| 122 | Ga0209455_1001114 | 3300025272 | Bacteria | 13145 |
| 123 | Ga0209673_1041055 | 3300025273 | Bacteria | 1318 |
| 124 | Ga0209564_1027978 | 3300025295 | Bacteria | 1815 |
| 125 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 126 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 127 | Ga0209758_1002049 | 3300025297 | Bacteria | 21606 |
| 128 | Ga0209758_1005922 | 3300025297 | Bacteria | 9090 |
| 129 | Ga0209758_1020096 | 3300025297 | Bacteria | 3179 |
| 130 | Ga0209758_1032747 | 3300025297 | Bacteria | 2103 |
| 131 | Ga0209050_1000299 | 3300025298 | Bacteria | 104017 |
| 132 | Ga0209256_1008038 | 3300025299 | Bacteria | 4997 |
| 133 | Ga0207426_1000120 | 3300025302 | Bacteria | 219117 |
| 134 | Ga0207426_1000673 | 3300025302 | Bacteria | 41533 |
| 135 | Ga0207426_1010122 | 3300025302 | Bacteria | 3683 |
| 136 | Ga0207426_1015033 | 3300025302 | Bacteria | 2822 |
| 137 | Ga0209257_1001327 | 3300025304 | Bacteria | 30091 |
| 138 | Ga0209257_1063088 | 3300025304 | Bacteria | 1000 |
| 139 | Ga0207696_1015915 | 3300025711 | Bacteria | 2532 |
| 140 | Ga0207713_1064293 | 3300025735 | Bacteria | 1382 |
| 141 | Ga0207710_10057690 | 3300025900 | Bacteria | 1754 |
| 142 | Ga0207710_10072977 | 3300025900 | Bacteria | 1577 |
| 143 | Ga0207688_10050140 | 3300025901 | Bacteria | 2336 |
| 144 | Ga0207680_10001161 | 3300025903 | Bacteria | 12411 |
| 145 | Ga0207647_10035303 | 3300025904 | Bacteria | 3187 |
| 146 | Ga0207705_10227936 | 3300025909 | Bacteria | 1416 |
| 147 | Ga0207684_10122127 | 3300025910 | Bacteria | 2233 |
| 148 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 149 | Ga0207671_10028984 | 3300025914 | Bacteria | 4135 |
| 150 | Ga0207671_10049564 | 3300025914 | Bacteria | 3109 |
| 151 | Ga0207671_10070742 | 3300025914 | Bacteria | 2602 |
| 152 | Ga0207652_10312493 | 3300025921 | Bacteria | 1418 |
| 153 | Ga0207646_10415611 | 3300025922 | Bacteria | 1214 |
| 154 | Ga0207681_10000358 | 3300025923 | Bacteria | 32494 |
| 155 | Ga0207681_10006344 | 3300025923 | Bacteria | 7259 |
| 156 | Ga0207681_10340062 | 3300025923 | Bacteria | 1199 |
| 157 | Ga0207694_10170272 | 3300025924 | Bacteria | 1763 |
| 158 | Ga0207694_10276747 | 3300025924 | Bacteria | 1378 |
| 159 | Ga0207650_10424246 | 3300025925 | Bacteria | 1104 |
| 160 | Ga0207644_10003443 | 3300025931 | Bacteria | 10228 |
| 161 | Ga0207644_10015682 | 3300025931 | Bacteria | 5091 |
| 162 | Ga0207706_10077856 | 3300025933 | Bacteria | 2916 |
| 163 | Ga0207711_10063926 | 3300025941 | Bacteria | 3178 |
| 164 | Ga0207711_10065464 | 3300025941 | Bacteria | 3142 |
| 165 | Ga0207689_10113725 | 3300025942 | Bacteria | 2225 |
| 166 | Ga0207667_10044360 | 3300025949 | Bacteria | 4712 |
| 167 | Ga0207667_10148553 | 3300025949 | Bacteria | 2412 |
| 168 | Ga0207667_10651660 | 3300025949 | Bacteria | 1059 |
| 169 | Ga0207712_10000405 | 3300025961 | Bacteria | 37152 |
| 170 | Ga0207668_10000027 | 3300025972 | Bacteria | 125575 |
| 171 | Ga0207668_10000119 | 3300025972 | Bacteria | 55547 |
| 172 | Ga0207668_10020385 | 3300025972 | Bacteria | 4211 |
| 173 | Ga0207640_10482574 | 3300025981 | Bacteria | 1028 |
| 174 | Ga0207640_10506313 | 3300025981 | Bacteria | 1006 |
| 175 | Ga0207640_10629650 | 3300025981 | Bacteria | 912 |
| 176 | Ga0207658_10000091 | 3300025986 | Bacteria | 99970 |
| 177 | Ga0207658_10000972 | 3300025986 | Bacteria | 23654 |
| 178 | Ga0207658_10303034 | 3300025986 | Bacteria | 1377 |
| 179 | Ga0207639_10003038 | 3300026041 | Bacteria | 11299 |
| 180 | Ga0207702_10222708 | 3300026078 | Bacteria | 1758 |
| 181 | Ga0207702_10378177 | 3300026078 | Bacteria | 1361 |
| 182 | Ga0207702_10383368 | 3300026078 | Bacteria | 1352 |
| 183 | Ga0207641_10000093 | 3300026088 | Bacteria | 125747 |
| 184 | Ga0207641_10027610 | 3300026088 | Bacteria | 4688 |
| 185 | Ga0207641_10502767 | 3300026088 | Bacteria | 1177 |
| 186 | Ga0207676_10571356 | 3300026095 | Bacteria | 1083 |
| 187 | Ga0207674_10114880 | 3300026116 | Bacteria | 2664 |
| 188 | Ga0207675_100288328 | 3300026118 | Bacteria | 1596 |
| 189 | Ga0207698_10720621 | 3300026142 | Bacteria | 994 |
| 190 | Ga0209281_1027858 | 3300027111 | Bacteria | 1031 |
| 191 | Ga0209389_1000010 | 3300027296 | Bacteria | 223892 |
| 192 | Ga0209389_1000149 | 3300027296 | Bacteria | 59631 |
| 193 | Ga0209589_1000016 | 3300027357 | Bacteria | 223788 |
| 194 | Ga0209489_100016 | 3300027361 | Bacteria | 223873 |
| 195 | Ga0209489_116912 | 3300027361 | Bacteria | 3617 |
| 196 | Ga0209489_116913 | 3300027361 | Bacteria | 3617 |
| 197 | Ga0209700_100030 | 3300027363 | Bacteria | 212982 |
| 198 | Ga0209813_10000012 | 3300027866 | Bacteria | 91374 |
| 199 | Ga0268266_10006810 | 3300028379 | Bacteria | 10409 |
| 200 | Ga0268265_10000633 | 3300028380 | Bacteria | 35043 |
| 201 | Ga0268265_10045396 | 3300028380 | Bacteria | 3278 |
| 202 | Ga0268265_10067570 | 3300028380 | Bacteria | 2768 |
| 203 | Ga0268265_10410731 | 3300028380 | Bacteria | 1254 |
| 204 | Ga0268264_10008606 | 3300028381 | Bacteria | 8479 |
| 205 | Ga0268264_10058148 | 3300028381 | Bacteria | 3237 |
| 206 | Ga0268264_10656444 | 3300028381 | Bacteria | 1038 |
| 207 | Ga0307515_10000626 | 3300028794 | Bacteria | 82165 |
| 208 | Ga0307513_10011751 | 3300031456 | Bacteria | 10858 |
| 209 | Ga0307514_10000861 | 3300031649 | Bacteria | 48344 |
| 210 | Ga0307405_10064861 | 3300031731 | Bacteria | 2323 |
| 211 | Ga0307406_10267878 | 3300031901 | Bacteria | 1296 |
| 212 | Ga0307412_10002798 | 3300031911 | Bacteria | 9692 |
| 213 | Ga0307412_10067707 | 3300031911 | Bacteria | 2425 |
| 214 | Ga0307412_10264674 | 3300031911 | Bacteria | 1342 |
| 215 | Ga0307510_10069078 | 3300033180 | Bacteria | 3541 |
| 216 | Ga0307510_10070985 | 3300033180 | Bacteria | 3473 |
| 217 | Ga0307510_10184609 | 3300033180 | Bacteria | 1643 |
| 218 | Ga0373937_0351190 | 3300036401 | Bacteria | 1397 |
| 219 | Ga0372808_004723 | 3300036459 | Bacteria | 1757 |
| 220 | Ga0373925_0533132 | 3300037068 | Bacteria | 965 |
| 221 | Ga0395905_0009332 | 3300037471 | Bacteria | 9596 |
| 222 | Ga0395905_0051815 | 3300037471 | Bacteria | 3844 |
| 223 | Ga0395901_0323940 | 3300038443 | Bacteria | 1594 |
| 224 | Ga0400483_054418 | 3300039062 | Bacteria | 2270 |
| 225 | Ga0400483_158578 | 3300039062 | Bacteria | 1435 |
| 226 | Ga0436365_1170893 | 3300039437 | Bacteria | 1189 |
| 227 | Ga0436361_0149759 | 3300039447 | Bacteria | 1692 |
| 228 | Ga0451793_1596515 | 3300041452 | Bacteria | 1250 |
| 229 | Ga0450911_000342 | 3300042115 | Bacteria | 16356 |
| 230 | Ga0466969_0004164 | 3300044656 | Bacteria | 7680 |
| 231 | Ga0466972_0000148 | 3300044658 | Bacteria | 57158 |
| 232 | Ga0466972_0003448 | 3300044658 | Bacteria | 7842 |
| 233 | Ga0466972_0089104 | 3300044658 | Bacteria | 1464 |
| 234 | Ga0466965_0078424 | 3300044683 | Bacteria | 1668 |
| 235 | Ga0466966_0012261 | 3300044684 | Bacteria | 5679 |
| 236 | Ga0466961_0000008 | 3300044693 | Bacteria | 142607 |
| 237 | Ga0466963_0064278 | 3300044694 | Bacteria | 2458 |
| 238 | Ga0466963_0114294 | 3300044694 | Bacteria | 1854 |
| 239 | Ga0466964_0042755 | 3300044706 | Bacteria | 1837 |
| 240 | Ga0466968_0038023 | 3300044735 | Bacteria | 2021 |
| 241 | Ga0466960_0016548 | 3300044901 | Bacteria | 3202 |
| 242 | Ga0466960_0051615 | 3300044901 | Bacteria | 1987 |
| 243 | Ga0466959_0012592 | 3300045049 | Bacteria | 6117 |
| 244 | Ga0451576_0002808 | 3300045051 | Bacteria | 25106 |
| 245 | Ga0451576_0340093 | 3300045051 | Bacteria | 1571 |
| 246 | Ga0451576_0438574 | 3300045051 | Bacteria | 1371 |
| 247 | Ga0466967_0334346 | 3300045976 | Bacteria | 1463 |
| 248 | Ga0495617_004580 | 3300046452 | Bacteria | 5007 |
| 249 | Ga0495627_013822 | 3300046453 | Bacteria | 2834 |
| 250 | Ga0495590_0014199 | 3300046457 | Bacteria | 2912 |
| 251 | Ga0495629_0059289 | 3300046459 | Bacteria | 2675 |
| 252 | Ga0495629_0133388 | 3300046459 | Bacteria | 1730 |
| 253 | Ga0495629_0232134 | 3300046459 | Bacteria | 1272 |
| 254 | Ga0495638_0000073 | 3300046460 | Bacteria | 164378 |
| 255 | Ga0495638_0002880 | 3300046460 | Bacteria | 13779 |
| 256 | Ga0495651_0001984 | 3300046462 | Bacteria | 15854 |
| 257 | Ga0495651_0029080 | 3300046462 | Bacteria | 4310 |
| 258 | Ga0495653_0019076 | 3300046463 | Bacteria | 5564 |
| 259 | Ga0495650_0001348 | 3300046471 | Bacteria | 24429 |
| 260 | Ga0495605_0051960 | 3300046474 | Bacteria | 1994 |
| 261 | Ga0495605_0059353 | 3300046474 | Bacteria | 1837 |
| 262 | Ga0495662_0050493 | 3300046476 | Bacteria | 2008 |
| 263 | Ga0495664_0004905 | 3300046477 | Bacteria | 7318 |
| 264 | Ga0495596_0003376 | 3300046500 | Bacteria | 8110 |
| 265 | Ga0495607_0035060 | 3300046501 | Bacteria | 3039 |
| 266 | Ga0495583_0000087 | 3300046506 | Bacteria | 164974 |
| 267 | Ga0495606_0055071 | 3300046507 | Bacteria | 2573 |
| 268 | Ga0495606_0061205 | 3300046507 | Bacteria | 2409 |
| 269 | Ga0495608_0010094 | 3300046511 | Bacteria | 6586 |
| 270 | Ga0495610_0000525 | 3300046512 | Bacteria | 38499 |
| 271 | Ga0495610_0005333 | 3300046512 | Bacteria | 9174 |
| 272 | Ga0495610_0022825 | 3300046512 | Bacteria | 3413 |
| 273 | Ga0495610_0080777 | 3300046512 | Bacteria | 1494 |
| 274 | Ga0495616_0012946 | 3300046513 | Bacteria | 4717 |
| 275 | Ga0495628_0011313 | 3300046516 | Bacteria | 7548 |
| 276 | Ga0495630_0596480 | 3300046517 | Bacteria | 847 |
| 277 | Ga0495632_0000049 | 3300046519 | Bacteria | 134597 |
| 278 | Ga0495632_0002653 | 3300046519 | Bacteria | 13424 |
| 279 | Ga0495632_0218751 | 3300046519 | Bacteria | 862 |
| 280 | Ga0495637_0009667 | 3300046520 | Bacteria | 4696 |
| 281 | Ga0495637_0014164 | 3300046520 | Bacteria | 3766 |
| 282 | Ga0495643_0000047 | 3300046522 | Bacteria | 217914 |
| 283 | Ga0495643_0000797 | 3300046522 | Bacteria | 34862 |
| 284 | Ga0495643_0020094 | 3300046522 | Bacteria | 3857 |
| 285 | Ga0495648_0000049 | 3300046524 | Bacteria | 164366 |
| 286 | Ga0495648_0013868 | 3300046524 | Bacteria | 5933 |
| 287 | Ga0495648_0017576 | 3300046524 | Bacteria | 5106 |
| 288 | Ga0495648_0032189 | 3300046524 | Bacteria | 3445 |
| 289 | Ga0495648_0154408 | 3300046524 | Bacteria | 1194 |
| 290 | Ga0495663_0000009 | 3300046525 | Bacteria | 256308 |
| 291 | Ga0495652_0010482 | 3300046529 | Bacteria | 8398 |
| 292 | Ga0495652_0035658 | 3300046529 | Bacteria | 4328 |
| 293 | Ga0495654_0065893 | 3300046530 | Bacteria | 1728 |
| 294 | Ga0495640_0016765 | 3300046533 | Bacteria | 5476 |
| 295 | Ga0495640_0049025 | 3300046533 | Bacteria | 2915 |
| 296 | Ga0495587_0004347 | 3300046536 | Bacteria | 9353 |
| 297 | Ga0495597_0004357 | 3300046542 | Bacteria | 7805 |
| 298 | Ga0495645_0001873 | 3300046543 | Bacteria | 14306 |
| 299 | Ga0495622_0074660 | 3300046557 | Bacteria | 1563 |
| 300 | Ga0495633_0000290 | 3300046558 | Bacteria | 57790 |
| 301 | Ga0495633_0000319 | 3300046558 | Bacteria | 54580 |
| 302 | Ga0495633_0100541 | 3300046558 | Bacteria | 1342 |
| 303 | Ga0495633_0206301 | 3300046558 | Bacteria | 901 |
| 304 | Ga0495667_0003300 | 3300046559 | Bacteria | 10818 |
| 305 | Ga0495668_0113866 | 3300046616 | Bacteria | 1479 |
| 306 | Ga0495634_0024720 | 3300046642 | Bacteria | 4211 |
| 307 | Ga0495634_0148798 | 3300046642 | Bacteria | 1482 |
| 308 | Ga0495634_0289931 | 3300046642 | Bacteria | 992 |
| 309 | Ga0495611_0049441 | 3300046648 | Bacteria | 1892 |
| 310 | Ga0495625_0004416 | 3300046660 | Bacteria | 13309 |
| 311 | Ga0495635_0001999 | 3300046663 | Bacteria | 13856 |
| 312 | Ga0495635_0009596 | 3300046663 | Bacteria | 6765 |
| 313 | Ga0495588_0007284 | 3300046674 | Bacteria | 5028 |
| 314 | Ga0495657_0001200 | 3300046675 | Bacteria | 22691 |
| 315 | Ga0495599_0004074 | 3300046678 | Bacteria | 8611 |
| 316 | Ga0495623_0012871 | 3300046679 | Bacteria | 5418 |
| 317 | Ga0495646_0040750 | 3300046680 | Bacteria | 2858 |
| 318 | Ga0495646_0042675 | 3300046680 | Bacteria | 2782 |
| 319 | Ga0495613_0028267 | 3300046689 | Bacteria | 4171 |
| 320 | Ga0495613_0185899 | 3300046689 | Bacteria | 1470 |
| 321 | Ga0495624_0361859 | 3300046690 | Bacteria | 872 |
| 322 | Ga0495671_0000038 | 3300046692 | Bacteria | 173693 |
| 323 | Ga0495671_0000042 | 3300046692 | Bacteria | 165201 |
| 324 | Ga0495649_0008912 | 3300046694 | Bacteria | 6004 |
| 325 | Ga0495589_0076439 | 3300046794 | Bacteria | 1633 |
| 326 | Ga0495600_0002291 | 3300046809 | Bacteria | 10909 |
| 327 | Ga0495600_0275180 | 3300046809 | Bacteria | 1067 |
| 328 | Ga0495604_0009383 | 3300047317 | Bacteria | 7739 |
| 329 | Ga0495604_0111017 | 3300047317 | Bacteria | 1999 |
| 330 | Ga0495674_0009389 | 3300047319 | Bacteria | 9296 |
| 331 | Ga0495676_0084691 | 3300047321 | Bacteria | 2391 |
| 332 | Ga0495680_0007048 | 3300047322 | Bacteria | 10359 |
| 333 | Ga0495683_0010864 | 3300047323 | Bacteria | 4802 |
| 334 | Ga0495683_0075570 | 3300047323 | Bacteria | 1650 |
| 335 | Ga0495687_016477 | 3300047443 | Bacteria | 3715 |
| 336 | Ga0495687_074941 | 3300047443 | Bacteria | 1344 |
| 337 | Ga0495687_083004 | 3300047443 | Bacteria | 1249 |
| 338 | Ga0495675_0001461 | 3300047444 | Bacteria | 14304 |
| 339 | Ga0495673_0000111 | 3300047469 | Bacteria | 164974 |
| 340 | Ga0495673_0108149 | 3300047469 | Bacteria | 1115 |
| 341 | Ga0495673_0115234 | 3300047469 | Bacteria | 1070 |
| 342 | Ga0495681_0000050 | 3300047470 | Bacteria | 109433 |
| 343 | Ga0495681_0000953 | 3300047470 | Bacteria | 22221 |
| 344 | Ga0495686_0000131 | 3300047472 | Bacteria | 152064 |
| 345 | Ga0495686_0254795 | 3300047472 | Bacteria | 985 |
| 346 | Ga0495593_0066345 | 3300047673 | Bacteria | 1881 |
| 347 | Ga0495593_0268923 | 3300047673 | Bacteria | 853 |
| 348 | Ga0495602_0016196 | 3300048088 | Bacteria | 7500 |
| 349 | Ga0495614_0078427 | 3300048089 | Bacteria | 1429 |
| 350 | Ga0495615_0000002 | 3300048090 | Bacteria | 167871 |
| 351 | Ga0495626_0001710 | 3300048091 | Bacteria | 16808 |
| 352 | Ga0496100_0331714 | 3300048903 | Bacteria | 1145 |
| 353 | Ga0496101_0063166 | 3300048904 | Bacteria | 2695 |
| 354 | Ga0496101_0386286 | 3300048904 | Bacteria | 1101 |
| 355 | Ga0496102_0001289 | 3300048905 | Bacteria | 22550 |
| 356 | Ga0496102_0014553 | 3300048905 | Bacteria | 6836 |
| 357 | Ga0496102_0631320 | 3300048905 | Bacteria | 994 |
| 358 | Ga0496103_0000723 | 3300048906 | Bacteria | 24417 |
| 359 | Ga0496103_0011719 | 3300048906 | Bacteria | 5201 |
| 360 | Ga0496104_0001038 | 3300048907 | Bacteria | 23748 |
| 361 | Ga0496104_0021120 | 3300048907 | Bacteria | 5973 |
| 362 | Ga0496104_0232302 | 3300048907 | Bacteria | 1756 |
| 363 | Ga0496104_0640432 | 3300048907 | Bacteria | 972 |
| 364 | Ga0496105_0001070 | 3300048908 | Bacteria | 18947 |
| 365 | Ga0496105_0007451 | 3300048908 | Bacteria | 8471 |
| 366 | Ga0496105_0029552 | 3300048908 | Bacteria | 4486 |
| 367 | Ga0496107_0125584 | 3300048910 | Bacteria | 1892 |
| 368 | Ga0496107_0420095 | 3300048910 | Bacteria | 994 |
| 369 | Ga0496108_0202228 | 3300048911 | Bacteria | 1724 |
| 370 | Ga0496108_0405095 | 3300048911 | Bacteria | 1191 |
| 371 | Ga0496108_0425246 | 3300048911 | Bacteria | 1160 |
| 372 | Ga0496109_0083360 | 3300048912 | Bacteria | 2948 |
| 373 | Ga0496110_0079158 | 3300048913 | Bacteria | 2926 |
| 374 | Ga0496110_0165804 | 3300048913 | Bacteria | 2003 |
| 375 | Ga0496110_0241914 | 3300048913 | Bacteria | 1642 |
| 376 | Ga0496112_0005313 | 3300048915 | Bacteria | 11115 |
| 377 | Ga0496112_0048480 | 3300048915 | Bacteria | 4164 |
| 378 | Ga0496113_0000519 | 3300048916 | Bacteria | 19033 |
| 379 | Ga0496113_0015207 | 3300048916 | Bacteria | 5281 |
| 380 | Ga0496113_0061925 | 3300048916 | Bacteria | 2824 |
| 381 | Ga0496114_0594528 | 3300048917 | Bacteria | 976 |
| 382 | Ga0496115_0031252 | 3300048918 | Bacteria | 4194 |
| 383 | Ga0496116_0000060 | 3300048919 | Bacteria | 272219 |
| 384 | Ga0496116_0022454 | 3300048919 | Bacteria | 4728 |
| 385 | Ga0496116_0166777 | 3300048919 | Bacteria | 1199 |
| 386 | Ga0496117_0001164 | 3300048920 | Bacteria | 39543 |
| 387 | Ga0496117_0298983 | 3300048920 | Bacteria | 853 |
| 388 | Ga0496118_0019810 | 3300048921 | Bacteria | 6000 |
| 389 | Ga0496118_0023183 | 3300048921 | Bacteria | 5400 |
| 390 | Ga0496118_0070937 | 3300048921 | Bacteria | 2511 |
| 391 | Ga0496118_0070938 | 3300048921 | Bacteria | 2511 |
| 392 | Ga0496118_0313882 | 3300048921 | Bacteria | 854 |
| 393 | Ga0496119_0003597 | 3300048922 | Bacteria | 15945 |
| 394 | Ga0496119_0011321 | 3300048922 | Bacteria | 7406 |
| 395 | Ga0496119_0031381 | 3300048922 | Bacteria | 3565 |
| 396 | Ga0496119_0151276 | 3300048922 | Bacteria | 1243 |
| 397 | Ga0496120_0006689 | 3300048923 | Bacteria | 8777 |
| 398 | Ga0496120_0022344 | 3300048923 | Bacteria | 3981 |
| 399 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 400 | Ga0496121_0001779 | 3300048924 | Bacteria | 34950 |
| 401 | Ga0496121_0011514 | 3300048924 | Bacteria | 9802 |
| 402 | Ga0496121_0035076 | 3300048924 | Bacteria | 4501 |
| 403 | Ga0496121_0043707 | 3300048924 | Bacteria | 3875 |
| 404 | Ga0496121_0059460 | 3300048924 | Bacteria | 3151 |
| 405 | Ga0496121_0063034 | 3300048924 | Bacteria | 3032 |
| 406 | Ga0496121_0093883 | 3300048924 | Bacteria | 2335 |
| 407 | Ga0496121_0166887 | 3300048924 | Bacteria | 1603 |
| 408 | Ga0496121_0172987 | 3300048924 | Bacteria | 1566 |
| 409 | Ga0496121_0276643 | 3300048924 | Bacteria | 1151 |
| 410 | Ga0496121_0311517 | 3300048924 | Bacteria | 1064 |
| 411 | Ga0496121_0365795 | 3300048924 | Bacteria | 956 |
| 412 | Ga0496122_0001106 | 3300048925 | Bacteria | 46592 |
| 413 | Ga0496122_0001302 | 3300048925 | Bacteria | 41169 |
| 414 | Ga0496122_0001656 | 3300048925 | Bacteria | 34600 |
| 415 | Ga0496122_0078710 | 3300048925 | Bacteria | 2308 |
| 416 | Ga0496122_0127770 | 3300048925 | Bacteria | 1623 |
| 417 | Ga0496123_0000457 | 3300048926 | Bacteria | 71921 |
| 418 | Ga0496123_0001454 | 3300048926 | Bacteria | 32962 |
| 419 | Ga0496123_0003614 | 3300048926 | Bacteria | 17136 |
| 420 | Ga0496123_0005223 | 3300048926 | Bacteria | 13192 |
| 421 | Ga0496123_0015170 | 3300048926 | Bacteria | 6338 |
| 422 | Ga0496123_0048070 | 3300048926 | Bacteria | 2874 |
| 423 | Ga0496124_0000204 | 3300048927 | Bacteria | 116976 |
| 424 | Ga0496124_0000988 | 3300048927 | Bacteria | 45089 |
| 425 | Ga0496124_0002175 | 3300048927 | Bacteria | 26179 |
| 426 | Ga0496124_0002877 | 3300048927 | Bacteria | 21757 |
| 427 | Ga0496124_0007980 | 3300048927 | Bacteria | 11142 |
| 428 | Ga0496124_0010058 | 3300048927 | Bacteria | 9649 |
| 429 | Ga0496124_0062229 | 3300048927 | Bacteria | 3124 |
| 430 | Ga0496124_0268464 | 3300048927 | Bacteria | 1251 |
| 431 | Ga0496125_0003958 | 3300048928 | Bacteria | 17459 |
| 432 | Ga0496125_0004293 | 3300048928 | Bacteria | 16548 |
| 433 | Ga0496125_0017253 | 3300048928 | Bacteria | 6896 |
| 434 | Ga0496125_0090717 | 3300048928 | Bacteria | 2292 |
| 435 | Ga0496125_0097804 | 3300048928 | Bacteria | 2173 |
| 436 | Ga0496125_0101131 | 3300048928 | Bacteria | 2123 |
| 437 | Ga0496125_0109237 | 3300048928 | Bacteria | 2009 |
| 438 | Ga0496125_0116566 | 3300048928 | Bacteria | 1918 |
| 439 | Ga0496126_0000066 | 3300048929 | Bacteria | 252188 |
| 440 | Ga0496126_0034196 | 3300048929 | Bacteria | 4775 |
| 441 | Ga0496126_0119292 | 3300048929 | Bacteria | 2289 |
| 442 | Ga0501198_033018 | 3300049649 | Bacteria | 871 |
| 443 | Ga0501223_000031 | 3300049663 | Bacteria | 51024 |
| 444 | Ga0501233_000027 | 3300049668 | Bacteria | 19963 |
| 445 | Ga0501225_0001726 | 3300049705 | Bacteria | 6842 |
| 446 | Ga0501225_0006588 | 3300049705 | Bacteria | 3389 |
| 447 | Ga0501225_0039660 | 3300049705 | Bacteria | 1298 |
| 448 | nmdc:mga03683_95844_c1 | 3300050489 | Bacteria | 1299 |
| 449 | nmdc:mga03n38_130459_c1 | 3300050490 | Bacteria | 1245 |
| 450 | nmdc:mga03n38_46090_c1 | 3300050490 | Bacteria | 1923 |
| 451 | nmdc:mga00v17_135649_c1 | 3300050491 | Bacteria | 1575 |
| 452 | nmdc:mga00v17_67343_c1 | 3300050491 | Bacteria | 2212 |
| 453 | nmdc:mga0yw44_35184_c1 | 3300050492 | Bacteria | 2941 |
| 454 | nmdc:mga0k408_272726_c1 | 3300050493 | Bacteria | 1010 |
| 455 | nmdc:mga0k408_4184_c1 | 3300050493 | Bacteria | 7658 |
| 456 | nmdc:mga06z11_108_c1 | 3300050494 | Bacteria | 33977 |
| 457 | nmdc:mga06z11_18525_c1 | 3300050494 | Bacteria | 3182 |
| 458 | nmdc:mga04h51_11_c1 | 3300050495 | Bacteria | 101578 |
| 459 | nmdc:mga04h51_16089_c1 | 3300050495 | Bacteria | 2167 |
| 460 | nmdc:mga07m45_3791_c1 | 3300050496 | Bacteria | 7316 |
| 461 | nmdc:mga07m45_41409_c1 | 3300050496 | Bacteria | 2580 |
| 462 | nmdc:mga05p37_167700_c1 | 3300050507 | Bacteria | 2679 |
| 463 | nmdc:mga08x19_103817_c1 | 3300050514 | Bacteria | 1888 |
| 464 | nmdc:mga0sz30_34311_c2 | 3300050516 | Bacteria | 827 |
| 465 | Ga0500610_0030564 | 3300053079 | Bacteria | 2731 |
| 466 | Ga0500635_0000497 | 3300053080 | Bacteria | 10901 |
| 467 | Ga0500635_0034923 | 3300053080 | Bacteria | 1650 |
| 468 | Ga0495595_0139141 | 3300053084 | Bacteria | 1190 |
| 469 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 470 | Ga0500643_007226 | 3300053087 | Bacteria | 4521 |
| 471 | Ga0500644_0075920 | 3300053088 | Bacteria | 1223 |
| 472 | Ga0500644_0141749 | 3300053088 | Bacteria | 956 |
| 473 | Ga0500647_0023075 | 3300053091 | Bacteria | 2916 |
| 474 | Ga0500583_0070954 | 3300053092 | Bacteria | 1665 |
| 475 | Ga0500651_0054309 | 3300053093 | Bacteria | 2511 |
| 476 | Ga0500566_0000613 | 3300053094 | Bacteria | 20005 |
| 477 | Ga0500566_0048519 | 3300053094 | Bacteria | 2434 |
| 478 | Ga0500641_0179247 | 3300053096 | Bacteria | 910 |
| 479 | Ga0500554_076941 | 3300053102 | Bacteria | 1094 |
| 480 | Ga0500555_003600 | 3300053103 | Bacteria | 4412 |
| 481 | Ga0500557_000009 | 3300053105 | Bacteria | 125806 |
| 482 | Ga0500562_009630 | 3300053108 | Bacteria | 2442 |
| 483 | Ga0500572_036605 | 3300053111 | Bacteria | 1402 |
| 484 | Ga0500595_000111 | 3300053119 | Bacteria | 55013 |
| 485 | Ga0500608_000420 | 3300053122 | Bacteria | 16146 |
| 486 | Ga0500608_057718 | 3300053122 | Bacteria | 1859 |
| 487 | Ga0500618_000755 | 3300053125 | Bacteria | 18296 |
| 488 | Ga0500618_047674 | 3300053125 | Bacteria | 974 |
| 489 | Ga0500626_044699 | 3300053128 | Bacteria | 1999 |
| 490 | Ga0500642_0000154 | 3300053130 | Bacteria | 28564 |
| 491 | Ga0500642_0021161 | 3300053130 | Bacteria | 2571 |
| 492 | Ga0500655_000008 | 3300053133 | Bacteria | 67575 |
| 493 | Ga0500658_0030410 | 3300053134 | Bacteria | 2106 |
| 494 | Ga0500559_0000335 | 3300053136 | Bacteria | 35252 |
| 495 | Ga0500559_0003742 | 3300053136 | Bacteria | 7393 |
| 496 | Ga0500559_0115931 | 3300053136 | Bacteria | 1243 |
| 497 | Ga0500564_004667 | 3300053138 | Bacteria | 5513 |
| 498 | Ga0500573_0059303 | 3300053140 | Bacteria | 2193 |
| 499 | Ga0500577_0020593 | 3300053142 | Bacteria | 2160 |
| 500 | Ga0500590_000889 | 3300053148 | Bacteria | 11325 |
| 501 | Ga0500590_123462 | 3300053148 | Bacteria | 1209 |
| 502 | Ga0500603_000222 | 3300053150 | Bacteria | 15001 |
| 503 | Ga0500604_0009791 | 3300053151 | Bacteria | 2555 |
| 504 | Ga0500622_0107920 | 3300053156 | Bacteria | 1363 |
| 505 | Ga0500624_000021 | 3300053157 | Bacteria | 117511 |
| 506 | Ga0500624_000221 | 3300053157 | Bacteria | 21108 |
| 507 | Ga0500638_000096 | 3300053162 | Bacteria | 16139 |
| 508 | Ga0500636_0000228 | 3300053177 | Bacteria | 30746 |
| 509 | Ga0500636_0040378 | 3300053177 | Bacteria | 2759 |
| 510 | Ga0500636_0157597 | 3300053177 | Bacteria | 1241 |
| 511 | Ga0500637_0000708 | 3300053178 | Bacteria | 13298 |
| 512 | Ga0500637_0001960 | 3300053178 | Bacteria | 8942 |
| 513 | Ga0500637_0083980 | 3300053178 | Bacteria | 1841 |
| 514 | Ga0500567_004223 | 3300053723 | Bacteria | 6519 |
| 515 | Ga0500567_133659 | 3300053723 | Bacteria | 965 |
| 516 | Ga0500625_000012 | 3300053729 | Bacteria | 127269 |
| 517 | Ga0500625_000053 | 3300053729 | Bacteria | 23355 |
| 518 | Ga0500645_011994 | 3300053730 | Bacteria | 2811 |
| 519 | Ga0500601_000488 | 3300053737 | Bacteria | 6175 |
| 520 | Ga0500661_000582 | 3300055283 | Bacteria | 6821 |
| 521 | Ga0500661_017617 | 3300055283 | Bacteria | 1275 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0051960 | Ga0495605_0051960_14_655 | 208 |
| 2 | iso_pu_bacteria | 8019678201 | 8019685142 | 210 |
| 3 | 3300048903 | Ga0496100_0331714 | Ga0496100_0331714_11_670 | 214 |
| 4 | iso_pu_bacteria | 2922386360 | 2922386623 | 218 |
| 5 | iso_pu_bacteria | 8016603502 | 8016609648 | 218 |
| 6 | iso_pu_bacteria | 8019530166 | 8019533967 | 218 |
| 7 | 3300038443 | Ga0395901_0323940 | Ga0395901_0323940_17_700 | 222 |
| 8 | 3300046642 | Ga0495634_0148798 | Ga0495634_0148798_789_1472 | 222 |
| 9 | 3300053084 | Ga0495595_0139141 | Ga0495595_0139141_467_1150 | 222 |
| 10 | 3300053096 | Ga0500641_0179247 | Ga0500641_0179247_213_896 | 222 |
| 11 | 3300039062 | Ga0400483_054418 | Ga0400483_054418_585_1259 | 223 |
| 12 | 3300046457 | Ga0495590_0014199 | Ga0495590_0014199_1617_2303 | 223 |
| 13 | 3300006051 | Ga0075364_10014814 | Ga0075364_100148143 | 227 |
| 14 | iso_pu_bacteria | 2898795034 | 2898798064 | 230 |
| 15 | iso_pu_bacteria | 2899259804 | 2899261409 | 232 |
| 16 | iso_pu_bacteria | 2507262055 | 2507507980 | 234 |
| 17 | iso_pu_bacteria | 2508501009 | 2508542087 | 234 |
| 18 | iso_pu_bacteria | 2508501042 | 2508692366 | 234 |
| 19 | iso_pu_bacteria | 2508501128 | 2509151082 | 234 |
| 20 | iso_pu_bacteria | 2511231028 | 2511397998 | 234 |
| 21 | iso_pu_bacteria | 2513237092 | 2513622573 | 234 |
| 22 | iso_pu_bacteria | 2513237094 | 2513639406 | 234 |
| 23 | iso_pu_bacteria | 2513237095 | 2513647191 | 234 |
| 24 | iso_pu_bacteria | 2513237096 | 2513653749 | 234 |
| 25 | iso_pu_bacteria | 2513237098 | 2513671731 | 234 |
| 26 | iso_pu_bacteria | 2513237137 | 2513856186 | 234 |
| 27 | iso_pu_bacteria | 2513237139 | 2513877607 | 234 |
| 28 | iso_pu_bacteria | 2513237145 | 2513918089 | 234 |
| 29 | iso_pu_bacteria | 2513237161 | 2514009752 | 234 |
| 30 | iso_pu_bacteria | 2515154112 | 2515626867 | 234 |
| 31 | iso_pu_bacteria | 2517572143 | 2517891673 | 234 |
| 32 | iso_pu_bacteria | 2524023205 | 2524442498 | 234 |
| 33 | iso_pu_bacteria | 2524023210 | 2524470176 | 234 |
| 34 | iso_pu_bacteria | 2528768022 | 2528850835 | 234 |
| 35 | iso_pu_bacteria | 2617270735 | 2617346476 | 234 |
| 36 | iso_pu_bacteria | 2617270741 | 2617378581 | 234 |
| 37 | iso_pu_bacteria | 2667528175 | 2671118556 | 234 |
| 38 | iso_pu_bacteria | 2744054633 | 2745075600 | 234 |
| 39 | iso_pu_bacteria | 2791355196 | 2793060791 | 234 |
| 40 | iso_pu_bacteria | 2791355197 | 2793067045 | 234 |
| 41 | iso_pu_bacteria | 2802429603 | 2805918383 | 234 |
| 42 | iso_pu_bacteria | 2816332527 | 2818236228 | 234 |
| 43 | iso_pu_bacteria | 2824600985 | 2824605319 | 234 |
| 44 | iso_pu_bacteria | 2824609381 | 2824615569 | 234 |
| 45 | iso_pu_bacteria | 2824617872 | 2824626462 | 234 |
| 46 | iso_pu_bacteria | 2824626560 | 2824634781 | 234 |
| 47 | iso_pu_bacteria | 2824635225 | 2824643738 | 234 |
| 48 | iso_pu_bacteria | 2824653114 | 2824656697 | 234 |
| 49 | iso_pu_bacteria | 2824661429 | 2824670625 | 234 |
| 50 | iso_pu_bacteria | 2824671348 | 2824678725 | 234 |
| 51 | iso_pu_bacteria | 2824679649 | 2824686920 | 234 |
| 52 | iso_pu_bacteria | 2824687955 | 2824696146 | 234 |
| 53 | iso_pu_bacteria | 2824696289 | 2824703496 | 234 |
| 54 | iso_pu_bacteria | 2824704595 | 2824714373 | 234 |
| 55 | iso_pu_bacteria | 2824714736 | 2824723582 | 234 |
| 56 | iso_pu_bacteria | 2824723954 | 2824732586 | 234 |
| 57 | iso_pu_bacteria | 2824732956 | 2824740392 | 234 |
| 58 | iso_pu_bacteria | 2824746037 | 2824752806 | 234 |
| 59 | iso_pu_bacteria | 2824753945 | 2824763329 | 234 |
| 60 | iso_pu_bacteria | 2824763712 | 2824773088 | 234 |
| 61 | iso_pu_bacteria | 2824773399 | 2824774736 | 234 |
| 62 | iso_pu_bacteria | 2838122688 | 2838122984 | 234 |
| 63 | iso_pu_bacteria | 2841941048 | 2841944731 | 234 |
| 64 | iso_pu_bacteria | 2841949485 | 2841955977 | 234 |
| 65 | iso_pu_bacteria | 2841957949 | 2841960029 | 234 |
| 66 | iso_pu_bacteria | 2841966195 | 2841969886 | 234 |
| 67 | iso_pu_bacteria | 2841974524 | 2841978684 | 234 |
| 68 | iso_pu_bacteria | 2841983080 | 2841984190 | 234 |
| 69 | iso_pu_bacteria | 2842038055 | 2842040331 | 234 |
| 70 | iso_pu_bacteria | 2842045827 | 2842046725 | 234 |
| 71 | iso_pu_bacteria | 2844315083 | 2844319697 | 234 |
| 72 | iso_pu_bacteria | 2847930680 | 2847937018 | 234 |
| 73 | iso_pu_bacteria | 2847939898 | 2847947418 | 234 |
| 74 | iso_pu_bacteria | 2849076700 | 2849078690 | 234 |
| 75 | iso_pu_bacteria | 2854681122 | 2854683475 | 234 |
| 76 | iso_pu_bacteria | 2857509624 | 2857513101 | 234 |
| 77 | iso_pu_bacteria | 2874590934 | 2874599073 | 234 |
| 78 | iso_pu_bacteria | 2874612657 | 2874617248 | 234 |
| 79 | iso_pu_bacteria | 2874620515 | 2874626618 | 234 |
| 80 | iso_pu_bacteria | 2874628541 | 2874635339 | 234 |
| 81 | iso_pu_bacteria | 2874645413 | 2874650482 | 234 |
| 82 | iso_pu_bacteria | 2876761206 | 2876764339 | 234 |
| 83 | iso_pu_bacteria | 2876771140 | 2876779112 | 234 |
| 84 | iso_pu_bacteria | 2876818435 | 2876822716 | 234 |
| 85 | iso_pu_bacteria | 2879074833 | 2879082905 | 234 |
| 86 | iso_pu_bacteria | 2879099564 | 2879106054 | 234 |
| 87 | iso_pu_bacteria | 2879127579 | 2879133030 | 234 |
| 88 | iso_pu_bacteria | 2879142872 | 2879149317 | 234 |
| 89 | iso_pu_bacteria | 2881364244 | 2881368111 | 234 |
| 90 | iso_pu_bacteria | 2881665667 | 2881667805 | 234 |
| 91 | iso_pu_bacteria | 2885366525 | 2885369585 | 234 |
| 92 | iso_pu_bacteria | 2885374607 | 2885381003 | 234 |
| 93 | iso_pu_bacteria | 2885383462 | 2885389128 | 234 |
| 94 | iso_pu_bacteria | 2885409591 | 2885414792 | 234 |
| 95 | iso_pu_bacteria | 2888378607 | 2888385118 | 234 |
| 96 | iso_pu_bacteria | 2888388044 | 2888393109 | 234 |
| 97 | iso_pu_bacteria | 2888419890 | 2888425265 | 234 |
| 98 | iso_pu_bacteria | 2891088606 | 2891089732 | 234 |
| 99 | iso_pu_bacteria | 2903727486 | 2903730622 | 234 |
| 100 | iso_pu_bacteria | 2903748898 | 2903755795 | 234 |
| 101 | iso_pu_bacteria | 2903768456 | 2903776259 | 234 |
| 102 | iso_pu_bacteria | 2904666416 | 2904671959 | 234 |
| 103 | iso_pu_bacteria | 2904711408 | 2904712317 | 234 |
| 104 | iso_pu_bacteria | 2906602504 | 2906609570 | 234 |
| 105 | iso_pu_bacteria | 2906610324 | 2906616846 | 234 |
| 106 | iso_pu_bacteria | 2906626472 | 2906628883 | 234 |
| 107 | iso_pu_bacteria | 2906635258 | 2906642887 | 234 |
| 108 | iso_pu_bacteria | 2906643746 | 2906649869 | 234 |
| 109 | iso_pu_bacteria | 2906660503 | 2906667177 | 234 |
| 110 | iso_pu_bacteria | 2908739725 | 2908742033 | 234 |
| 111 | iso_pu_bacteria | 2908775508 | 2908780825 | 234 |
| 112 | iso_pu_bacteria | 2922368715 | 2922372766 | 234 |
| 113 | iso_pu_bacteria | 2922393267 | 2922397410 | 234 |
| 114 | iso_pu_bacteria | 2922425934 | 2922431081 | 234 |
| 115 | iso_pu_bacteria | 2929615660 | 2929620588 | 234 |
| 116 | iso_pu_bacteria | 2929624759 | 2929626482 | 234 |
| 117 | iso_pu_bacteria | 2932784394 | 2932784651 | 234 |
| 118 | iso_pu_bacteria | 2932794094 | 2932795447 | 234 |
| 119 | iso_pu_bacteria | 2932801729 | 2932807959 | 234 |
| 120 | iso_pu_bacteria | 2932809354 | 2932809631 | 234 |
| 121 | iso_pu_bacteria | 2932818245 | 2932818626 | 234 |
| 122 | iso_pu_bacteria | 2932828146 | 2932828419 | 234 |
| 123 | iso_pu_bacteria | 2933577622 | 2933582505 | 234 |
| 124 | iso_pu_bacteria | 2935608549 | 2935609524 | 234 |
| 125 | iso_pu_bacteria | 2935616580 | 2935617392 | 234 |
| 126 | iso_pu_bacteria | 2935630451 | 2935636923 | 234 |
| 127 | iso_pu_bacteria | 2935638405 | 2935639126 | 234 |
| 128 | iso_pu_bacteria | 2935648319 | 2935652325 | 234 |
| 129 | iso_pu_bacteria | 2935656913 | 2935660907 | 234 |
| 130 | iso_pu_bacteria | 2935665750 | 2935666022 | 234 |
| 131 | iso_pu_bacteria | 2935675223 | 2935675670 | 234 |
| 132 | iso_pu_bacteria | 2935684952 | 2935685321 | 234 |
| 133 | iso_pu_bacteria | 2935694250 | 2935698570 | 234 |
| 134 | iso_pu_bacteria | 2935703347 | 2935704133 | 234 |
| 135 | iso_pu_bacteria | 2935713505 | 2935713874 | 234 |
| 136 | iso_pu_bacteria | 2935722832 | 2935724493 | 234 |
| 137 | iso_pu_bacteria | 2935732158 | 2935733149 | 234 |
| 138 | iso_pu_bacteria | 2935741537 | 2935742528 | 234 |
| 139 | iso_pu_bacteria | 2935750917 | 2935751286 | 234 |
| 140 | iso_pu_bacteria | 2935760218 | 2935765943 | 234 |
| 141 | iso_pu_bacteria | 2935769743 | 2935769924 | 234 |
| 142 | iso_pu_bacteria | 2935777560 | 2935782056 | 234 |
| 143 | iso_pu_bacteria | 2935785616 | 2935785834 | 234 |
| 144 | iso_pu_bacteria | 2935793552 | 2935794238 | 234 |
| 145 | iso_pu_bacteria | 2935801545 | 2935802216 | 234 |
| 146 | iso_pu_bacteria | 2935810662 | 2935811040 | 234 |
| 147 | iso_pu_bacteria | 2935819856 | 2935822686 | 234 |
| 148 | iso_pu_bacteria | 2935827899 | 2935828621 | 234 |
| 149 | iso_pu_bacteria | 2935837841 | 2935839997 | 234 |
| 150 | iso_pu_bacteria | 2935847175 | 2935848268 | 234 |
| 151 | iso_pu_bacteria | 2935855204 | 2935856017 | 234 |
| 152 | iso_pu_bacteria | 2935864058 | 2935866039 | 234 |
| 153 | iso_pu_bacteria | 2935873716 | 2935877636 | 234 |
| 154 | iso_pu_bacteria | 2935883170 | 2935883653 | 234 |
| 155 | iso_pu_bacteria | 2935908558 | 2935909929 | 234 |
| 156 | iso_pu_bacteria | 2935916978 | 2935917655 | 234 |
| 157 | iso_pu_bacteria | 2935926038 | 2935927409 | 234 |
| 158 | iso_pu_bacteria | 2935934488 | 2935936746 | 234 |
| 159 | iso_pu_bacteria | 2935942939 | 2935944951 | 234 |
| 160 | iso_pu_bacteria | 2935951376 | 2935953388 | 234 |
| 161 | iso_pu_bacteria | 2935959822 | 2935961119 | 234 |
| 162 | iso_pu_bacteria | 2935967501 | 2935970228 | 234 |
| 163 | iso_pu_bacteria | 2935975950 | 2935981049 | 234 |
| 164 | iso_pu_bacteria | 2935984226 | 2935986796 | 234 |
| 165 | iso_pu_bacteria | 2935992306 | 2935992580 | 234 |
| 166 | iso_pu_bacteria | 2936002035 | 2936002452 | 234 |
| 167 | iso_pu_bacteria | 2936011229 | 2936014963 | 234 |
| 168 | iso_pu_bacteria | 2936019824 | 2936022056 | 234 |
| 169 | iso_pu_bacteria | 2936028420 | 2936032744 | 234 |
| 170 | iso_pu_bacteria | 2936037263 | 2936037541 | 234 |
| 171 | iso_pu_bacteria | 2936046547 | 2936050704 | 234 |
| 172 | iso_pu_bacteria | 2936055302 | 2936059519 | 234 |
| 173 | iso_pu_bacteria | 2940556831 | 2940557912 | 234 |
| 174 | iso_pu_bacteria | 2941507105 | 2941513621 | 234 |
| 175 | iso_pu_bacteria | 2941515067 | 2941521523 | 234 |
| 176 | iso_pu_bacteria | 2941523033 | 2941529277 | 234 |
| 177 | iso_pu_bacteria | 2941531003 | 2941536755 | 234 |
| 178 | iso_pu_bacteria | 2941538514 | 2941540663 | 234 |
| 179 | iso_pu_bacteria | 3005483717 | 3005485071 | 234 |
| 180 | iso_pu_bacteria | 3005506211 | 3005507410 | 234 |
| 181 | iso_pu_bacteria | 3005594810 | 3005599925 | 234 |
| 182 | iso_pu_bacteria | 3005710791 | 3005715519 | 234 |
| 183 | iso_pu_bacteria | 3005718088 | 3005722855 | 234 |
| 184 | iso_pu_bacteria | 8006964411 | 8006970929 | 234 |
| 185 | iso_pu_bacteria | 8006994254 | 8006999336 | 234 |
| 186 | iso_pu_bacteria | 8016511872 | 8016521098 | 234 |
| 187 | iso_pu_bacteria | 8016522445 | 8016528994 | 234 |
| 188 | iso_pu_bacteria | 8016530956 | 8016534195 | 234 |
| 189 | iso_pu_bacteria | 8016548790 | 8016554716 | 234 |
| 190 | iso_pu_bacteria | 8016557553 | 8016563088 | 234 |
| 191 | iso_pu_bacteria | 8016566248 | 8016572537 | 234 |
| 192 | iso_pu_bacteria | 8016575299 | 8016576705 | 234 |
| 193 | iso_pu_bacteria | 8016583857 | 8016593789 | 234 |
| 194 | iso_pu_bacteria | 8016595262 | 8016600845 | 234 |
| 195 | iso_pu_bacteria | 8016613128 | 8016615280 | 234 |
| 196 | iso_pu_bacteria | 8016622563 | 8016625928 | 234 |
| 197 | iso_pu_bacteria | 8016630954 | 8016639510 | 234 |
| 198 | iso_pu_bacteria | 8017057580 | 8017064509 | 234 |
| 199 | iso_pu_bacteria | 8019538911 | 8019545704 | 234 |
| 200 | iso_pu_bacteria | 8019555841 | 8019565713 | 234 |
| 201 | iso_pu_bacteria | 8019565922 | 8019575804 | 234 |
| 202 | iso_pu_bacteria | 8019576017 | 8019583874 | 234 |
| 203 | iso_pu_bacteria | 8019586578 | 8019591685 | 234 |
| 204 | iso_pu_bacteria | 8019597564 | 8019599651 | 234 |
| 205 | iso_pu_bacteria | 8019619141 | 8019619485 | 234 |
| 206 | iso_pu_bacteria | 8019629233 | 8019633636 | 234 |
| 207 | iso_pu_bacteria | 8019638758 | 8019646269 | 234 |
| 208 | iso_pu_bacteria | 8019648815 | 8019649021 | 234 |
| 209 | iso_pu_bacteria | 8019659431 | 8019661514 | 234 |
| 210 | iso_pu_bacteria | 8019668869 | 8019671047 | 234 |
| 211 | iso_pu_bacteria | 8019687851 | 8019690735 | 234 |
| 212 | iso_pu_bacteria | 8055742211 | 8055745450 | 234 |
| 213 | iso_pu_bacteria | 8056967851 | 8056968712 | 234 |
| 214 | iso_pu_bacteria | 8057132660 | 8057133606 | 234 |
| 215 | iso_pu_bacteria | 2899275550 | 2899276857 | 235 |
| 216 | 3300005331 | Ga0070670_100043222 | Ga0070670_1000432222 | 236 |
| 217 | 3300005353 | Ga0070669_100047738 | Ga0070669_1000477382 | 236 |
| 218 | 3300005355 | Ga0070671_100072841 | Ga0070671_1000728413 | 236 |
| 219 | 3300005367 | Ga0070667_100333724 | Ga0070667_1003337242 | 236 |
| 220 | 3300005466 | Ga0070685_10413856 | Ga0070685_104138562 | 236 |
| 221 | 3300009978 | Ga0105148_100042 | Ga0105148_10004217 | 236 |
| 222 | 3300014326 | Ga0157380_10225714 | Ga0157380_102257142 | 236 |
| 223 | 3300017792 | Ga0163161_10576031 | Ga0163161_105760311 | 236 |
| 224 | 3300025986 | Ga0207658_10303034 | Ga0207658_103030342 | 236 |
| 225 | 3300048911 | Ga0496108_0405095 | Ga0496108_0405095_302_1018 | 236 |
| 226 | 3300048913 | Ga0496110_0165804 | Ga0496110_0165804_660_1376 | 236 |
| 227 | 3300048916 | Ga0496113_0015207 | Ga0496113_0015207_2165_2881 | 236 |
| 228 | 3300049705 | Ga0501225_0001726 | Ga0501225_0001726_5826_6542 | 236 |
| 229 | iso_pu_bacteria | 2919138771 | 2919140962 | 236 |
| 230 | 3300050491 | nmdc:mga00v17_135649_c1 | nmdc:mga00v17_135649_c1_571_1296 | 237 |
| 231 | iso_pu_bacteria | 2599185354 | 2600200274 | 237 |
| 232 | iso_pu_bacteria | 2599185359 | 2600226156 | 237 |
| 233 | iso_pu_bacteria | 2751185897 | 2753763949 | 237 |
| 234 | iso_pu_bacteria | 2818991466 | 2819712798 | 237 |
| 235 | iso_pu_bacteria | 2840878972 | 2840882981 | 237 |
| 236 | iso_pu_bacteria | 2919679072 | 2919682022 | 237 |
| 237 | iso_pu_bacteria | 2928027323 | 2928030439 | 237 |
| 238 | iso_pu_bacteria | 2928526807 | 2928527389 | 237 |
| 239 | iso_pu_bacteria | 2928968154 | 2928969125 | 237 |
| 240 | iso_pu_bacteria | 2946787523 | 2946788597 | 237 |
| 241 | iso_pu_bacteria | 2984555340 | 2984557366 | 237 |
| 242 | iso_pu_bacteria | 2984564862 | 2984568237 | 237 |
| 243 | iso_pu_bacteria | 2990265787 | 2990267978 | 237 |
| 244 | iso_pu_bacteria | 2993356040 | 2993359317 | 237 |
| 245 | iso_pu_bacteria | 2993693658 | 2993697003 | 237 |
| 246 | 3300003215 | JGI25153J46596_10000775 | JGI25153J46596_1000077514 | 238 |
| 247 | 3300003215 | JGI25153J46596_10001683 | JGI25153J46596_100016836 | 238 |
| 248 | 3300003215 | JGI25153J46596_10015897 | JGI25153J46596_100158974 | 238 |
| 249 | 3300003354 | JGI25160J50197_1000991 | JGI25160J50197_10009915 | 238 |
| 250 | 3300003354 | JGI25160J50197_1008973 | JGI25160J50197_10089735 | 238 |
| 251 | 3300003354 | JGI25160J50197_1029732 | JGI25160J50197_10297321 | 238 |
| 252 | 3300003794 | Ga0055531_10007448 | Ga0055531_100074482 | 238 |
| 253 | 3300005262 | Ga0065165_1000420 | Ga0065165_100042051 | 238 |
| 254 | 3300005262 | Ga0065165_1000556 | Ga0065165_100055642 | 238 |
| 255 | 3300005262 | Ga0065165_1002861 | Ga0065165_10028616 | 238 |
| 256 | 3300005262 | Ga0065165_1018469 | Ga0065165_10184693 | 238 |
| 257 | 3300005295 | Ga0065707_10182958 | Ga0065707_101829582 | 238 |
| 258 | 3300005327 | Ga0070658_10129261 | Ga0070658_101292612 | 238 |
| 259 | 3300005327 | Ga0070658_10291834 | Ga0070658_102918342 | 238 |
| 260 | 3300005331 | Ga0070670_100158239 | Ga0070670_1001582392 | 238 |
| 261 | 3300005335 | Ga0070666_10232277 | Ga0070666_102322771 | 238 |
| 262 | 3300005347 | Ga0070668_100000159 | Ga0070668_10000015919 | 238 |
| 263 | 3300005347 | Ga0070668_100042914 | Ga0070668_1000429144 | 238 |
| 264 | 3300005347 | Ga0070668_100060893 | Ga0070668_1000608932 | 238 |
| 265 | 3300005353 | Ga0070669_100008694 | Ga0070669_1000086945 | 238 |
| 266 | 3300005354 | Ga0070675_100421684 | Ga0070675_1004216842 | 238 |
| 267 | 3300005355 | Ga0070671_100039396 | Ga0070671_1000393962 | 238 |
| 268 | 3300005367 | Ga0070667_100000120 | Ga0070667_10000012035 | 238 |
| 269 | 3300005467 | Ga0070706_100111923 | Ga0070706_1001119233 | 238 |
| 270 | 3300005471 | Ga0070698_100129760 | Ga0070698_1001297603 | 238 |
| 271 | 3300005530 | Ga0070679_100061959 | Ga0070679_1000619592 | 238 |
| 272 | 3300005536 | Ga0070697_100259244 | Ga0070697_1002592441 | 238 |
| 273 | 3300005539 | Ga0068853_100231198 | Ga0068853_1002311982 | 238 |
| 274 | 3300005544 | Ga0070686_100195545 | Ga0070686_1001955452 | 238 |
| 275 | 3300005614 | Ga0068856_100442332 | Ga0068856_1004423321 | 238 |
| 276 | 3300005614 | Ga0068856_100486051 | Ga0068856_1004860511 | 238 |
| 277 | 3300005617 | Ga0068859_100788986 | Ga0068859_1007889862 | 238 |
| 278 | 3300005841 | Ga0068863_100000053 | Ga0068863_10000005336 | 238 |
| 279 | 3300005841 | Ga0068863_100042120 | Ga0068863_1000421205 | 238 |
| 280 | 3300005843 | Ga0068860_100013340 | Ga0068860_1000133404 | 238 |
| 281 | 3300005844 | Ga0068862_100000778 | Ga0068862_10000077822 | 238 |
| 282 | 3300005844 | Ga0068862_100084813 | Ga0068862_1000848133 | 238 |
| 283 | 3300005983 | Ga0081540_1052167 | Ga0081540_10521672 | 238 |
| 284 | 3300006038 | Ga0075365_10085543 | Ga0075365_100855433 | 238 |
| 285 | 3300006038 | Ga0075365_10182055 | Ga0075365_101820552 | 238 |
| 286 | 3300006048 | Ga0075363_100019180 | Ga0075363_1000191803 | 238 |
| 287 | 3300006051 | Ga0075364_10049523 | Ga0075364_100495232 | 238 |
| 288 | 3300006177 | Ga0075362_10034352 | Ga0075362_100343522 | 238 |
| 289 | 3300006178 | Ga0075367_10144121 | Ga0075367_101441212 | 238 |
| 290 | 3300006186 | Ga0075369_10027581 | Ga0075369_100275813 | 238 |
| 291 | 3300006186 | Ga0075369_10104048 | Ga0075369_101040481 | 238 |
| 292 | 3300006195 | Ga0075366_10004909 | Ga0075366_100049099 | 238 |
| 293 | 3300006195 | Ga0075366_10005300 | Ga0075366_100053004 | 238 |
| 294 | 3300006353 | Ga0075370_10119996 | Ga0075370_101199962 | 238 |
| 295 | 3300006358 | Ga0068871_100395503 | Ga0068871_1003955032 | 238 |
| 296 | 3300006914 | Ga0075436_100496761 | Ga0075436_1004967611 | 238 |
| 297 | 3300006931 | Ga0097620_100789063 | Ga0097620_1007890632 | 238 |
| 298 | 3300006941 | Ga0099825_1042350 | Ga0099825_10423502 | 238 |
| 299 | 3300006942 | Ga0099824_1005450 | Ga0099824_100545016 | 238 |
| 300 | 3300009093 | Ga0105240_10208799 | Ga0105240_102087991 | 238 |
| 301 | 3300009093 | Ga0105240_10396813 | Ga0105240_103968132 | 238 |
| 302 | 3300009101 | Ga0105247_10005744 | Ga0105247_100057446 | 238 |
| 303 | 3300009101 | Ga0105247_10109567 | Ga0105247_101095672 | 238 |
| 304 | 3300009148 | Ga0105243_10578373 | Ga0105243_105783731 | 238 |
| 305 | 3300009174 | Ga0105241_10060960 | Ga0105241_100609603 | 238 |
| 306 | 3300009174 | Ga0105241_10073639 | Ga0105241_100736393 | 238 |
| 307 | 3300009174 | Ga0105241_10112845 | Ga0105241_101128452 | 238 |
| 308 | 3300009177 | Ga0105248_10050368 | Ga0105248_100503683 | 238 |
| 309 | 3300009177 | Ga0105248_10050394 | Ga0105248_100503943 | 238 |
| 310 | 3300009545 | Ga0105237_10010021 | Ga0105237_1001002111 | 238 |
| 311 | 3300009545 | Ga0105237_10030642 | Ga0105237_100306424 | 238 |
| 312 | 3300009551 | Ga0105238_10284461 | Ga0105238_102844613 | 238 |
| 313 | 3300009553 | Ga0105249_10000479 | Ga0105249_1000047925 | 238 |
| 314 | 3300010375 | Ga0105239_10022158 | Ga0105239_100221583 | 238 |
| 315 | 3300010375 | Ga0105239_10237764 | Ga0105239_102377642 | 238 |
| 316 | 3300010375 | Ga0105239_11006962 | Ga0105239_110069621 | 238 |
| 317 | 3300014325 | Ga0163163_10073023 | Ga0163163_100730232 | 238 |
| 318 | 3300021320 | Ga0214544_1000004 | Ga0214544_1000004209 | 238 |
| 319 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001144 | 238 |
| 320 | 3300021321 | Ga0214542_1029915 | Ga0214542_10299153 | 238 |
| 321 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001211 | 238 |
| 322 | 3300021324 | Ga0214545_1023811 | Ga0214545_10238111 | 238 |
| 323 | 3300021327 | Ga0214543_1000006 | Ga0214543_1000006208 | 238 |
| 324 | 3300025230 | Ga0209563_104631 | Ga0209563_1046313 | 238 |
| 325 | 3300025245 | Ga0207425_1016340 | Ga0207425_10163403 | 238 |
| 326 | 3300025253 | Ga0209677_101151 | Ga0209677_1011519 | 238 |
| 327 | 3300025261 | Ga0209233_1001516 | Ga0209233_10015163 | 238 |
| 328 | 3300025261 | Ga0209233_1002707 | Ga0209233_10027075 | 238 |
| 329 | 3300025261 | Ga0209233_1031659 | Ga0209233_10316592 | 238 |
| 330 | 3300025272 | Ga0209455_1001114 | Ga0209455_10011146 | 238 |
| 331 | 3300025273 | Ga0209673_1041055 | Ga0209673_10410551 | 238 |
| 332 | 3300025295 | Ga0209564_1027978 | Ga0209564_10279783 | 238 |
| 333 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024537 | 238 |
| 334 | 3300025297 | Ga0209758_1000068 | Ga0209758_1000068309 | 238 |
| 335 | 3300025297 | Ga0209758_1002049 | Ga0209758_100204913 | 238 |
| 336 | 3300025297 | Ga0209758_1005922 | Ga0209758_10059228 | 238 |
| 337 | 3300025297 | Ga0209758_1020096 | Ga0209758_10200962 | 238 |
| 338 | 3300025297 | Ga0209758_1032747 | Ga0209758_10327472 | 238 |
| 339 | 3300025299 | Ga0209256_1008038 | Ga0209256_10080384 | 238 |
| 340 | 3300025302 | Ga0207426_1000120 | Ga0207426_100012043 | 238 |
| 341 | 3300025302 | Ga0207426_1000673 | Ga0207426_100067313 | 238 |
| 342 | 3300025302 | Ga0207426_1010122 | Ga0207426_10101222 | 238 |
| 343 | 3300025302 | Ga0207426_1015033 | Ga0207426_10150332 | 238 |
| 344 | 3300025304 | Ga0209257_1001327 | Ga0209257_100132718 | 238 |
| 345 | 3300025304 | Ga0209257_1063088 | Ga0209257_10630881 | 238 |
| 346 | 3300025900 | Ga0207710_10057690 | Ga0207710_100576902 | 238 |
| 347 | 3300025900 | Ga0207710_10072977 | Ga0207710_100729772 | 238 |
| 348 | 3300025901 | Ga0207688_10050140 | Ga0207688_100501403 | 238 |
| 349 | 3300025903 | Ga0207680_10001161 | Ga0207680_100011619 | 238 |
| 350 | 3300025904 | Ga0207647_10035303 | Ga0207647_100353033 | 238 |
| 351 | 3300025909 | Ga0207705_10227936 | Ga0207705_102279362 | 238 |
| 352 | 3300025910 | Ga0207684_10122127 | Ga0207684_101221272 | 238 |
| 353 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008491 | 238 |
| 354 | 3300025914 | Ga0207671_10049564 | Ga0207671_100495643 | 238 |
| 355 | 3300025914 | Ga0207671_10070742 | Ga0207671_100707423 | 238 |
| 356 | 3300025921 | Ga0207652_10312493 | Ga0207652_103124932 | 238 |
| 357 | 3300025922 | Ga0207646_10415611 | Ga0207646_104156111 | 238 |
| 358 | 3300025923 | Ga0207681_10006344 | Ga0207681_100063444 | 238 |
| 359 | 3300025923 | Ga0207681_10340062 | Ga0207681_103400622 | 238 |
| 360 | 3300025924 | Ga0207694_10170272 | Ga0207694_101702722 | 238 |
| 361 | 3300025925 | Ga0207650_10424246 | Ga0207650_104242462 | 238 |
| 362 | 3300025931 | Ga0207644_10015682 | Ga0207644_100156823 | 238 |
| 363 | 3300025933 | Ga0207706_10077856 | Ga0207706_100778563 | 238 |
| 364 | 3300025941 | Ga0207711_10063926 | Ga0207711_100639263 | 238 |
| 365 | 3300025941 | Ga0207711_10065464 | Ga0207711_100654643 | 238 |
| 366 | 3300025942 | Ga0207689_10113725 | Ga0207689_101137253 | 238 |
| 367 | 3300025949 | Ga0207667_10044360 | Ga0207667_100443602 | 238 |
| 368 | 3300025949 | Ga0207667_10148553 | Ga0207667_101485533 | 238 |
| 369 | 3300025949 | Ga0207667_10651660 | Ga0207667_106516602 | 238 |
| 370 | 3300025961 | Ga0207712_10000405 | Ga0207712_1000040525 | 238 |
| 371 | 3300025972 | Ga0207668_10000027 | Ga0207668_1000002736 | 238 |
| 372 | 3300025972 | Ga0207668_10000119 | Ga0207668_100001197 | 238 |
| 373 | 3300025981 | Ga0207640_10482574 | Ga0207640_104825742 | 238 |
| 374 | 3300025986 | Ga0207658_10000091 | Ga0207658_1000009135 | 238 |
| 375 | 3300026078 | Ga0207702_10222708 | Ga0207702_102227083 | 238 |
| 376 | 3300026078 | Ga0207702_10378177 | Ga0207702_103781772 | 238 |
| 377 | 3300026078 | Ga0207702_10383368 | Ga0207702_103833682 | 238 |
| 378 | 3300026088 | Ga0207641_10000093 | Ga0207641_1000009386 | 238 |
| 379 | 3300026088 | Ga0207641_10027610 | Ga0207641_100276105 | 238 |
| 380 | 3300026095 | Ga0207676_10571356 | Ga0207676_105713562 | 238 |
| 381 | 3300026118 | Ga0207675_100288328 | Ga0207675_1002883283 | 238 |
| 382 | 3300026142 | Ga0207698_10720621 | Ga0207698_107206212 | 238 |
| 383 | 3300027296 | Ga0209389_1000010 | Ga0209389_1000010116 | 238 |
| 384 | 3300027296 | Ga0209389_1000149 | Ga0209389_100014936 | 238 |
| 385 | 3300027357 | Ga0209589_1000016 | Ga0209589_100001698 | 238 |
| 386 | 3300027361 | Ga0209489_100016 | Ga0209489_100016116 | 238 |
| 387 | 3300027361 | Ga0209489_116912 | Ga0209489_1169122 | 238 |
| 388 | 3300027361 | Ga0209489_116913 | Ga0209489_1169132 | 238 |
| 389 | 3300027363 | Ga0209700_100030 | Ga0209700_100030180 | 238 |
| 390 | 3300028380 | Ga0268265_10000633 | Ga0268265_1000063313 | 238 |
| 391 | 3300028380 | Ga0268265_10067570 | Ga0268265_100675703 | 238 |
| 392 | 3300028380 | Ga0268265_10410731 | Ga0268265_104107312 | 238 |
| 393 | 3300028381 | Ga0268264_10008606 | Ga0268264_100086066 | 238 |
| 394 | 3300028381 | Ga0268264_10656444 | Ga0268264_106564442 | 238 |
| 395 | 3300028794 | Ga0307515_10000626 | Ga0307515_100006262 | 238 |
| 396 | 3300031456 | Ga0307513_10011751 | Ga0307513_100117517 | 238 |
| 397 | 3300031649 | Ga0307514_10000861 | Ga0307514_1000086128 | 238 |
| 398 | 3300031731 | Ga0307405_10064861 | Ga0307405_100648612 | 238 |
| 399 | 3300031901 | Ga0307406_10267878 | Ga0307406_102678782 | 238 |
| 400 | 3300033180 | Ga0307510_10069078 | Ga0307510_100690784 | 238 |
| 401 | 3300033180 | Ga0307510_10070985 | Ga0307510_100709852 | 238 |
| 402 | 3300033180 | Ga0307510_10184609 | Ga0307510_101846092 | 238 |
| 403 | 3300036401 | Ga0373937_0351190 | Ga0373937_0351190_13_744 | 238 |
| 404 | 3300036459 | Ga0372808_004723 | Ga0372808_004723_380_1111 | 238 |
| 405 | 3300037068 | Ga0373925_0533132 | Ga0373925_0533132_120_851 | 238 |
| 406 | 3300037471 | Ga0395905_0009332 | Ga0395905_0009332_3316_4047 | 238 |
| 407 | 3300037471 | Ga0395905_0051815 | Ga0395905_0051815_2762_3493 | 238 |
| 408 | 3300039437 | Ga0436365_1170893 | Ga0436365_1170893_352_1083 | 238 |
| 409 | 3300039447 | Ga0436361_0149759 | Ga0436361_0149759_217_948 | 238 |
| 410 | 3300041452 | Ga0451793_1596515 | Ga0451793_1596515_378_1109 | 238 |
| 411 | 3300042115 | Ga0450911_000342 | Ga0450911_000342_3212_3943 | 238 |
| 412 | 3300044656 | Ga0466969_0004164 | Ga0466969_0004164_5757_6488 | 238 |
| 413 | 3300044658 | Ga0466972_0000148 | Ga0466972_0000148_13448_14179 | 238 |
| 414 | 3300044658 | Ga0466972_0003448 | Ga0466972_0003448_897_1628 | 238 |
| 415 | 3300044658 | Ga0466972_0089104 | Ga0466972_0089104_516_1247 | 238 |
| 416 | 3300044683 | Ga0466965_0078424 | Ga0466965_0078424_198_929 | 238 |
| 417 | 3300044684 | Ga0466966_0012261 | Ga0466966_0012261_444_1175 | 238 |
| 418 | 3300044693 | Ga0466961_0000008 | Ga0466961_0000008_68374_69105 | 238 |
| 419 | 3300044694 | Ga0466963_0064278 | Ga0466963_0064278_1144_1875 | 238 |
| 420 | 3300044694 | Ga0466963_0114294 | Ga0466963_0114294_364_1095 | 238 |
| 421 | 3300044706 | Ga0466964_0042755 | Ga0466964_0042755_303_1034 | 238 |
| 422 | 3300044735 | Ga0466968_0038023 | Ga0466968_0038023_53_784 | 238 |
| 423 | 3300044901 | Ga0466960_0016548 | Ga0466960_0016548_1230_1961 | 238 |
| 424 | 3300044901 | Ga0466960_0051615 | Ga0466960_0051615_404_1135 | 238 |
| 425 | 3300045049 | Ga0466959_0012592 | Ga0466959_0012592_4710_5441 | 238 |
| 426 | 3300045976 | Ga0466967_0334346 | Ga0466967_0334346_507_1238 | 238 |
| 427 | 3300046459 | Ga0495629_0059289 | Ga0495629_0059289_1311_2042 | 238 |
| 428 | 3300046459 | Ga0495629_0133388 | Ga0495629_0133388_432_1163 | 238 |
| 429 | 3300046459 | Ga0495629_0232134 | Ga0495629_0232134_225_956 | 238 |
| 430 | 3300046460 | Ga0495638_0002880 | Ga0495638_0002880_9567_10298 | 238 |
| 431 | 3300046462 | Ga0495651_0001984 | Ga0495651_0001984_4481_5212 | 238 |
| 432 | 3300046462 | Ga0495651_0029080 | Ga0495651_0029080_1293_2024 | 238 |
| 433 | 3300046463 | Ga0495653_0019076 | Ga0495653_0019076_1831_2562 | 238 |
| 434 | 3300046471 | Ga0495650_0001348 | Ga0495650_0001348_20367_21089 | 238 |
| 435 | 3300046474 | Ga0495605_0059353 | Ga0495605_0059353_717_1448 | 238 |
| 436 | 3300046476 | Ga0495662_0050493 | Ga0495662_0050493_1227_1958 | 238 |
| 437 | 3300046477 | Ga0495664_0004905 | Ga0495664_0004905_562_1293 | 238 |
| 438 | 3300046507 | Ga0495606_0055071 | Ga0495606_0055071_1213_1944 | 238 |
| 439 | 3300046511 | Ga0495608_0010094 | Ga0495608_0010094_5447_6178 | 238 |
| 440 | 3300046512 | Ga0495610_0080777 | Ga0495610_0080777_262_993 | 238 |
| 441 | 3300046516 | Ga0495628_0011313 | Ga0495628_0011313_3940_4671 | 238 |
| 442 | 3300046517 | Ga0495630_0596480 | Ga0495630_0596480_13_744 | 238 |
| 443 | 3300046519 | Ga0495632_0000049 | Ga0495632_0000049_86177_86908 | 238 |
| 444 | 3300046519 | Ga0495632_0218751 | Ga0495632_0218751_114_845 | 238 |
| 445 | 3300046520 | Ga0495637_0014164 | Ga0495637_0014164_263_994 | 238 |
| 446 | 3300046522 | Ga0495643_0000047 | Ga0495643_0000047_64442_65173 | 238 |
| 447 | 3300046522 | Ga0495643_0020094 | Ga0495643_0020094_1553_2284 | 238 |
| 448 | 3300046524 | Ga0495648_0013868 | Ga0495648_0013868_4671_5402 | 238 |
| 449 | 3300046524 | Ga0495648_0017576 | Ga0495648_0017576_4172_4903 | 238 |
| 450 | 3300046524 | Ga0495648_0154408 | Ga0495648_0154408_36_767 | 238 |
| 451 | 3300046525 | Ga0495663_0000009 | Ga0495663_0000009_141817_142548 | 238 |
| 452 | 3300046529 | Ga0495652_0010482 | Ga0495652_0010482_2168_2899 | 238 |
| 453 | 3300046529 | Ga0495652_0035658 | Ga0495652_0035658_2410_3141 | 238 |
| 454 | 3300046533 | Ga0495640_0016765 | Ga0495640_0016765_2965_3696 | 238 |
| 455 | 3300046533 | Ga0495640_0049025 | Ga0495640_0049025_36_767 | 238 |
| 456 | 3300046536 | Ga0495587_0004347 | Ga0495587_0004347_957_1688 | 238 |
| 457 | 3300046542 | Ga0495597_0004357 | Ga0495597_0004357_4089_4820 | 238 |
| 458 | 3300046543 | Ga0495645_0001873 | Ga0495645_0001873_5177_5908 | 238 |
| 459 | 3300046557 | Ga0495622_0074660 | Ga0495622_0074660_213_944 | 238 |
| 460 | 3300046558 | Ga0495633_0000290 | Ga0495633_0000290_8461_9192 | 238 |
| 461 | 3300046558 | Ga0495633_0000319 | Ga0495633_0000319_31180_31911 | 238 |
| 462 | 3300046559 | Ga0495667_0003300 | Ga0495667_0003300_5447_6178 | 238 |
| 463 | 3300046642 | Ga0495634_0024720 | Ga0495634_0024720_1501_2232 | 238 |
| 464 | 3300046642 | Ga0495634_0289931 | Ga0495634_0289931_34_765 | 238 |
| 465 | 3300046648 | Ga0495611_0049441 | Ga0495611_0049441_381_1112 | 238 |
| 466 | 3300046663 | Ga0495635_0001999 | Ga0495635_0001999_10079_10810 | 238 |
| 467 | 3300046663 | Ga0495635_0009596 | Ga0495635_0009596_3783_4514 | 238 |
| 468 | 3300046674 | Ga0495588_0007284 | Ga0495588_0007284_327_1058 | 238 |
| 469 | 3300046675 | Ga0495657_0001200 | Ga0495657_0001200_15940_16671 | 238 |
| 470 | 3300046678 | Ga0495599_0004074 | Ga0495599_0004074_1307_2038 | 238 |
| 471 | 3300046679 | Ga0495623_0012871 | Ga0495623_0012871_3997_4728 | 238 |
| 472 | 3300046680 | Ga0495646_0040750 | Ga0495646_0040750_1092_1823 | 238 |
| 473 | 3300046680 | Ga0495646_0042675 | Ga0495646_0042675_1560_2291 | 238 |
| 474 | 3300046689 | Ga0495613_0028267 | Ga0495613_0028267_3366_4097 | 238 |
| 475 | 3300046689 | Ga0495613_0185899 | Ga0495613_0185899_571_1302 | 238 |
| 476 | 3300046690 | Ga0495624_0361859 | Ga0495624_0361859_129_860 | 238 |
| 477 | 3300046692 | Ga0495671_0000038 | Ga0495671_0000038_108521_109252 | 238 |
| 478 | 3300046694 | Ga0495649_0008912 | Ga0495649_0008912_394_1125 | 238 |
| 479 | 3300046794 | Ga0495589_0076439 | Ga0495589_0076439_460_1191 | 238 |
| 480 | 3300046809 | Ga0495600_0002291 | Ga0495600_0002291_5667_6398 | 238 |
| 481 | 3300046809 | Ga0495600_0275180 | Ga0495600_0275180_200_931 | 238 |
| 482 | 3300047317 | Ga0495604_0009383 | Ga0495604_0009383_2538_3269 | 238 |
| 483 | 3300047317 | Ga0495604_0111017 | Ga0495604_0111017_86_817 | 238 |
| 484 | 3300047319 | Ga0495674_0009389 | Ga0495674_0009389_4598_5329 | 238 |
| 485 | 3300047321 | Ga0495676_0084691 | Ga0495676_0084691_420_1151 | 238 |
| 486 | 3300047322 | Ga0495680_0007048 | Ga0495680_0007048_5688_6419 | 238 |
| 487 | 3300047323 | Ga0495683_0010864 | Ga0495683_0010864_468_1199 | 238 |
| 488 | 3300047323 | Ga0495683_0075570 | Ga0495683_0075570_403_1134 | 238 |
| 489 | 3300047443 | Ga0495687_016477 | Ga0495687_016477_2165_2896 | 238 |
| 490 | 3300047443 | Ga0495687_074941 | Ga0495687_074941_329_1060 | 238 |
| 491 | 3300047444 | Ga0495675_0001461 | Ga0495675_0001461_3669_4400 | 238 |
| 492 | 3300047469 | Ga0495673_0108149 | Ga0495673_0108149_249_980 | 238 |
| 493 | 3300047469 | Ga0495673_0115234 | Ga0495673_0115234_61_792 | 238 |
| 494 | 3300047470 | Ga0495681_0000953 | Ga0495681_0000953_4883_5614 | 238 |
| 495 | 3300047472 | Ga0495686_0254795 | Ga0495686_0254795_121_852 | 238 |
| 496 | 3300047673 | Ga0495593_0066345 | Ga0495593_0066345_762_1493 | 238 |
| 497 | 3300047673 | Ga0495593_0268923 | Ga0495593_0268923_16_747 | 238 |
| 498 | 3300048088 | Ga0495602_0016196 | Ga0495602_0016196_2458_3189 | 238 |
| 499 | 3300048089 | Ga0495614_0078427 | Ga0495614_0078427_61_792 | 238 |
| 500 | 3300048904 | Ga0496101_0063166 | Ga0496101_0063166_1824_2555 | 238 |
| 501 | 3300048905 | Ga0496102_0014553 | Ga0496102_0014553_1365_2096 | 238 |
| 502 | 3300048905 | Ga0496102_0631320 | Ga0496102_0631320_25_756 | 238 |
| 503 | 3300048906 | Ga0496103_0011719 | Ga0496103_0011719_3301_4032 | 238 |
| 504 | 3300048907 | Ga0496104_0021120 | Ga0496104_0021120_1061_1792 | 238 |
| 505 | 3300048907 | Ga0496104_0232302 | Ga0496104_0232302_336_1067 | 238 |
| 506 | 3300048907 | Ga0496104_0640432 | Ga0496104_0640432_64_795 | 238 |
| 507 | 3300048908 | Ga0496105_0001070 | Ga0496105_0001070_11535_12266 | 238 |
| 508 | 3300048908 | Ga0496105_0029552 | Ga0496105_0029552_3194_3925 | 238 |
| 509 | 3300048910 | Ga0496107_0125584 | Ga0496107_0125584_292_1023 | 238 |
| 510 | 3300048910 | Ga0496107_0420095 | Ga0496107_0420095_130_861 | 238 |
| 511 | 3300048911 | Ga0496108_0202228 | Ga0496108_0202228_684_1415 | 238 |
| 512 | 3300048911 | Ga0496108_0425246 | Ga0496108_0425246_204_935 | 238 |
| 513 | 3300048912 | Ga0496109_0083360 | Ga0496109_0083360_316_1047 | 238 |
| 514 | 3300048913 | Ga0496110_0079158 | Ga0496110_0079158_29_760 | 238 |
| 515 | 3300048915 | Ga0496112_0048480 | Ga0496112_0048480_1459_2190 | 238 |
| 516 | 3300048916 | Ga0496113_0061925 | Ga0496113_0061925_956_1687 | 238 |
| 517 | 3300048917 | Ga0496114_0594528 | Ga0496114_0594528_112_843 | 238 |
| 518 | 3300048918 | Ga0496115_0031252 | Ga0496115_0031252_1902_2633 | 238 |
| 519 | 3300048919 | Ga0496116_0022454 | Ga0496116_0022454_3839_4570 | 238 |
| 520 | 3300048921 | Ga0496118_0019810 | Ga0496118_0019810_5117_5848 | 238 |
| 521 | 3300048921 | Ga0496118_0023183 | Ga0496118_0023183_2831_3562 | 238 |
| 522 | 3300048921 | Ga0496118_0313882 | Ga0496118_0313882_91_822 | 238 |
| 523 | 3300048922 | Ga0496119_0011321 | Ga0496119_0011321_6185_6916 | 238 |
| 524 | 3300048922 | Ga0496119_0031381 | Ga0496119_0031381_1990_2721 | 238 |
| 525 | 3300048922 | Ga0496119_0151276 | Ga0496119_0151276_363_1094 | 238 |
| 526 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_314112_314834 | 238 |
| 527 | 3300048924 | Ga0496121_0011514 | Ga0496121_0011514_8837_9568 | 238 |
| 528 | 3300048924 | Ga0496121_0035076 | Ga0496121_0035076_123_854 | 238 |
| 529 | 3300048924 | Ga0496121_0059460 | Ga0496121_0059460_1595_2326 | 238 |
| 530 | 3300048924 | Ga0496121_0063034 | Ga0496121_0063034_1476_2207 | 238 |
| 531 | 3300048924 | Ga0496121_0093883 | Ga0496121_0093883_1230_1961 | 238 |
| 532 | 3300048924 | Ga0496121_0166887 | Ga0496121_0166887_655_1386 | 238 |
| 533 | 3300048924 | Ga0496121_0276643 | Ga0496121_0276643_86_817 | 238 |
| 534 | 3300048924 | Ga0496121_0311517 | Ga0496121_0311517_56_787 | 238 |
| 535 | 3300048924 | Ga0496121_0365795 | Ga0496121_0365795_80_811 | 238 |
| 536 | 3300048925 | Ga0496122_0127770 | Ga0496122_0127770_475_1206 | 238 |
| 537 | 3300048927 | Ga0496124_0268464 | Ga0496124_0268464_67_798 | 238 |
| 538 | 3300048928 | Ga0496125_0004293 | Ga0496125_0004293_2684_3415 | 238 |
| 539 | 3300048928 | Ga0496125_0090717 | Ga0496125_0090717_697_1428 | 238 |
| 540 | 3300048928 | Ga0496125_0097804 | Ga0496125_0097804_1361_2092 | 238 |
| 541 | 3300048929 | Ga0496126_0034196 | Ga0496126_0034196_1838_2569 | 238 |
| 542 | 3300048929 | Ga0496126_0119292 | Ga0496126_0119292_925_1656 | 238 |
| 543 | 3300049663 | Ga0501223_000031 | Ga0501223_000031_41298_42020 | 238 |
| 544 | 3300049705 | Ga0501225_0006588 | Ga0501225_0006588_1268_1990 | 238 |
| 545 | 3300050489 | nmdc:mga03683_95844_c1 | nmdc:mga03683_95844_c1_269_1000 | 238 |
| 546 | 3300050490 | nmdc:mga03n38_130459_c1 | nmdc:mga03n38_130459_c1_239_970 | 238 |
| 547 | 3300050491 | nmdc:mga00v17_67343_c1 | nmdc:mga00v17_67343_c1_462_1193 | 238 |
| 548 | 3300050492 | nmdc:mga0yw44_35184_c1 | nmdc:mga0yw44_35184_c1_438_1169 | 238 |
| 549 | 3300050493 | nmdc:mga0k408_272726_c1 | nmdc:mga0k408_272726_c1_111_842 | 238 |
| 550 | 3300050493 | nmdc:mga0k408_4184_c1 | nmdc:mga0k408_4184_c1_1036_1767 | 238 |
| 551 | 3300050494 | nmdc:mga06z11_18525_c1 | nmdc:mga06z11_18525_c1_1773_2504 | 238 |
| 552 | 3300050495 | nmdc:mga04h51_16089_c1 | nmdc:mga04h51_16089_c1_214_945 | 238 |
| 553 | 3300050496 | nmdc:mga07m45_41409_c1 | nmdc:mga07m45_41409_c1_1111_1842 | 238 |
| 554 | 3300050514 | nmdc:mga08x19_103817_c1 | nmdc:mga08x19_103817_c1_35_766 | 238 |
| 555 | 3300050516 | nmdc:mga0sz30_34311_c2 | nmdc:mga0sz30_34311_c2_19_750 | 238 |
| 556 | 3300053079 | Ga0500610_0030564 | Ga0500610_0030564_1115_1846 | 238 |
| 557 | 3300053080 | Ga0500635_0000497 | Ga0500635_0000497_2463_3194 | 238 |
| 558 | 3300053080 | Ga0500635_0034923 | Ga0500635_0034923_540_1271 | 238 |
| 559 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_449962_450693 | 238 |
| 560 | 3300053088 | Ga0500644_0141749 | Ga0500644_0141749_75_806 | 238 |
| 561 | 3300053091 | Ga0500647_0023075 | Ga0500647_0023075_1671_2402 | 238 |
| 562 | 3300053092 | Ga0500583_0070954 | Ga0500583_0070954_754_1485 | 238 |
| 563 | 3300053093 | Ga0500651_0054309 | Ga0500651_0054309_716_1447 | 238 |
| 564 | 3300053094 | Ga0500566_0000613 | Ga0500566_0000613_6810_7541 | 238 |
| 565 | 3300053103 | Ga0500555_003600 | Ga0500555_003600_1554_2285 | 238 |
| 566 | 3300053105 | Ga0500557_000009 | Ga0500557_000009_78063_78794 | 238 |
| 567 | 3300053108 | Ga0500562_009630 | Ga0500562_009630_459_1190 | 238 |
| 568 | 3300053111 | Ga0500572_036605 | Ga0500572_036605_433_1164 | 238 |
| 569 | 3300053122 | Ga0500608_057718 | Ga0500608_057718_237_968 | 238 |
| 570 | 3300053125 | Ga0500618_000755 | Ga0500618_000755_4649_5371 | 238 |
| 571 | 3300053128 | Ga0500626_044699 | Ga0500626_044699_1019_1750 | 238 |
| 572 | 3300053130 | Ga0500642_0000154 | Ga0500642_0000154_2097_2828 | 238 |
| 573 | 3300053130 | Ga0500642_0021161 | Ga0500642_0021161_52_783 | 238 |
| 574 | 3300053134 | Ga0500658_0030410 | Ga0500658_0030410_1312_2043 | 238 |
| 575 | 3300053136 | Ga0500559_0115931 | Ga0500559_0115931_50_781 | 238 |
| 576 | 3300053142 | Ga0500577_0020593 | Ga0500577_0020593_1068_1799 | 238 |
| 577 | 3300053148 | Ga0500590_123462 | Ga0500590_123462_339_1070 | 238 |
| 578 | 3300053150 | Ga0500603_000222 | Ga0500603_000222_7558_8289 | 238 |
| 579 | 3300053151 | Ga0500604_0009791 | Ga0500604_0009791_839_1570 | 238 |
| 580 | 3300053177 | Ga0500636_0000228 | Ga0500636_0000228_16235_16966 | 238 |
| 581 | 3300053177 | Ga0500636_0157597 | Ga0500636_0157597_77_808 | 238 |
| 582 | 3300053178 | Ga0500637_0000708 | Ga0500637_0000708_372_1103 | 238 |
| 583 | 3300053178 | Ga0500637_0083980 | Ga0500637_0083980_702_1433 | 238 |
| 584 | 3300053723 | Ga0500567_133659 | Ga0500567_133659_109_840 | 238 |
| 585 | 3300053729 | Ga0500625_000053 | Ga0500625_000053_19620_20351 | 238 |
| 586 | 3300053730 | Ga0500645_011994 | Ga0500645_011994_726_1457 | 238 |
| 587 | 3300053737 | Ga0500601_000488 | Ga0500601_000488_373_1104 | 238 |
| 588 | 3300055283 | Ga0500661_017617 | Ga0500661_017617_236_967 | 238 |
| 589 | iso_pu_bacteria | 2834578030 | 2834579061 | 238 |
| 590 | iso_pu_bacteria | 2879163058 | 2879165910 | 238 |
| 591 | 3300006042 | Ga0075368_10000747 | Ga0075368_100007477 | 239 |
| 592 | 3300006178 | Ga0075367_10001262 | Ga0075367_100012623 | 239 |
| 593 | 3300006353 | Ga0075370_10001829 | Ga0075370_100018297 | 239 |
| 594 | 3300006946 | Ga0079104_1003511 | Ga0079104_10035113 | 239 |
| 595 | 3300009147 | Ga0114129_10196764 | Ga0114129_101967643 | 239 |
| 596 | 3300013297 | Ga0157378_10057175 | Ga0157378_100571754 | 239 |
| 597 | 3300027111 | Ga0209281_1027858 | Ga0209281_10278582 | 239 |
| 598 | 3300046452 | Ga0495617_004580 | Ga0495617_004580_2556_3284 | 239 |
| 599 | 3300046453 | Ga0495627_013822 | Ga0495627_013822_279_1007 | 239 |
| 600 | 3300046512 | Ga0495610_0022825 | Ga0495610_0022825_299_1027 | 239 |
| 601 | 3300046520 | Ga0495637_0009667 | Ga0495637_0009667_3791_4519 | 239 |
| 602 | 3300046558 | Ga0495633_0100541 | Ga0495633_0100541_261_989 | 239 |
| 603 | 3300047470 | Ga0495681_0000050 | Ga0495681_0000050_93433_94161 | 239 |
| 604 | 3300047472 | Ga0495686_0000131 | Ga0495686_0000131_63335_64054 | 239 |
| 605 | 3300048923 | Ga0496120_0022344 | Ga0496120_0022344_2996_3721 | 239 |
| 606 | 3300050490 | nmdc:mga03n38_46090_c1 | nmdc:mga03n38_46090_c1_310_1029 | 239 |
| 607 | 3300050494 | nmdc:mga06z11_108_c1 | nmdc:mga06z11_108_c1_12448_13167 | 239 |
| 608 | 3300050495 | nmdc:mga04h51_11_c1 | nmdc:mga04h51_11_c1_17351_18070 | 239 |
| 609 | 3300050496 | nmdc:mga07m45_3791_c1 | nmdc:mga07m45_3791_c1_2881_3600 | 239 |
| 610 | 3300050507 | nmdc:mga05p37_167700_c1 | nmdc:mga05p37_167700_c1_809_1537 | 239 |
| 611 | 3300053094 | Ga0500566_0048519 | Ga0500566_0048519_1092_1826 | 239 |
| 612 | 3300053102 | Ga0500554_076941 | Ga0500554_076941_21_755 | 239 |
| 613 | 3300053119 | Ga0500595_000111 | Ga0500595_000111_14645_15379 | 239 |
| 614 | 3300053125 | Ga0500618_047674 | Ga0500618_047674_30_755 | 239 |
| 615 | 3300053162 | Ga0500638_000096 | Ga0500638_000096_5801_6535 | 239 |
| 616 | 3300053178 | Ga0500637_0001960 | Ga0500637_0001960_1236_1970 | 239 |
| 617 | 3300055283 | Ga0500661_000582 | Ga0500661_000582_5524_6258 | 239 |
| 618 | iso_pu_bacteria | 2738541275 | 2738712229 | 239 |
| 619 | iso_pu_bacteria | 2738541301 | 2738850654 | 239 |
| 620 | iso_pu_bacteria | 2738541304 | 2738866383 | 239 |
| 621 | iso_pu_bacteria | 2738543022 | 2739298901 | 239 |
| 622 | iso_pu_bacteria | 2738543033 | 2739360579 | 239 |
| 623 | 3300007788 | Ga0099795_10002064 | Ga0099795_100020644 | 240 |
| 624 | 3300010159 | Ga0099796_10011546 | Ga0099796_100115463 | 240 |
| 625 | 3300013296 | Ga0157374_10128458 | Ga0157374_101284583 | 240 |
| 626 | 3300027866 | Ga0209813_10000012 | Ga0209813_1000001210 | 240 |
| 627 | 3300039062 | Ga0400483_158578 | Ga0400483_158578_442_1167 | 240 |
| 628 | 3300046501 | Ga0495607_0035060 | Ga0495607_0035060_650_1372 | 240 |
| 629 | 3300046524 | Ga0495648_0032189 | Ga0495648_0032189_566_1288 | 240 |
| 630 | 3300048924 | Ga0496121_0001779 | Ga0496121_0001779_12048_12785 | 240 |
| 631 | 3300049649 | Ga0501198_033018 | Ga0501198_033018_11_742 | 240 |
| 632 | 3300049668 | Ga0501233_000027 | Ga0501233_000027_14068_14799 | 240 |
| 633 | 3300049705 | Ga0501225_0039660 | Ga0501225_0039660_517_1248 | 240 |
| 634 | 3300009545 | Ga0105237_10017465 | Ga0105237_100174654 | 241 |
| 635 | 3300013105 | Ga0157369_10593390 | Ga0157369_105933902 | 241 |
| 636 | 3300025914 | Ga0207671_10028984 | Ga0207671_100289843 | 241 |
| 637 | 3300025981 | Ga0207640_10629650 | Ga0207640_106296501 | 241 |
| 638 | 3300031911 | Ga0307412_10002798 | Ga0307412_100027986 | 241 |
| 639 | 3300031911 | Ga0307412_10067707 | Ga0307412_100677073 | 241 |
| 640 | 3300045051 | Ga0451576_0002808 | Ga0451576_0002808_3022_3765 | 241 |
| 641 | 3300046460 | Ga0495638_0000073 | Ga0495638_0000073_96658_97407 | 241 |
| 642 | 3300046500 | Ga0495596_0003376 | Ga0495596_0003376_5952_6701 | 241 |
| 643 | 3300046506 | Ga0495583_0000087 | Ga0495583_0000087_96618_97352 | 241 |
| 644 | 3300046507 | Ga0495606_0061205 | Ga0495606_0061205_1147_1896 | 241 |
| 645 | 3300046512 | Ga0495610_0000525 | Ga0495610_0000525_20596_21330 | 241 |
| 646 | 3300046512 | Ga0495610_0005333 | Ga0495610_0005333_3731_4480 | 241 |
| 647 | 3300046513 | Ga0495616_0012946 | Ga0495616_0012946_1722_2456 | 241 |
| 648 | 3300046519 | Ga0495632_0002653 | Ga0495632_0002653_7908_8657 | 241 |
| 649 | 3300046522 | Ga0495643_0000797 | Ga0495643_0000797_22757_23491 | 241 |
| 650 | 3300046524 | Ga0495648_0000049 | Ga0495648_0000049_96658_97407 | 241 |
| 651 | 3300046558 | Ga0495633_0206301 | Ga0495633_0206301_157_882 | 241 |
| 652 | 3300046616 | Ga0495668_0113866 | Ga0495668_0113866_517_1266 | 241 |
| 653 | 3300046660 | Ga0495625_0004416 | Ga0495625_0004416_4940_5674 | 241 |
| 654 | 3300046692 | Ga0495671_0000042 | Ga0495671_0000042_96845_97579 | 241 |
| 655 | 3300047469 | Ga0495673_0000111 | Ga0495673_0000111_67623_68357 | 241 |
| 656 | 3300048090 | Ga0495615_0000002 | Ga0495615_0000002_96266_97000 | 241 |
| 657 | 3300048091 | Ga0495626_0001710 | Ga0495626_0001710_5965_6714 | 241 |
| 658 | 3300048919 | Ga0496116_0000060 | Ga0496116_0000060_61559_62284 | 241 |
| 659 | 3300048920 | Ga0496117_0298983 | Ga0496117_0298983_17_742 | 241 |
| 660 | 3300048925 | Ga0496122_0001106 | Ga0496122_0001106_7126_7851 | 241 |
| 661 | 3300048925 | Ga0496122_0001656 | Ga0496122_0001656_18694_19428 | 241 |
| 662 | 3300048925 | Ga0496122_0078710 | Ga0496122_0078710_492_1217 | 241 |
| 663 | 3300048926 | Ga0496123_0000457 | Ga0496123_0000457_47103_47828 | 241 |
| 664 | 3300048926 | Ga0496123_0003614 | Ga0496123_0003614_3524_4258 | 241 |
| 665 | 3300048926 | Ga0496123_0005223 | Ga0496123_0005223_4425_5150 | 241 |
| 666 | 3300048926 | Ga0496123_0015170 | Ga0496123_0015170_4905_5630 | 241 |
| 667 | 3300048926 | Ga0496123_0048070 | Ga0496123_0048070_1462_2187 | 241 |
| 668 | 3300048927 | Ga0496124_0000204 | Ga0496124_0000204_30490_31215 | 241 |
| 669 | 3300048927 | Ga0496124_0002175 | Ga0496124_0002175_10413_11138 | 241 |
| 670 | 3300048927 | Ga0496124_0002877 | Ga0496124_0002877_5769_6494 | 241 |
| 671 | 3300048927 | Ga0496124_0010058 | Ga0496124_0010058_2742_3467 | 241 |
| 672 | 3300048927 | Ga0496124_0062229 | Ga0496124_0062229_966_1700 | 241 |
| 673 | 3300048928 | Ga0496125_0017253 | Ga0496125_0017253_283_1008 | 241 |
| 674 | 3300048928 | Ga0496125_0101131 | Ga0496125_0101131_1017_1742 | 241 |
| 675 | 3300048928 | Ga0496125_0109237 | Ga0496125_0109237_523_1257 | 241 |
| 676 | 3300048928 | Ga0496125_0116566 | Ga0496125_0116566_597_1322 | 241 |
| 677 | 3300053087 | Ga0500643_007226 | Ga0500643_007226_1905_2630 | 241 |
| 678 | 3300053088 | Ga0500644_0075920 | Ga0500644_0075920_118_852 | 241 |
| 679 | 3300053148 | Ga0500590_000889 | Ga0500590_000889_9195_9920 | 241 |
| 680 | 3300053156 | Ga0500622_0107920 | Ga0500622_0107920_499_1224 | 241 |
| 681 | 3300053157 | Ga0500624_000021 | Ga0500624_000021_81711_82436 | 241 |
| 682 | 3300053157 | Ga0500624_000221 | Ga0500624_000221_14934_15659 | 241 |
| 683 | 3300053177 | Ga0500636_0040378 | Ga0500636_0040378_1829_2554 | 241 |
| 684 | iso_pu_bacteria | 2512564014 | 2512642192 | 241 |
| 685 | iso_pu_bacteria | 2818991438 | 2819552054 | 241 |
| 686 | 2162886007 | SwRhRL2b_contig_891765 | SwRhRL2b_0885.00003270 | 242 |
| 687 | 3300003791 | Ga0055530_10024967 | Ga0055530_100249672 | 242 |
| 688 | 3300005289 | Ga0065704_10073969 | Ga0065704_100739693 | 242 |
| 689 | 3300005347 | Ga0070668_100012970 | Ga0070668_1000129704 | 242 |
| 690 | 3300005353 | Ga0070669_100000502 | Ga0070669_10000050211 | 242 |
| 691 | 3300005355 | Ga0070671_100002918 | Ga0070671_10000291813 | 242 |
| 692 | 3300005367 | Ga0070667_100113842 | Ga0070667_1001138423 | 242 |
| 693 | 3300005539 | Ga0068853_100001299 | Ga0068853_10000129919 | 242 |
| 694 | 3300005548 | Ga0070665_100018399 | Ga0070665_1000183992 | 242 |
| 695 | 3300005578 | Ga0068854_100155996 | Ga0068854_1001559962 | 242 |
| 696 | 3300005841 | Ga0068863_100516929 | Ga0068863_1005169292 | 242 |
| 697 | 3300005843 | Ga0068860_100081169 | Ga0068860_1000811693 | 242 |
| 698 | 3300009011 | Ga0105251_10098742 | Ga0105251_100987422 | 242 |
| 699 | 3300009092 | Ga0105250_10013981 | Ga0105250_100139812 | 242 |
| 700 | 3300009177 | Ga0105248_10097135 | Ga0105248_100971352 | 242 |
| 701 | 3300009551 | Ga0105238_10694460 | Ga0105238_106944602 | 242 |
| 702 | 3300017792 | Ga0163161_10005250 | Ga0163161_100052508 | 242 |
| 703 | 3300025298 | Ga0209050_1000299 | Ga0209050_100029941 | 242 |
| 704 | 3300025711 | Ga0207696_1015915 | Ga0207696_10159153 | 242 |
| 705 | 3300025735 | Ga0207713_1064293 | Ga0207713_10642932 | 242 |
| 706 | 3300025923 | Ga0207681_10000358 | Ga0207681_1000035819 | 242 |
| 707 | 3300025924 | Ga0207694_10276747 | Ga0207694_102767472 | 242 |
| 708 | 3300025931 | Ga0207644_10003443 | Ga0207644_1000344311 | 242 |
| 709 | 3300025972 | Ga0207668_10020385 | Ga0207668_100203854 | 242 |
| 710 | 3300025981 | Ga0207640_10506313 | Ga0207640_105063132 | 242 |
| 711 | 3300025986 | Ga0207658_10000972 | Ga0207658_100009722 | 242 |
| 712 | 3300026041 | Ga0207639_10003038 | Ga0207639_100030388 | 242 |
| 713 | 3300026088 | Ga0207641_10502767 | Ga0207641_105027672 | 242 |
| 714 | 3300026116 | Ga0207674_10114880 | Ga0207674_101148802 | 242 |
| 715 | 3300028379 | Ga0268266_10006810 | Ga0268266_100068107 | 242 |
| 716 | 3300028380 | Ga0268265_10045396 | Ga0268265_100453962 | 242 |
| 717 | 3300028381 | Ga0268264_10058148 | Ga0268264_100581483 | 242 |
| 718 | 3300031911 | Ga0307412_10264674 | Ga0307412_102646742 | 242 |
| 719 | 3300045051 | Ga0451576_0340093 | Ga0451576_0340093_77_817 | 242 |
| 720 | 3300045051 | Ga0451576_0438574 | Ga0451576_0438574_248_994 | 242 |
| 721 | 3300046530 | Ga0495654_0065893 | Ga0495654_0065893_585_1331 | 242 |
| 722 | 3300047443 | Ga0495687_083004 | Ga0495687_083004_135_881 | 242 |
| 723 | 3300048904 | Ga0496101_0386286 | Ga0496101_0386286_225_953 | 242 |
| 724 | 3300048905 | Ga0496102_0001289 | Ga0496102_0001289_14493_15221 | 242 |
| 725 | 3300048906 | Ga0496103_0000723 | Ga0496103_0000723_92_820 | 242 |
| 726 | 3300048907 | Ga0496104_0001038 | Ga0496104_0001038_368_1096 | 242 |
| 727 | 3300048908 | Ga0496105_0007451 | Ga0496105_0007451_6220_6948 | 242 |
| 728 | 3300048913 | Ga0496110_0241914 | Ga0496110_0241914_831_1559 | 242 |
| 729 | 3300048915 | Ga0496112_0005313 | Ga0496112_0005313_5752_6480 | 242 |
| 730 | 3300048916 | Ga0496113_0000519 | Ga0496113_0000519_6201_6929 | 242 |
| 731 | 3300048919 | Ga0496116_0166777 | Ga0496116_0166777_117_845 | 242 |
| 732 | 3300048920 | Ga0496117_0001164 | Ga0496117_0001164_15214_15942 | 242 |
| 733 | 3300048921 | Ga0496118_0070937 | Ga0496118_0070937_26_754 | 242 |
| 734 | 3300048921 | Ga0496118_0070938 | Ga0496118_0070938_1758_2486 | 242 |
| 735 | 3300048922 | Ga0496119_0003597 | Ga0496119_0003597_9921_10649 | 242 |
| 736 | 3300048923 | Ga0496120_0006689 | Ga0496120_0006689_39_767 | 242 |
| 737 | 3300048924 | Ga0496121_0043707 | Ga0496121_0043707_1390_2118 | 242 |
| 738 | 3300048924 | Ga0496121_0172987 | Ga0496121_0172987_328_1056 | 242 |
| 739 | 3300048925 | Ga0496122_0001302 | Ga0496122_0001302_34961_35689 | 242 |
| 740 | 3300048926 | Ga0496123_0001454 | Ga0496123_0001454_26754_27482 | 242 |
| 741 | 3300048927 | Ga0496124_0000988 | Ga0496124_0000988_37892_38620 | 242 |
| 742 | 3300048927 | Ga0496124_0007980 | Ga0496124_0007980_5776_6513 | 242 |
| 743 | 3300048928 | Ga0496125_0003958 | Ga0496125_0003958_6693_7421 | 242 |
| 744 | 3300048929 | Ga0496126_0000066 | Ga0496126_0000066_18339_19067 | 242 |
| 745 | 3300053122 | Ga0500608_000420 | Ga0500608_000420_4240_4986 | 242 |
| 746 | 3300053133 | Ga0500655_000008 | Ga0500655_000008_37599_38345 | 242 |
| 747 | 3300053136 | Ga0500559_0000335 | Ga0500559_0000335_23387_24124 | 242 |
| 748 | 3300053136 | Ga0500559_0003742 | Ga0500559_0003742_4244_4990 | 242 |
| 749 | 3300053138 | Ga0500564_004667 | Ga0500564_004667_2284_3030 | 242 |
| 750 | 3300053140 | Ga0500573_0059303 | Ga0500573_0059303_872_1618 | 242 |
| 751 | 3300053723 | Ga0500567_004223 | Ga0500567_004223_3085_3831 | 242 |
| 752 | 3300053729 | Ga0500625_000012 | Ga0500625_000012_68912_69658 | 242 |
| 753 | iso_pu_bacteria | 2574179768 | 2574430754 | 242 |
| 754 | iso_pu_bacteria | 2928100450 | 2928102717 | 242 |
| 755 | iso_pu_bacteria | 2928959182 | 2928959198 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hh1-assembly1.cif.gz_B | the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls | 0.7786 | 4 | 135 |
| 3hh1-assembly1.cif.gz_B | the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls | 0.7668 | 4 | 135 |
| 3hh1-assembly3.cif.gz_D | the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls | 0.671 | 4 | 134 |
| 7eyu-assembly1.cif.gz_A | fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf-n65t mutant with andiconin d | 0.6654 | 156 | 184 |
| 3hh1-assembly3.cif.gz_D | the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls | 0.656 | 4 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGB3_138_244_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9338 | 140 | 241 | 3.30.950.10 |
| af_P9WGB3_5_136_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9153 | 5 | 136 | 3.40.1010.10 |
| af_P9WGB3_5_136_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9087 | 5 | 136 | 3.40.1010.10 |
| af_P9WGB3_138_244_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.8838 | 140 | 241 | 3.30.950.10 |
| af_Q58181_4_127_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.8689 | 6 | 136 | 3.40.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0X8X8X3-F1-model_v4 | Cobalt-precorrin-2 C20-methyltransferase | 0.9654 | 3 | 134 |
GO:0008168
GO:0009236 GO:0032259 |
| AF-A0A529ZBY4-F1-model_v4 | Precorrin-2 C(20)-methyltransferase (EC 2.1.1.130) | 0.9619 | 162 | 237 |
GO:0009236
GO:0030788 GO:0032259 |
| AF-A0A533IW23-F1-model_v4 | deleted | 0.9585 | 5 | 119 |
|
| AF-A0A2S8NAY1-F1-model_v4 | deleted | 0.9558 | 152 | 231 |
|
| AF-A0A4Q5SVS4-F1-model_v4 | Precorrin-3B C(17)-methyltransferase (EC 2.1.1.131) | 0.9553 | 140 | 242 |
GO:0009236
GO:0030789 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar