F479125

General Info

Members Datasets Scaffolds Average Seq Length
751 382 730 254

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000564|Ga0466972_0000564_13386_14261
Length 291
Sequence MGRIVSSATMPPHRLSAAVSFRKPSSSSESATMQHSPIIWLDDEAQPLPPSALALGPASEAPGLLAAGGRLSVARLTEAYSQGVFPWYSSGQPVLWWSPDPRMVLPVAEFKLSRSLRKTLQKFIRTPGCEVRIDSAFERVIRACAGTKRDGQQGTWIVPEMIQAYTAWHKAGRVHSVETWIDGELAGGLYGVSLGRMFFGESMFSHRTDASKIALAALICFCREHRIPLIDCQQKTSHLASMGAREIPRAHFERHLSLTLGAAPVRDWSYDVSLWEHIGLKAASALPEDPQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
7 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
8 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
9 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
10 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
13 2643221660 Methylibium sp. Root1272 Isolate Unclassified
14 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
15 2885266251 Ralstonia sp. SET104 Isolate Nodule
16 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
17 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
18 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
19 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
20 2928058823 Ralstonia sp. 1138 Isolate Unclassified
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
37 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
38 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
257 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
258 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
259 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
260 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
268 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
314 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
315 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
343 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
344 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
345 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
365 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
366 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
373 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
374 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
375 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
376 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
381 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
382 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 1.46
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.3
Nodule 0.67
Rhizoplane 2.93
Rhizosphere 62.05
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1242637 2162886007 Bacteria 3450
2 JGI24741J21665_1000156 3300001915 Bacteria 19419
3 JGI24740J21852_10002175 3300001979 Bacteria 8963
4 JGI24740J21852_10003164 3300001979 Bacteria 7264
5 JGI24740J21852_10019148 3300001979 Bacteria 2416
6 JGI24735J21928_10001336 3300002067 Bacteria 8727
7 JGI24735J21928_10003035 3300002067 Bacteria 5760
8 JGI24735J21928_10004088 3300002067 Bacteria 4925
9 JGI25156J39149_1000076 3300002705 Bacteria 76265
10 JGI25156J39149_1002013 3300002705 Bacteria 7769
11 JGI25154J39366_1001073 3300002738 Bacteria 10769
12 JGI25154J39366_1003428 3300002738 Bacteria 3334
13 JGI25157J39369_1000037 3300002741 Bacteria 131578
14 JGI25152J39213_1021263 3300002773 Bacteria 1141
15 JGI25150J39212_1015037 3300002774 Bacteria 1299
16 JGI25151J46595_10002737 3300003187 Bacteria 10278
17 JGI25151J46595_10016772 3300003187 Bacteria 3195
18 JGI25153J46596_10001674 3300003215 Bacteria 13142
19 JGI25153J46596_10021502 3300003215 Bacteria 2403
20 rootH1_10048059 3300003316 Bacteria 2400
21 rootH1_10147659 3300003316 Bacteria 1286
22 rootH2_10001011 3300003320 Bacteria 4777
23 rootL2_10000128 3300003322 Bacteria 2760
24 rootL2_10116308 3300003322 Bacteria 3265
25 rootL2_10220982 3300003322 Bacteria 1171
26 rootL2_10292878 3300003322 Bacteria 1491
27 rootH1_10146187 3300003323 Bacteria 1509
28 Ga0006562J51391_1072632 3300003578 Bacteria 1680
29 Ga0055539_1000062 3300003752 Bacteria 141171
30 Ga0055539_1000180 3300003752 Bacteria 53702
31 Ga0055539_1003887 3300003752 Bacteria 2029
32 Ga0055533_1000169 3300003756 Bacteria 59989
33 Ga0055533_1000522 3300003756 Bacteria 13873
34 Ga0055532_1000019 3300003758 Bacteria 286358
35 Ga0055525_1000011 3300003759 Bacteria 503124
36 Ga0055525_1000046 3300003759 Bacteria 261587
37 Ga0055525_1000526 3300003759 Bacteria 18471
38 Ga0055525_1000592 3300003759 Bacteria 15701
39 Ga0055527_1000558 3300003760 Bacteria 12374
40 Ga0055535_1000014 3300003761 Bacteria 286358
41 Ga0055535_1000177 3300003761 Bacteria 68502
42 Ga0055542_1008756 3300003762 Bacteria 1957
43 Ga0055529_1000086 3300003763 Bacteria 140681
44 Ga0055529_1000346 3300003763 Bacteria 51499
45 Ga0055526_1001196 3300003771 Bacteria 18739
46 Ga0055526_1008504 3300003771 Bacteria 5111
47 Ga0055526_1011661 3300003771 Bacteria 3932
48 Ga0055537_1000969 3300003773 Bacteria 13076
49 Ga0055524_1000182 3300003775 Bacteria 70730
50 Ga0055524_1001551 3300003775 Bacteria 12948
51 Ga0055524_1015404 3300003775 Bacteria 2790
52 Ga0055536_1000034 3300003781 Bacteria 148178
53 Ga0055536_1001441 3300003781 Bacteria 14355
54 Ga0055534_1001162 3300003784 Bacteria 11107
55 Ga0055534_1007227 3300003784 Bacteria 2680
56 Ga0055530_10003939 3300003791 Bacteria 8036
57 Ga0055540_1000233 3300003792 Bacteria 51303
58 Ga0055531_10021528 3300003794 Bacteria 2497
59 Ga0055541_1000218 3300003841 Bacteria 23615
60 Ga0055541_1001407 3300003841 Bacteria 5220
61 Ga0065704_10000521 3300005289 Bacteria 27858
62 Ga0070658_10142750 3300005327 Bacteria 2001
63 Ga0070676_10120114 3300005328 Bacteria 1648
64 Ga0070690_100064119 3300005330 Bacteria 2372
65 Ga0070670_100052202 3300005331 Bacteria 3511
66 Ga0068869_100185772 3300005334 Bacteria 1632
67 Ga0068869_100256539 3300005334 Bacteria 1398
68 Ga0070666_10045584 3300005335 Bacteria 2939
69 Ga0070666_10128249 3300005335 Bacteria 1761
70 Ga0068868_100355522 3300005338 Bacteria 1255
71 Ga0070660_100062158 3300005339 Bacteria 2900
72 Ga0070660_100126394 3300005339 Bacteria 2043
73 Ga0070660_100289162 3300005339 Bacteria 1342
74 Ga0070660_100563686 3300005339 Bacteria 951
75 Ga0070689_100474448 3300005340 Bacteria 1068
76 Ga0070661_100000088 3300005344 Bacteria 73636
77 Ga0070661_100002048 3300005344 Bacteria 13895
78 Ga0070668_100023518 3300005347 Bacteria 4661
79 Ga0070668_100121311 3300005347 Bacteria 2090
80 Ga0070669_100055294 3300005353 Bacteria 2908
81 Ga0070675_100059896 3300005354 Bacteria 3142
82 Ga0070675_100153211 3300005354 Bacteria 1977
83 Ga0070675_100528340 3300005354 Bacteria 1065
84 Ga0070671_100011544 3300005355 Bacteria 7104
85 Ga0070671_100070434 3300005355 Bacteria 2917
86 Ga0070671_100446201 3300005355 Bacteria 1110
87 Ga0070674_100023714 3300005356 Bacteria 3975
88 Ga0070674_100053542 3300005356 Bacteria 2787
89 Ga0070674_100348270 3300005356 Bacteria 1196
90 Ga0070674_100532635 3300005356 Bacteria 983
91 Ga0070674_100800113 3300005356 Bacteria 814
92 Ga0070659_100000684 3300005366 Bacteria 24663
93 Ga0070659_100036638 3300005366 Bacteria 3824
94 Ga0070659_100069361 3300005366 Bacteria 2798
95 Ga0070659_100103256 3300005366 Bacteria 2296
96 Ga0070667_100002698 3300005367 Bacteria 15368
97 Ga0070667_100004949 3300005367 Bacteria 11163
98 Ga0070667_100152363 3300005367 Bacteria 2031
99 Ga0070667_100284036 3300005367 Bacteria 1487
100 Ga0070663_100000010 3300005455 Bacteria 158193
101 Ga0070663_100000172 3300005455 Bacteria 32702
102 Ga0070678_100194506 3300005456 Bacteria 1670
103 Ga0070662_100013398 3300005457 Bacteria 5456
104 Ga0070662_100295166 3300005457 Bacteria 1315
105 Ga0070662_100345238 3300005457 Bacteria 1218
106 Ga0070662_100603149 3300005457 Bacteria 924
107 Ga0068867_100000070 3300005459 Bacteria 61892
108 Ga0068867_100075085 3300005459 Bacteria 2535
109 Ga0068867_100188007 3300005459 Bacteria 1646
110 Ga0070706_100012812 3300005467 Bacteria 7761
111 Ga0070706_100154388 3300005467 Bacteria 2143
112 Ga0070707_100034845 3300005468 Bacteria 4800
113 Ga0070698_100243253 3300005471 Bacteria 1732
114 Ga0070672_100004411 3300005543 Bacteria 9209
115 Ga0070672_100081573 3300005543 Bacteria 2593
116 Ga0070672_100089747 3300005543 Bacteria 2477
117 Ga0070672_100155866 3300005543 Bacteria 1892
118 Ga0070665_100011217 3300005548 Bacteria 9061
119 Ga0070665_100184722 3300005548 Bacteria 2086
120 Ga0070665_100772606 3300005548 Bacteria 974
121 Ga0068855_100002721 3300005563 Bacteria 21787
122 Ga0068855_100361027 3300005563 Bacteria 1598
123 Ga0070664_100000005 3300005564 Bacteria 222746
124 Ga0070664_100011468 3300005564 Bacteria 7193
125 Ga0068857_100001142 3300005577 Bacteria 20694
126 Ga0068857_100005050 3300005577 Bacteria 11209
127 Ga0068857_100084990 3300005577 Bacteria 2827
128 Ga0068857_100667754 3300005577 Bacteria 986
129 Ga0068854_100000104 3300005578 Bacteria 58909
130 Ga0068854_100422408 3300005578 Bacteria 1108
131 Ga0068856_100000054 3300005614 Bacteria 104246
132 Ga0068856_100005635 3300005614 Bacteria 12324
133 Ga0068852_100007651 3300005616 Bacteria 7899
134 Ga0068852_100063109 3300005616 Bacteria 3225
135 Ga0068852_100075588 3300005616 Bacteria 2972
136 Ga0068859_100041965 3300005617 Bacteria 4595
137 Ga0068859_100442506 3300005617 Bacteria 1396
138 Ga0068859_100445831 3300005617 Bacteria 1390
139 Ga0068864_100006013 3300005618 Bacteria 9963
140 Ga0068864_100119003 3300005618 Bacteria 2359
141 Ga0068864_100122122 3300005618 Bacteria 2330
142 Ga0068864_100457003 3300005618 Bacteria 1222
143 Ga0068866_10018175 3300005718 Bacteria 3174
144 Ga0068861_100038355 3300005719 Bacteria 3566
145 Ga0068861_100091450 3300005719 Bacteria 2402
146 Ga0068863_100010184 3300005841 Bacteria 9142
147 Ga0068863_100052311 3300005841 Bacteria 3871
148 Ga0068858_100003457 3300005842 Bacteria 15673
149 Ga0068860_100010521 3300005843 Bacteria 9145
150 Ga0068860_100147158 3300005843 Bacteria 2267
151 Ga0068860_100938260 3300005843 Bacteria 882
152 Ga0068862_100046531 3300005844 Bacteria 3701
153 Ga0075368_10115570 3300006042 Bacteria 1108
154 Ga0075368_10207221 3300006042 Bacteria 830
155 Ga0075363_100076420 3300006048 Bacteria 1826
156 Ga0075363_100078873 3300006048 Bacteria 1798
157 Ga0075364_10000093 3300006051 Bacteria 36230
158 Ga0075364_10187187 3300006051 Bacteria 1402
159 Ga0075364_10205482 3300006051 Bacteria 1335
160 Ga0075362_10015684 3300006177 Bacteria 3086
161 Ga0075362_10174037 3300006177 Bacteria 1041
162 Ga0075367_10005261 3300006178 Bacteria 6398
163 Ga0075367_10051646 3300006178 Bacteria 2430
164 Ga0075367_10056457 3300006178 Bacteria 2333
165 Ga0075367_10118351 3300006178 Bacteria 1631
166 Ga0075369_10050419 3300006186 Bacteria 1800
167 Ga0075366_10003640 3300006195 Bacteria 8167
168 Ga0075366_10018595 3300006195 Bacteria 4013
169 Ga0075366_10066650 3300006195 Bacteria 2142
170 Ga0075366_10068126 3300006195 Bacteria 2118
171 Ga0075366_10069318 3300006195 Bacteria 2099
172 Ga0075366_10073311 3300006195 Bacteria 2040
173 Ga0075366_10087441 3300006195 Bacteria 1865
174 Ga0097621_100018737 3300006237 Bacteria 5295
175 Ga0075370_10003212 3300006353 Bacteria 7738
176 Ga0075370_10007548 3300006353 Bacteria 5543
177 Ga0075370_10016620 3300006353 Bacteria 3960
178 Ga0075370_10038128 3300006353 Bacteria 2704
179 Ga0075370_10062349 3300006353 Bacteria 2124
180 Ga0075370_10217247 3300006353 Bacteria 1129
181 Ga0075370_10260648 3300006353 Bacteria 1028
182 Ga0075370_10298349 3300006353 Bacteria 958
183 Ga0068865_100021548 3300006881 Bacteria 4192
184 Ga0097620_100041965 3300006931 Bacteria 4595
185 Ga0097620_100442472 3300006931 Bacteria 1396
186 Ga0097620_100445867 3300006931 Bacteria 1390
187 Ga0079104_1000333 3300006946 Bacteria 57718
188 Ga0105251_10001385 3300009011 Bacteria 20970
189 Ga0105240_10038201 3300009093 Bacteria 6160
190 Ga0105240_10050723 3300009093 Bacteria 5229
191 Ga0105240_10052231 3300009093 Bacteria 5139
192 Ga0105240_10169962 3300009093 Bacteria 2583
193 Ga0111539_10870216 3300009094 Bacteria 1048
194 Ga0105245_10140169 3300009098 Bacteria 2276
195 Ga0105245_10204521 3300009098 Bacteria 1897
196 Ga0105245_10238116 3300009098 Bacteria 1763
197 Ga0114129_10118444 3300009147 Bacteria 3647
198 Ga0105243_10001208 3300009148 Bacteria 23242
199 Ga0105243_10017699 3300009148 Bacteria 5389
200 Ga0105243_10046506 3300009148 Bacteria 3414
201 Ga0105241_10530253 3300009174 Bacteria 1054
202 Ga0105241_10566064 3300009174 Bacteria 1022
203 Ga0105242_10179872 3300009176 Bacteria 1865
204 Ga0105248_10001394 3300009177 Bacteria 26961
205 Ga0105248_10502049 3300009177 Bacteria 1368
206 Ga0105237_10002681 3300009545 Bacteria 21822
207 Ga0105237_10111846 3300009545 Bacteria 2723
208 Ga0105237_10129910 3300009545 Bacteria 2514
209 Ga0105238_10010268 3300009551 Bacteria 9391
210 Ga0105238_10256926 3300009551 Bacteria 1726
211 Ga0105249_10071057 3300009553 Bacteria 3215
212 Ga0105239_10001896 3300010375 Bacteria 27329
213 Ga0105239_10010428 3300010375 Bacteria 10391
214 Ga0105239_10149036 3300010375 Bacteria 2611
215 Ga0105239_10829492 3300010375 Bacteria 1060
216 Ga0157373_10029907 3300013100 Bacteria 3922
217 Ga0157371_10000103 3300013102 Bacteria 128611
218 Ga0157370_10000966 3300013104 Bacteria 36379
219 Ga0157369_10003969 3300013105 Bacteria 17540
220 Ga0157374_10118342 3300013296 Bacteria 2555
221 Ga0157374_10123028 3300013296 Bacteria 2506
222 Ga0157374_10131273 3300013296 Bacteria 2424
223 Ga0157374_10219015 3300013296 Bacteria 1867
224 Ga0157374_10454282 3300013296 Bacteria 1283
225 Ga0157378_10066654 3300013297 Bacteria 3225
226 Ga0157378_10196196 3300013297 Bacteria 1907
227 Ga0163162_10033348 3300013306 Bacteria 5116
228 Ga0163162_10081416 3300013306 Bacteria 3308
229 Ga0163162_10261071 3300013306 Bacteria 1864
230 Ga0163162_10440953 3300013306 Bacteria 1434
231 Ga0163162_10579391 3300013306 Bacteria 1249
232 Ga0163162_11030625 3300013306 Bacteria 931
233 Ga0157375_10134869 3300013308 Bacteria 2591
234 Ga0157375_10176788 3300013308 Bacteria 2284
235 Ga0157375_10178174 3300013308 Bacteria 2276
236 Ga0157380_10039716 3300014326 Bacteria 3661
237 Ga0157380_10111468 3300014326 Bacteria 2300
238 Ga0157377_10000016 3300014745 Bacteria 190613
239 Ga0157377_10143964 3300014745 Bacteria 1467
240 Ga0157379_10020286 3300014968 Bacteria 5876
241 Ga0157379_10177099 3300014968 Bacteria 1926
242 Ga0157376_10562464 3300014969 Bacteria 1130
243 Ga0182006_1000468 3300015261 Bacteria 31596
244 Ga0182006_1005546 3300015261 Bacteria 5995
245 Ga0182007_10040374 3300015262 Bacteria 1558
246 Ga0183362_10001 3300015683 Bacteria 2046624
247 Ga0163161_10272440 3300017792 Bacteria 1325
248 Ga0197907_11038722 3300020069 Bacteria 2812
249 Ga0206355_1479823 3300020076 Bacteria 3847
250 Ga0206351_10121833 3300020077 Bacteria 6469
251 Ga0206350_11084827 3300020080 Bacteria 2842
252 Ga0206353_11440426 3300020082 Bacteria 1309
253 Ga0154015_1286480 3300020610 Bacteria 42278
254 Ga0213872_10000051 3300021361 Bacteria 107261
255 Ga0213872_10000074 3300021361 Bacteria 90986
256 Ga0213872_10000710 3300021361 Bacteria 25046
257 Ga0213872_10020308 3300021361 Bacteria 3061
258 Ga0213872_10051886 3300021361 Bacteria 1861
259 Ga0213872_10161368 3300021361 Bacteria 975
260 Ga0224712_10012271 3300022467 Bacteria 2689
261 Ga0209784_100003 3300025224 Bacteria 1379451
262 Ga0209784_100328 3300025224 Bacteria 24020
263 Ga0209566_100002 3300025225 Bacteria 2614868
264 Ga0209566_100621 3300025225 Bacteria 21899
265 Ga0209566_100782 3300025225 Bacteria 16940
266 Ga0209674_100008 3300025226 Bacteria 1076909
267 Ga0209674_100165 3300025226 Bacteria 86006
268 Ga0209674_100239 3300025226 Bacteria 46704
269 Ga0209672_100246 3300025228 Bacteria 40789
270 Ga0209147_100002 3300025229 Bacteria 2158988
271 Ga0209563_100004 3300025230 Bacteria 1814108
272 Ga0209563_100005 3300025230 Bacteria 1774893
273 Ga0209563_100137 3300025230 Bacteria 87321
274 Ga0209563_103216 3300025230 Bacteria 3438
275 Ga0209563_111937 3300025230 Bacteria 1207
276 Ga0207427_101146 3300025231 Bacteria 10442
277 Ga0209258_100002 3300025242 Bacteria 2158988
278 Ga0209258_100146 3300025242 Bacteria 163331
279 Ga0209258_100973 3300025242 Bacteria 13413
280 Ga0207425_1000332 3300025245 Bacteria 33095
281 Ga0209646_1000019 3300025246 Bacteria 475248
282 Ga0209646_1000062 3300025246 Bacteria 252045
283 Ga0209026_1000026 3300025250 Bacteria 352109
284 Ga0209026_1001896 3300025250 Bacteria 8498
285 Ga0209677_100009 3300025253 Bacteria 749530
286 Ga0209677_100124 3300025253 Bacteria 79576
287 Ga0209677_100191 3300025253 Bacteria 50010
288 Ga0209677_101539 3300025253 Bacteria 9834
289 Ga0209677_106364 3300025253 Bacteria 2809
290 Ga0209148_1000471 3300025254 Bacteria 42915
291 Ga0209148_1004089 3300025254 Bacteria 3695
292 Ga0209759_1000050 3300025256 Bacteria 215979
293 Ga0209759_1001102 3300025256 Bacteria 17442
294 Ga0209759_1001190 3300025256 Bacteria 16317
295 Ga0209759_1001457 3300025256 Bacteria 13288
296 Ga0209759_1006480 3300025256 Bacteria 3923
297 Ga0209759_1008489 3300025256 Bacteria 3194
298 Ga0209759_1011545 3300025256 Bacteria 2503
299 Ga0209129_1000012 3300025258 Bacteria 541516
300 Ga0209565_1000191 3300025263 Bacteria 75148
301 Ga0209565_1004996 3300025263 Bacteria 3928
302 Ga0209455_1000059 3300025272 Bacteria 339995
303 Ga0209455_1000076 3300025272 Bacteria 284092
304 Ga0209130_1011141 3300025284 Bacteria 2423
305 Ga0209675_1000084 3300025291 Bacteria 152066
306 Ga0209675_1001550 3300025291 Bacteria 13072
307 Ga0209675_1008884 3300025291 Bacteria 3619
308 Ga0209676_1000014 3300025292 Bacteria 793514
309 Ga0209676_1000086 3300025292 Bacteria 264155
310 Ga0209025_1000323 3300025294 Bacteria 106442
311 Ga0209025_1000363 3300025294 Bacteria 96763
312 Ga0209025_1009587 3300025294 Bacteria 6718
313 Ga0209564_1000022 3300025295 Bacteria 555109
314 Ga0209564_1000953 3300025295 Bacteria 36860
315 Ga0209564_1001000 3300025295 Bacteria 35296
316 Ga0209758_1000356 3300025297 Bacteria 82914
317 Ga0209758_1000708 3300025297 Bacteria 49463
318 Ga0209050_1002670 3300025298 Bacteria 14557
319 Ga0209050_1016415 3300025298 Bacteria 3030
320 Ga0209256_1000024 3300025299 Bacteria 448909
321 Ga0209256_1000466 3300025299 Bacteria 61247
322 Ga0209256_1003509 3300025299 Bacteria 10925
323 Ga0209051_1000155 3300025303 Bacteria 129560
324 Ga0209051_1005150 3300025303 Bacteria 7752
325 Ga0209051_1007719 3300025303 Bacteria 5833
326 Ga0209051_1012820 3300025303 Bacteria 4032
327 Ga0209257_1000236 3300025304 Bacteria 129543
328 Ga0207682_10003745 3300025893 Bacteria 6537
329 Ga0207682_10075488 3300025893 Bacteria 1435
330 Ga0207642_10215411 3300025899 Bacteria 1070
331 Ga0207688_10061796 3300025901 Bacteria 2112
332 Ga0207680_10289776 3300025903 Bacteria 1139
333 Ga0207645_10037411 3300025907 Bacteria 3114
334 Ga0207705_10196295 3300025909 Bacteria 1528
335 Ga0207705_10506943 3300025909 Bacteria 937
336 Ga0207684_10047582 3300025910 Bacteria 3637
337 Ga0207654_10385906 3300025911 Bacteria 971
338 Ga0207695_10018539 3300025913 Bacteria 8042
339 Ga0207695_10033764 3300025913 Bacteria 5575
340 Ga0207695_10037040 3300025913 Bacteria 5265
341 Ga0207671_10002325 3300025914 Bacteria 20511
342 Ga0207657_10010303 3300025919 Bacteria 9332
343 Ga0207657_10342379 3300025919 Bacteria 1180
344 Ga0207657_10500555 3300025919 Bacteria 952
345 Ga0207649_10000098 3300025920 Bacteria 71539
346 Ga0207649_10005919 3300025920 Bacteria 6628
347 Ga0207649_10235460 3300025920 Bacteria 1312
348 Ga0207649_10297286 3300025920 Bacteria 1179
349 Ga0207681_10020476 3300025923 Bacteria 4192
350 Ga0207681_10065945 3300025923 Bacteria 2505
351 Ga0207681_10112910 3300025923 Bacteria 1980
352 Ga0207650_10006156 3300025925 Bacteria 8179
353 Ga0207650_10098602 3300025925 Bacteria 2245
354 Ga0207650_10584120 3300025925 Bacteria 938
355 Ga0207659_10099075 3300025926 Bacteria 2193
356 Ga0207659_10127859 3300025926 Bacteria 1957
357 Ga0207659_10153708 3300025926 Bacteria 1799
358 Ga0207659_10351705 3300025926 Bacteria 1223
359 Ga0207687_10064217 3300025927 Bacteria 2602
360 Ga0207687_10072680 3300025927 Bacteria 2461
361 Ga0207687_10136902 3300025927 Bacteria 1853
362 Ga0207644_10000924 3300025931 Bacteria 18658
363 Ga0207644_10166966 3300025931 Bacteria 1715
364 Ga0207690_10005848 3300025932 Bacteria 7278
365 Ga0207690_10019643 3300025932 Bacteria 4164
366 Ga0207690_10167488 3300025932 Bacteria 1643
367 Ga0207706_10005864 3300025933 Bacteria 11427
368 Ga0207706_10054989 3300025933 Bacteria 3512
369 Ga0207706_10071708 3300025933 Bacteria 3047
370 Ga0207706_10101818 3300025933 Bacteria 2527
371 Ga0207706_10401590 3300025933 Bacteria 1188
372 Ga0207686_10168180 3300025934 Bacteria 1543
373 Ga0207709_10002246 3300025935 Bacteria 12298
374 Ga0207709_10020701 3300025935 Bacteria 3714
375 Ga0207669_10076721 3300025937 Bacteria 2122
376 Ga0207669_10163304 3300025937 Bacteria 1576
377 Ga0207704_10111664 3300025938 Bacteria 1849
378 Ga0207691_10039297 3300025940 Bacteria 4377
379 Ga0207691_10510833 3300025940 Bacteria 1020
380 Ga0207711_10006498 3300025941 Bacteria 9843
381 Ga0207711_10128462 3300025941 Bacteria 2269
382 Ga0207711_10237146 3300025941 Bacteria 1672
383 Ga0207689_10003940 3300025942 Bacteria 13512
384 Ga0207679_10000020 3300025945 Bacteria 225727
385 Ga0207679_10003912 3300025945 Bacteria 9243
386 Ga0207679_10059750 3300025945 Bacteria 2830
387 Ga0207667_10001993 3300025949 Bacteria 25611
388 Ga0207667_10267199 3300025949 Bacteria 1749
389 Ga0207667_10539739 3300025949 Bacteria 1180
390 Ga0207651_10000893 3300025960 Bacteria 13093
391 Ga0207712_10136980 3300025961 Bacteria 1874
392 Ga0207668_10590580 3300025972 Bacteria 966
393 Ga0207640_10000092 3300025981 Bacteria 71354
394 Ga0207658_10000596 3300025986 Bacteria 32369
395 Ga0207658_10031648 3300025986 Bacteria 3758
396 Ga0207658_10137657 3300025986 Bacteria 1971
397 Ga0207677_10050885 3300026023 Bacteria 2805
398 Ga0207677_10410906 3300026023 Bacteria 1150
399 Ga0207703_10066736 3300026035 Bacteria 2960
400 Ga0207703_10118572 3300026035 Bacteria 2269
401 Ga0207703_10444667 3300026035 Bacteria 1210
402 Ga0207639_10083956 3300026041 Bacteria 2529
403 Ga0207678_10000181 3300026067 Bacteria 53999
404 Ga0207678_10000478 3300026067 Bacteria 36328
405 Ga0207678_10157820 3300026067 Bacteria 1937
406 Ga0207708_10178413 3300026075 Bacteria 1686
407 Ga0207702_10000017 3300026078 Bacteria 222964
408 Ga0207702_10000573 3300026078 Bacteria 40848
409 Ga0207702_10209508 3300026078 Bacteria 1811
410 Ga0207641_10064210 3300026088 Bacteria 3137
411 Ga0207641_10081066 3300026088 Bacteria 2817
412 Ga0207641_10538458 3300026088 Bacteria 1137
413 Ga0207648_10000412 3300026089 Bacteria 47573
414 Ga0207648_10117120 3300026089 Bacteria 2342
415 Ga0207648_10426260 3300026089 Bacteria 1205
416 Ga0207648_10559589 3300026089 Bacteria 1051
417 Ga0207676_10175468 3300026095 Bacteria 1871
418 Ga0207676_10215227 3300026095 Bacteria 1707
419 Ga0207676_10624225 3300026095 Bacteria 1037
420 Ga0207676_10625593 3300026095 Bacteria 1036
421 Ga0207674_10001842 3300026116 Bacteria 27012
422 Ga0207674_10009965 3300026116 Bacteria 10813
423 Ga0207674_10014163 3300026116 Bacteria 8813
424 Ga0207674_10315985 3300026116 Bacteria 1511
425 Ga0207675_100036720 3300026118 Bacteria 4570
426 Ga0207675_100038606 3300026118 Bacteria 4456
427 Ga0207675_100122801 3300026118 Bacteria 2458
428 Ga0207683_10442906 3300026121 Bacteria 1197
429 Ga0207683_10548935 3300026121 Bacteria 1068
430 Ga0207698_10059115 3300026142 Bacteria 2975
431 Ga0207698_10236080 3300026142 Bacteria 1663
432 Ga0207698_10305646 3300026142 Bacteria 1483
433 Ga0209281_1000322 3300027111 Bacteria 84374
434 Ga0209966_1000005 3300027695 Bacteria 103734
435 Ga0209974_10005889 3300027876 Bacteria 4297
436 Ga0209974_10006645 3300027876 Bacteria 4024
437 Ga0268266_10013898 3300028379 Bacteria 6932
438 Ga0268266_10139229 3300028379 Bacteria 2177
439 Ga0268266_10435893 3300028379 Bacteria 1244
440 Ga0268266_10629987 3300028379 Bacteria 1031
441 Ga0268265_10024728 3300028380 Bacteria 4254
442 Ga0268264_10006835 3300028381 Bacteria 9581
443 Ga0268264_10114353 3300028381 Bacteria 2369
444 Ga0268264_10599936 3300028381 Bacteria 1085
445 Ga0268264_10633347 3300028381 Bacteria 1057
446 Ga0265336_10000119 3300028666 Bacteria 59232
447 Ga0307517_10010987 3300028786 Bacteria 12591
448 Ga0307515_10000026 3300028794 Bacteria 382411
449 Ga0307515_10000051 3300028794 Bacteria 272100
450 Ga0307515_10000305 3300028794 Bacteria 121634
451 Ga0307515_10004253 3300028794 Bacteria 29706
452 Ga0307515_10006880 3300028794 Bacteria 22609
453 Ga0307515_10025690 3300028794 Bacteria 10178
454 Ga0307515_10095432 3300028794 Bacteria 3660
455 Ga0307515_10103254 3300028794 Bacteria 3419
456 Ga0307515_10137858 3300028794 Bacteria 2638
457 Ga0265324_10009959 3300029957 Bacteria 3691
458 Ga0307512_10024522 3300030522 Bacteria 5365
459 Ga0307512_10098240 3300030522 Bacteria 1999
460 Ga0265328_10008350 3300031239 Bacteria 4277
461 Ga0265331_10010000 3300031250 Bacteria 5276
462 Ga0265327_10000078 3300031251 Bacteria 207398
463 Ga0307513_10012007 3300031456 Bacteria 10723
464 Ga0307513_10015459 3300031456 Bacteria 9251
465 Ga0307513_10039983 3300031456 Bacteria 5191
466 Ga0307513_10046000 3300031456 Bacteria 4765
467 Ga0307513_10064266 3300031456 Bacteria 3868
468 Ga0307513_10243770 3300031456 Bacteria 1600
469 Ga0307513_10322523 3300031456 Bacteria 1302
470 Ga0307509_10001286 3300031507 Bacteria 42598
471 Ga0307509_10010432 3300031507 Bacteria 11388
472 Ga0307509_10013769 3300031507 Bacteria 9545
473 Ga0307509_10192000 3300031507 Bacteria 1892
474 Ga0307408_100120145 3300031548 Bacteria 2034
475 Ga0307508_10000098 3300031616 Bacteria 103295
476 Ga0307508_10000159 3300031616 Bacteria 81150
477 Ga0307508_10313926 3300031616 Bacteria 1159
478 Ga0307514_10006986 3300031649 Bacteria 9760
479 Ga0307514_10008269 3300031649 Bacteria 8878
480 Ga0307516_10002826 3300031730 Bacteria 22886
481 Ga0307516_10003066 3300031730 Bacteria 21791
482 Ga0307516_10004343 3300031730 Bacteria 17529
483 Ga0307516_10030498 3300031730 Bacteria 5440
484 Ga0307516_10176912 3300031730 Bacteria 1870
485 Ga0307405_10004366 3300031731 Bacteria 6671
486 Ga0307413_10008901 3300031824 Bacteria 4770
487 Ga0307518_10235322 3300031838 Bacteria 1181
488 Ga0307410_10073767 3300031852 Bacteria 2374
489 Ga0307410_10167566 3300031852 Bacteria 1652
490 Ga0307410_10341530 3300031852 Bacteria 1194
491 Ga0307406_10083144 3300031901 Bacteria 2134
492 Ga0307412_10081044 3300031911 Bacteria 2243
493 Ga0307416_100097304 3300032002 Bacteria 2548
494 Ga0307414_10130313 3300032004 Bacteria 1951
495 Ga0307414_10184698 3300032004 Bacteria 1681
496 Ga0307411_10010018 3300032005 Bacteria 5024
497 Ga0307507_10064389 3300033179 Bacteria 3384
498 Ga0307510_10002924 3300033180 Bacteria 19645
499 Ga0373953_0068769 3300035117 Bacteria 1458
500 Ga0373927_0093092 3300035695 Bacteria 1958
501 Ga0373937_0259585 3300036401 Bacteria 1638
502 Ga0395899_0155022 3300037312 Bacteria 1621
503 Ga0395900_0000050 3300037418 Bacteria 224616
504 Ga0395900_0008520 3300037418 Bacteria 10540
505 Ga0395898_0000817 3300037466 Bacteria 52136
506 Ga0395898_0134229 3300037466 Bacteria 2370
507 Ga0395905_0013384 3300037471 Bacteria 7860
508 Ga0395905_0255121 3300037471 Bacteria 1638
509 Ga0395905_0386006 3300037471 Bacteria 1295
510 Ga0395901_0001599 3300038443 Bacteria 23451
511 Ga0436361_0060431 3300039447 Bacteria 1307
512 Ga0436361_0146317 3300039447 Bacteria 92155
513 Ga0436361_0180496 3300039447 Bacteria 1798
514 Ga0436361_0362737 3300039447 Bacteria 5180
515 Ga0436361_0768142 3300039447 Bacteria 56393
516 Ga0436361_0855507 3300039447 Bacteria 1812
517 Ga0436361_0939166 3300039447 Bacteria 85026
518 Ga0451793_0207973 3300041452 Bacteria 2114
519 Ga0451793_1769215 3300041452 Bacteria 4829
520 Ga0451833_1270813 3300041491 Bacteria 2084
521 Ga0451839_1057768 3300041496 Bacteria 1488
522 Ga0451847_0972424 3300041503 Bacteria 1053
523 Ga0451851_0448762 3300041507 Bacteria 2378
524 Ga0451853_1890114 3300041512 Bacteria 1662
525 Ga0439434_0116469 3300042435 Bacteria 869
526 Ga0450918_000287 3300042531 Bacteria 11389
527 Ga0451577_0003543 3300042876 Bacteria 17252
528 Ga0451577_0178794 3300042876 Bacteria 1912
529 Ga0451577_0186179 3300042876 Bacteria 1872
530 Ga0451577_0576409 3300042876 Bacteria 1021
531 Ga0466969_0023854 3300044656 Bacteria 3148
532 Ga0466969_0025097 3300044656 Bacteria 3065
533 Ga0466969_0050747 3300044656 Bacteria 2044
534 Ga0466969_0097828 3300044656 Bacteria 1384
535 Ga0466972_0000564 3300044658 Bacteria 18111
536 Ga0466972_0033620 3300044658 Bacteria 2514
537 Ga0466972_0047073 3300044658 Bacteria 2086
538 Ga0466972_0116790 3300044658 Bacteria 1259
539 Ga0466975_0331127 3300044661 Bacteria 964
540 Ga0466982_0062127 3300044672 Bacteria 2300
541 Ga0466965_0002967 3300044683 Bacteria 7350
542 Ga0466965_0018420 3300044683 Bacteria 3347
543 Ga0466965_0024197 3300044683 Bacteria 2935
544 Ga0466965_0045731 3300044683 Bacteria 2166
545 Ga0466966_0003862 3300044684 Bacteria 9890
546 Ga0466966_0005496 3300044684 Bacteria 8326
547 Ga0466966_0076484 3300044684 Bacteria 2090
548 Ga0466961_0000202 3300044693 Bacteria 40048
549 Ga0466961_0000655 3300044693 Bacteria 21750
550 Ga0466961_0012612 3300044693 Bacteria 5412
551 Ga0466961_0016936 3300044693 Bacteria 4683
552 Ga0466964_0004693 3300044706 Bacteria 5050
553 Ga0466964_0046890 3300044706 Bacteria 1762
554 Ga0466964_0069619 3300044706 Bacteria 1484
555 Ga0453684_0071583 3300044712 Bacteria 4383
556 Ga0466971_0011261 3300044719 Bacteria 3918
557 Ga0466971_0016744 3300044719 Bacteria 3237
558 Ga0466968_0010399 3300044735 Bacteria 3606
559 Ga0466968_0031325 3300044735 Bacteria 2206
560 Ga0466970_0004900 3300044765 Bacteria 6610
561 Ga0466970_0075768 3300044765 Bacteria 1812
562 Ga0466970_0079395 3300044765 Bacteria 1771
563 Ga0466970_0271794 3300044765 Bacteria 952
564 Ga0466957_0005869 3300044842 Bacteria 6916
565 Ga0466957_0026350 3300044842 Bacteria 3448
566 Ga0466960_0219898 3300044901 Bacteria 1045
567 Ga0466959_0000285 3300045049 Bacteria 30873
568 Ga0466959_0044517 3300045049 Bacteria 3270
569 Ga0466959_0046888 3300045049 Bacteria 3180
570 Ga0451576_0024224 3300045051 Bacteria 6557
571 Ga0451576_0823240 3300045051 Bacteria 975
572 Ga0466958_0117702 3300045836 Bacteria 1661
573 Ga0466967_0011318 3300045976 Bacteria 6747
574 Ga0466967_0074550 3300045976 Bacteria 3048
575 Ga0466967_0127300 3300045976 Bacteria 2360
576 Ga0466967_0558205 3300045976 Bacteria 1127
577 Ga0495592_0000205 3300046454 Bacteria 50544
578 Ga0495603_0002742 3300046455 Bacteria 10387
579 Ga0495629_0000480 3300046459 Bacteria 33539
580 Ga0495638_0010534 3300046460 Bacteria 6406
581 Ga0495651_0093157 3300046462 Bacteria 2256
582 Ga0495651_0115987 3300046462 Bacteria 1974
583 Ga0495650_0002453 3300046471 Bacteria 14961
584 Ga0495650_0010155 3300046471 Bacteria 5279
585 Ga0495582_0215042 3300046473 Bacteria 1099
586 Ga0495605_0001336 3300046474 Bacteria 16318
587 Ga0495639_0050769 3300046475 Bacteria 1885
588 Ga0495639_0111927 3300046475 Bacteria 1296
589 Ga0495662_0064672 3300046476 Bacteria 1768
590 Ga0495596_0070535 3300046500 Bacteria 1358
591 Ga0495583_0000585 3300046506 Bacteria 49928
592 Ga0495583_0097552 3300046506 Bacteria 1258
593 Ga0495606_0005296 3300046507 Bacteria 12423
594 Ga0495606_0020534 3300046507 Bacteria 4866
595 Ga0495610_0020856 3300046512 Bacteria 3623
596 Ga0495632_0003624 3300046519 Bacteria 10853
597 Ga0495632_0034350 3300046519 Bacteria 2596
598 Ga0495644_0029675 3300046523 Bacteria 2066
599 Ga0495648_0067868 3300046524 Bacteria 2084
600 Ga0495642_0033579 3300046528 Bacteria 2063
601 Ga0495586_0007585 3300046535 Bacteria 5791
602 Ga0495597_0002614 3300046542 Bacteria 11205
603 Ga0495645_0009654 3300046543 Bacteria 6749
604 Ga0495667_0119798 3300046559 Bacteria 1700
605 Ga0495668_0020891 3300046616 Bacteria 3760
606 Ga0495668_0065020 3300046616 Bacteria 2008
607 Ga0495668_0149498 3300046616 Bacteria 1279
608 Ga0495625_0002218 3300046660 Bacteria 21465
609 Ga0495625_0051677 3300046660 Bacteria 2946
610 Ga0495625_0234894 3300046660 Bacteria 1196
611 Ga0495646_0084861 3300046680 Bacteria 1838
612 Ga0495658_0073883 3300046683 Bacteria 1986
613 Ga0495669_0020999 3300046684 Bacteria 2830
614 Ga0495669_0108198 3300046684 Bacteria 1296
615 Ga0495613_0356586 3300046689 Bacteria 1003
616 Ga0495649_0007041 3300046694 Bacteria 6922
617 Ga0495649_0008123 3300046694 Bacteria 6333
618 Ga0495660_0016584 3300046810 Bacteria 4247
619 Ga0495687_000078 3300047443 Bacteria 148202
620 Ga0495687_000473 3300047443 Bacteria 48762
621 Ga0495687_010018 3300047443 Bacteria 5236
622 Ga0495673_0063698 3300047469 Bacteria 1571
623 Ga0495681_0130243 3300047470 Bacteria 1071
624 Ga0495686_0000042 3300047472 Bacteria 293968
625 Ga0495686_0007475 3300047472 Bacteria 8186
626 Ga0495686_0066710 3300047472 Bacteria 2223
627 Ga0495686_0068404 3300047472 Bacteria 2191
628 Ga0495686_0081042 3300047472 Bacteria 1983
629 Ga0495593_0126967 3300047673 Bacteria 1296
630 Ga0496100_0123382 3300048903 Bacteria 1815
631 Ga0496101_0245804 3300048904 Bacteria 1393
632 Ga0496101_0402824 3300048904 Bacteria 1077
633 Ga0496102_0008536 3300048905 Bacteria 8785
634 Ga0496104_0008971 3300048907 Bacteria 8892
635 Ga0496105_0029841 3300048908 Bacteria 4465
636 Ga0496105_0381150 3300048908 Bacteria 1122
637 Ga0496106_0004373 3300048909 Bacteria 10498
638 Ga0496106_0025809 3300048909 Bacteria 4372
639 Ga0496107_0156247 3300048910 Bacteria 1689
640 Ga0496108_0147760 3300048911 Bacteria 2027
641 Ga0496109_0098397 3300048912 Bacteria 2712
642 Ga0496110_0204149 3300048913 Bacteria 1796
643 Ga0496111_0114549 3300048914 Bacteria 1988
644 Ga0496112_0013286 3300048915 Bacteria 7601
645 Ga0496113_0330230 3300048916 Bacteria 1223
646 Ga0496114_0002351 3300048917 Bacteria 14395
647 Ga0496114_0022878 3300048917 Bacteria 5094
648 Ga0496114_0134827 3300048917 Bacteria 2134
649 Ga0496121_0035317 3300048924 Bacteria 4482
650 Ga0496124_0002098 3300048927 Bacteria 26914
651 Ga0496125_0004872 3300048928 Bacteria 15234
652 Ga0496125_0020567 3300048928 Bacteria 6192
653 Ga0496125_0051782 3300048928 Bacteria 3382
654 Ga0496126_0049526 3300048929 Bacteria 3835
655 Ga0495682_0041378 3300049460 Bacteria 1689
656 Ga0501034_0000761 3300049571 Bacteria 48401
657 Ga0501034_0187644 3300049571 Bacteria 2030
658 Ga0501034_0391458 3300049571 Bacteria 1314
659 Ga0501043_0000149 3300049579 Bacteria 65122
660 Ga0501046_0000092 3300049580 Bacteria 97456
661 Ga0501047_0000028 3300049581 Bacteria 220279
662 Ga0501048_0000097 3300049582 Bacteria 47728
663 Ga0501198_000039 3300049649 Bacteria 47786
664 Ga0501222_000043 3300049662 Bacteria 47790
665 Ga0501265_002175 3300049762 Bacteria 2227
666 Ga0501281_03204 3300049777 Bacteria 1176
667 Ga0501035_0036476 3300049822 Bacteria 4456
668 Ga0501045_0002894 3300049824 Bacteria 11731
669 nmdc:mga03683_11744_c1 3300050489 Bacteria 3182
670 nmdc:mga03683_121581_c1 3300050489 Bacteria 1161
671 nmdc:mga03683_4370_c1 3300050489 Bacteria 4684
672 nmdc:mga03n38_50977_c1 3300050490 Bacteria 1846
673 nmdc:mga03n38_57588_c1 3300050490 Bacteria 1758
674 nmdc:mga00v17_40775_c1 3300050491 Bacteria 2786
675 nmdc:mga00v17_817_c1 3300050491 Bacteria 16934
676 nmdc:mga00v17_85501_c1 3300050491 Bacteria 1975
677 nmdc:mga0k408_11730_c1 3300050493 Bacteria 4780
678 nmdc:mga0k408_13369_c1 3300050493 Bacteria 4500
679 nmdc:mga0k408_17075_c1 3300050493 Bacteria 4037
680 nmdc:mga0k408_17184_c1 3300050493 Bacteria 4027
681 nmdc:mga0k408_19881_c1 3300050493 Bacteria 3759
682 nmdc:mga0k408_33077_c1 3300050493 Bacteria 2956
683 nmdc:mga0k408_50451_c1 3300050493 Bacteria 2409
684 nmdc:mga0k408_59089_c1 3300050493 Bacteria 2227
685 nmdc:mga0k408_59284_c1 3300050493 Bacteria 2224
686 nmdc:mga0k408_96875_c1 3300050493 Bacteria 1737
687 nmdc:mga06z11_6776_c1 3300050494 Bacteria 4680
688 nmdc:mga07m45_103845_c1 3300050496 Bacteria 1634
689 nmdc:mga07m45_11799_c1 3300050496 Bacteria 4600
690 nmdc:mga07m45_220_c1 3300050496 Bacteria 22633
691 nmdc:mga07m45_23119_c1 3300050496 Bacteria 3396
692 nmdc:mga07m45_8131_c1 3300050496 Bacteria 5377
693 nmdc:mga07m45_85631_c1 3300050496 Bacteria 1802
694 nmdc:mga07m45_98223_c1 3300050496 Bacteria 1681
695 nmdc:mga05p37_129068_c1 3300050507 Bacteria 3103
696 nmdc:mga09592_965_c1 3300050508 Bacteria 22699
697 nmdc:mga0sz30_13382_c1 3300050516 Bacteria 3212
698 Ga0500635_0000129 3300053080 Bacteria 44308
699 Ga0500644_0025707 3300053088 Bacteria 1815
700 Ga0500644_0042148 3300053088 Bacteria 1520
701 Ga0500651_0003537 3300053093 Bacteria 8548
702 Ga0500651_0018573 3300053093 Bacteria 4306
703 Ga0500650_0081160 3300053098 Bacteria 1517
704 Ga0500650_0154431 3300053098 Bacteria 1060
705 Ga0500594_0001531 3300053118 Bacteria 5031
706 Ga0500618_002404 3300053125 Bacteria 7121
707 Ga0500642_0002183 3300053130 Bacteria 5686
708 Ga0500652_000757 3300053131 Bacteria 10901
709 Ga0500655_037154 3300053133 Bacteria 949
710 Ga0500658_0002272 3300053134 Bacteria 7435
711 Ga0500658_0002796 3300053134 Bacteria 6699
712 Ga0500559_0000134 3300053136 Bacteria 56963
713 Ga0500568_0011123 3300053139 Bacteria 4192
714 Ga0500568_0076934 3300053139 Bacteria 1270
715 Ga0500577_0150637 3300053142 Bacteria 986
716 Ga0500619_000137 3300053154 Bacteria 18737
717 Ga0500622_0001329 3300053156 Bacteria 20074
718 Ga0500622_0134851 3300053156 Bacteria 1183
719 Ga0500634_0103218 3300053161 Bacteria 1422
720 Ga0500587_004869 3300053739 Bacteria 1831
721 Ga0500587_005872 3300053739 Bacteria 1641
722 Ga0500661_006420 3300055283 Bacteria 2187
723 Ga0590071_001197 3300059421 Bacteria 7016
724 Ga0587088_003217 3300059508 Bacteria 1956
725 Ga0587067_000317 3300059640 Bacteria 3964
726 Ga0587072_000189 3300059643 Bacteria 5370
727 Ga0501082_0866279 3300060353 Bacteria 790
728 Ga0466962_0003867 3300061719 Bacteria 7154
729 Ga0466962_0009971 3300061719 Bacteria 4556
730 Ga0466962_0022710 3300061719 Bacteria 3015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100103256 Ga0070659_1001032562 215
2 3300046519 Ga0495632_0034350 Ga0495632_0034350_14_718 220
3 3300025303 Ga0209051_1007719 Ga0209051_10077196 223
4 3300002067 JGI24735J21928_10001336 JGI24735J21928_1000133610 224
5 3300002067 JGI24735J21928_10003035 JGI24735J21928_100030356 224
6 3300002067 JGI24735J21928_10004088 JGI24735J21928_100040882 224
7 3300009011 Ga0105251_10001385 Ga0105251_1000138520 224
8 3300027876 Ga0209974_10006645 Ga0209974_100066454 224
9 3300048916 Ga0496113_0330230 Ga0496113_0330230_169_939 224
10 3300031649 Ga0307514_10006986 Ga0307514_100069865 225
11 3300003781 Ga0055536_1001441 Ga0055536_10014415 226
12 3300005289 Ga0065704_10000521 Ga0065704_1000052118 226
13 3300048917 Ga0496114_0022878 Ga0496114_0022878_2520_3200 226
14 3300048929 Ga0496126_0049526 Ga0496126_0049526_1198_1878 226
15 3300005548 Ga0070665_100772606 Ga0070665_1007726061 232
16 3300042876 Ga0451577_0003543 Ga0451577_0003543_2806_3576 233
17 iso_pu_bacteria 2513237150 2513952765 233
18 iso_pu_bacteria 2585428057 2587730066 233
19 iso_pu_bacteria 2596583598 2597032150 233
20 iso_pu_bacteria 2599185178 2599444270 233
21 iso_pu_bacteria 2643221654 2644302002 233
22 iso_pu_bacteria 2834641062 2834641950 233
23 iso_pu_bacteria 2885266251 2885268480 233
24 iso_pu_bacteria 2900577576 2900578811 233
25 iso_pu_bacteria 2901300506 2901301147 233
26 iso_pu_bacteria 2928058823 2928063247 233
27 iso_pu_bacteria 644736347 644747630 233
28 iso_pu_bacteria 8003400568 8003404505 233
29 3300053125 Ga0500618_002404 Ga0500618_002404_96_821 234
30 iso_pu_bacteria 2585428062 2587760233 234
31 3300003841 Ga0055541_1000218 Ga0055541_10002182 235
32 3300025934 Ga0207686_10168180 Ga0207686_101681802 235
33 3300025941 Ga0207711_10128462 Ga0207711_101284623 235
34 3300025986 Ga0207658_10137657 Ga0207658_101376572 235
35 3300026067 Ga0207678_10157820 Ga0207678_101578202 235
36 3300031507 Ga0307509_10192000 Ga0307509_101920002 235
37 3300031730 Ga0307516_10004343 Ga0307516_1000434319 235
38 3300046455 Ga0495603_0002742 Ga0495603_0002742_9639_10370 235
39 3300046459 Ga0495629_0000480 Ga0495629_0000480_5964_6695 235
40 3300046460 Ga0495638_0010534 Ga0495638_0010534_452_1183 235
41 3300046462 Ga0495651_0093157 Ga0495651_0093157_1458_2189 235
42 3300046471 Ga0495650_0002453 Ga0495650_0002453_2909_3640 235
43 3300046473 Ga0495582_0215042 Ga0495582_0215042_158_889 235
44 3300046474 Ga0495605_0001336 Ga0495605_0001336_14542_15273 235
45 3300046475 Ga0495639_0111927 Ga0495639_0111927_498_1229 235
46 3300046476 Ga0495662_0064672 Ga0495662_0064672_597_1328 235
47 3300046507 Ga0495606_0020534 Ga0495606_0020534_3655_4386 235
48 3300046523 Ga0495644_0029675 Ga0495644_0029675_1071_1802 235
49 3300046528 Ga0495642_0033579 Ga0495642_0033579_693_1424 235
50 3300046543 Ga0495645_0009654 Ga0495645_0009654_5897_6628 235
51 3300046559 Ga0495667_0119798 Ga0495667_0119798_669_1400 235
52 3300046616 Ga0495668_0149498 Ga0495668_0149498_51_782 235
53 3300046680 Ga0495646_0084861 Ga0495646_0084861_855_1586 235
54 3300046684 Ga0495669_0108198 Ga0495669_0108198_345_1076 235
55 3300046689 Ga0495613_0356586 Ga0495613_0356586_45_776 235
56 3300047470 Ga0495681_0130243 Ga0495681_0130243_200_931 235
57 3300047673 Ga0495593_0126967 Ga0495593_0126967_411_1142 235
58 3300048903 Ga0496100_0123382 Ga0496100_0123382_946_1677 235
59 3300048904 Ga0496101_0245804 Ga0496101_0245804_333_1064 235
60 3300048904 Ga0496101_0402824 Ga0496101_0402824_217_948 235
61 3300048908 Ga0496105_0029841 Ga0496105_0029841_3248_3979 235
62 3300048908 Ga0496105_0381150 Ga0496105_0381150_238_969 235
63 3300048909 Ga0496106_0004373 Ga0496106_0004373_9566_10297 235
64 3300048910 Ga0496107_0156247 Ga0496107_0156247_912_1643 235
65 3300048914 Ga0496111_0114549 Ga0496111_0114549_956_1687 235
66 3300048917 Ga0496114_0002351 Ga0496114_0002351_6633_7364 235
67 3300060353 Ga0501082_0866279 Ga0501082_0866279_11_754 235
68 3300009174 Ga0105241_10530253 Ga0105241_105302532 236
69 3300013306 Ga0163162_10033348 Ga0163162_100333486 236
70 3300028794 Ga0307515_10103254 Ga0307515_101032545 236
71 3300031456 Ga0307513_10012007 Ga0307513_100120079 236
72 3300047472 Ga0495686_0000042 Ga0495686_0000042_33834_34577 236
73 3300001915 JGI24741J21665_1000156 JGI24741J21665_100015615 237
74 3300001979 JGI24740J21852_10002175 JGI24740J21852_100021754 237
75 3300001979 JGI24740J21852_10003164 JGI24740J21852_100031643 237
76 3300001979 JGI24740J21852_10019148 JGI24740J21852_100191484 237
77 3300002705 JGI25156J39149_1002013 JGI25156J39149_10020135 237
78 3300002738 JGI25154J39366_1001073 JGI25154J39366_10010738 237
79 3300002773 JGI25152J39213_1021263 JGI25152J39213_10212632 237
80 3300002774 JGI25150J39212_1015037 JGI25150J39212_10150372 237
81 3300003187 JGI25151J46595_10002737 JGI25151J46595_100027376 237
82 3300003187 JGI25151J46595_10016772 JGI25151J46595_100167724 237
83 3300003215 JGI25153J46596_10001674 JGI25153J46596_100016742 237
84 3300003215 JGI25153J46596_10021502 JGI25153J46596_100215023 237
85 3300003578 Ga0006562J51391_1072632 Ga0006562J51391_10726322 237
86 3300003752 Ga0055539_1000062 Ga0055539_100006241 237
87 3300003756 Ga0055533_1000522 Ga0055533_100052212 237
88 3300003758 Ga0055532_1000019 Ga0055532_1000019217 237
89 3300003759 Ga0055525_1000592 Ga0055525_10005928 237
90 3300003760 Ga0055527_1000558 Ga0055527_100055810 237
91 3300003761 Ga0055535_1000014 Ga0055535_100001463 237
92 3300003762 Ga0055542_1008756 Ga0055542_10087562 237
93 3300003763 Ga0055529_1000086 Ga0055529_100008643 237
94 3300003771 Ga0055526_1001196 Ga0055526_10011968 237
95 3300003771 Ga0055526_1008504 Ga0055526_10085043 237
96 3300003771 Ga0055526_1011661 Ga0055526_10116613 237
97 3300003773 Ga0055537_1000969 Ga0055537_10009694 237
98 3300003775 Ga0055524_1001551 Ga0055524_10015519 237
99 3300003775 Ga0055524_1015404 Ga0055524_10154043 237
100 3300003781 Ga0055536_1000034 Ga0055536_1000034117 237
101 3300003784 Ga0055534_1001162 Ga0055534_10011629 237
102 3300003784 Ga0055534_1007227 Ga0055534_10072273 237
103 3300003841 Ga0055541_1001407 Ga0055541_10014074 237
104 3300005328 Ga0070676_10120114 Ga0070676_101201142 237
105 3300005339 Ga0070660_100289162 Ga0070660_1002891622 237
106 3300005344 Ga0070661_100000088 Ga0070661_10000008859 237
107 3300005366 Ga0070659_100069361 Ga0070659_1000693612 237
108 3300005367 Ga0070667_100002698 Ga0070667_10000269810 237
109 3300005455 Ga0070663_100000010 Ga0070663_10000001046 237
110 3300005459 Ga0068867_100188007 Ga0068867_1001880072 237
111 3300005543 Ga0070672_100089747 Ga0070672_1000897473 237
112 3300005548 Ga0070665_100184722 Ga0070665_1001847222 237
113 3300005564 Ga0070664_100000005 Ga0070664_100000005154 237
114 3300005577 Ga0068857_100005050 Ga0068857_10000505010 237
115 3300005578 Ga0068854_100000104 Ga0068854_10000010418 237
116 3300005614 Ga0068856_100000054 Ga0068856_10000005447 237
117 3300005616 Ga0068852_100075588 Ga0068852_1000755882 237
118 3300005843 Ga0068860_100147158 Ga0068860_1001471581 237
119 3300006195 Ga0075366_10003640 Ga0075366_100036406 237
120 3300006195 Ga0075366_10073311 Ga0075366_100733112 237
121 3300006353 Ga0075370_10298349 Ga0075370_102983491 237
122 3300009093 Ga0105240_10038201 Ga0105240_100382017 237
123 3300009098 Ga0105245_10140169 Ga0105245_101401692 237
124 3300013100 Ga0157373_10029907 Ga0157373_100299075 237
125 3300013102 Ga0157371_10000103 Ga0157371_1000010367 237
126 3300013104 Ga0157370_10000966 Ga0157370_100009669 237
127 3300013105 Ga0157369_10003969 Ga0157369_100039697 237
128 3300013296 Ga0157374_10454282 Ga0157374_104542822 237
129 3300013306 Ga0163162_10579391 Ga0163162_105793912 237
130 3300013308 Ga0157375_10134869 Ga0157375_101348694 237
131 3300014968 Ga0157379_10020286 Ga0157379_100202868 237
132 3300015261 Ga0182006_1000468 Ga0182006_100046822 237
133 3300015261 Ga0182006_1005546 Ga0182006_10055462 237
134 3300015262 Ga0182007_10040374 Ga0182007_100403741 237
135 3300020069 Ga0197907_11038722 Ga0197907_110387224 237
136 3300020076 Ga0206355_1479823 Ga0206355_14798235 237
137 3300020077 Ga0206351_10121833 Ga0206351_101218333 237
138 3300020080 Ga0206350_11084827 Ga0206350_110848272 237
139 3300020610 Ga0154015_1286480 Ga0154015_128648016 237
140 3300021361 Ga0213872_10000051 Ga0213872_1000005137 237
141 3300021361 Ga0213872_10000074 Ga0213872_1000007418 237
142 3300022467 Ga0224712_10012271 Ga0224712_100122714 237
143 3300025224 Ga0209784_100003 Ga0209784_1000031213 237
144 3300025224 Ga0209784_100328 Ga0209784_1003289 237
145 3300025225 Ga0209566_100002 Ga0209566_1000022167 237
146 3300025225 Ga0209566_100621 Ga0209566_10062115 237
147 3300025225 Ga0209566_100782 Ga0209566_1007829 237
148 3300025226 Ga0209674_100008 Ga0209674_10000818 237
149 3300025226 Ga0209674_100239 Ga0209674_10023941 237
150 3300025228 Ga0209672_100246 Ga0209672_10024619 237
151 3300025229 Ga0209147_100002 Ga0209147_1000021201 237
152 3300025230 Ga0209563_100004 Ga0209563_1000041584 237
153 3300025230 Ga0209563_103216 Ga0209563_1032163 237
154 3300025242 Ga0209258_100002 Ga0209258_1000021201 237
155 3300025245 Ga0207425_1000332 Ga0207425_100033228 237
156 3300025246 Ga0209646_1000019 Ga0209646_100001987 237
157 3300025250 Ga0209026_1001896 Ga0209026_100189611 237
158 3300025253 Ga0209677_100009 Ga0209677_10000948 237
159 3300025253 Ga0209677_106364 Ga0209677_1063644 237
160 3300025254 Ga0209148_1000471 Ga0209148_100047142 237
161 3300025254 Ga0209148_1004089 Ga0209148_10040892 237
162 3300025256 Ga0209759_1001190 Ga0209759_10011908 237
163 3300025256 Ga0209759_1006480 Ga0209759_10064804 237
164 3300025258 Ga0209129_1000012 Ga0209129_1000012500 237
165 3300025263 Ga0209565_1000191 Ga0209565_100019121 237
166 3300025263 Ga0209565_1004996 Ga0209565_10049962 237
167 3300025272 Ga0209455_1000076 Ga0209455_1000076215 237
168 3300025284 Ga0209130_1011141 Ga0209130_10111412 237
169 3300025291 Ga0209675_1000084 Ga0209675_100008419 237
170 3300025291 Ga0209675_1001550 Ga0209675_10015506 237
171 3300025292 Ga0209676_1000014 Ga0209676_1000014266 237
172 3300025294 Ga0209025_1000323 Ga0209025_100032319 237
173 3300025294 Ga0209025_1000363 Ga0209025_100036323 237
174 3300025294 Ga0209025_1009587 Ga0209025_10095874 237
175 3300025295 Ga0209564_1000022 Ga0209564_100002214 237
176 3300025295 Ga0209564_1000953 Ga0209564_100095326 237
177 3300025295 Ga0209564_1001000 Ga0209564_10010009 237
178 3300025297 Ga0209758_1000356 Ga0209758_100035662 237
179 3300025297 Ga0209758_1000708 Ga0209758_100070814 237
180 3300025299 Ga0209256_1000466 Ga0209256_100046636 237
181 3300025299 Ga0209256_1003509 Ga0209256_10035095 237
182 3300025303 Ga0209051_1005150 Ga0209051_10051502 237
183 3300025913 Ga0207695_10033764 Ga0207695_100337647 237
184 3300025919 Ga0207657_10342379 Ga0207657_103423792 237
185 3300025920 Ga0207649_10000098 Ga0207649_1000009819 237
186 3300025923 Ga0207681_10112910 Ga0207681_101129102 237
187 3300025926 Ga0207659_10351705 Ga0207659_103517052 237
188 3300025927 Ga0207687_10136902 Ga0207687_101369022 237
189 3300025932 Ga0207690_10019643 Ga0207690_100196435 237
190 3300025940 Ga0207691_10039297 Ga0207691_100392974 237
191 3300025945 Ga0207679_10000020 Ga0207679_10000020149 237
192 3300025949 Ga0207667_10267199 Ga0207667_102671992 237
193 3300025981 Ga0207640_10000092 Ga0207640_1000009228 237
194 3300025986 Ga0207658_10000596 Ga0207658_1000059626 237
195 3300026067 Ga0207678_10000181 Ga0207678_100001813 237
196 3300026078 Ga0207702_10000017 Ga0207702_10000017149 237
197 3300026089 Ga0207648_10117120 Ga0207648_101171202 237
198 3300026116 Ga0207674_10009965 Ga0207674_1000996510 237
199 3300028379 Ga0268266_10139229 Ga0268266_101392293 237
200 3300028381 Ga0268264_10114353 Ga0268264_101143533 237
201 3300031456 Ga0307513_10046000 Ga0307513_100460002 237
202 3300031548 Ga0307408_100120145 Ga0307408_1001201452 237
203 3300031730 Ga0307516_10176912 Ga0307516_101769122 237
204 3300031731 Ga0307405_10004366 Ga0307405_100043663 237
205 3300031824 Ga0307413_10008901 Ga0307413_100089012 237
206 3300031852 Ga0307410_10073767 Ga0307410_100737673 237
207 3300031852 Ga0307410_10341530 Ga0307410_103415301 237
208 3300031901 Ga0307406_10083144 Ga0307406_100831442 237
209 3300031911 Ga0307412_10081044 Ga0307412_100810442 237
210 3300032002 Ga0307416_100097304 Ga0307416_1000973043 237
211 3300032004 Ga0307414_10130313 Ga0307414_101303132 237
212 3300032005 Ga0307411_10010018 Ga0307411_100100183 237
213 3300035695 Ga0373927_0093092 Ga0373927_0093092_183_938 237
214 3300037312 Ga0395899_0155022 Ga0395899_0155022_622_1368 237
215 3300037418 Ga0395900_0008520 Ga0395900_0008520_986_1732 237
216 3300037471 Ga0395905_0255121 Ga0395905_0255121_401_1147 237
217 3300039447 Ga0436361_0768142 Ga0436361_0768142_1400_2137 237
218 3300039447 Ga0436361_0939166 Ga0436361_0939166_55146_55886 237
219 3300041452 Ga0451793_1769215 Ga0451793_1769215_3747_4508 237
220 3300041503 Ga0451847_0972424 Ga0451847_0972424_245_1006 237
221 3300044656 Ga0466969_0097828 Ga0466969_0097828_186_932 237
222 3300044658 Ga0466972_0033620 Ga0466972_0033620_477_1223 237
223 3300044672 Ga0466982_0062127 Ga0466982_0062127_1236_1982 237
224 3300044693 Ga0466961_0000202 Ga0466961_0000202_36729_37475 237
225 3300044706 Ga0466964_0069619 Ga0466964_0069619_284_1030 237
226 3300044735 Ga0466968_0031325 Ga0466968_0031325_1143_1889 237
227 3300044765 Ga0466970_0004900 Ga0466970_0004900_3493_4239 237
228 3300044842 Ga0466957_0026350 Ga0466957_0026350_2525_3271 237
229 3300044901 Ga0466960_0219898 Ga0466960_0219898_123_869 237
230 3300045051 Ga0451576_0823240 Ga0451576_0823240_96_830 237
231 3300045976 Ga0466967_0127300 Ga0466967_0127300_875_1621 237
232 3300047472 Ga0495686_0068404 Ga0495686_0068404_257_1015 237
233 3300048909 Ga0496106_0025809 Ga0496106_0025809_2596_3354 237
234 3300048928 Ga0496125_0020567 Ga0496125_0020567_2257_3003 237
235 3300049571 Ga0501034_0000761 Ga0501034_0000761_20466_21218 237
236 3300049571 Ga0501034_0187644 Ga0501034_0187644_74_808 237
237 3300050489 nmdc:mga03683_121581_c1 nmdc:mga03683_121581_c1_384_1148 237
238 3300050490 nmdc:mga03n38_50977_c1 nmdc:mga03n38_50977_c1_1070_1831 237
239 3300050493 nmdc:mga0k408_33077_c1 nmdc:mga0k408_33077_c1_351_1115 237
240 3300050493 nmdc:mga0k408_59089_c1 nmdc:mga0k408_59089_c1_870_1634 237
241 3300050496 nmdc:mga07m45_85631_c1 nmdc:mga07m45_85631_c1_214_975 237
242 3300053088 Ga0500644_0025707 Ga0500644_0025707_442_1203 237
243 3300053088 Ga0500644_0042148 Ga0500644_0042148_453_1208 237
244 3300053093 Ga0500651_0003537 Ga0500651_0003537_2878_3639 237
245 3300053098 Ga0500650_0154431 Ga0500650_0154431_89_850 237
246 3300053130 Ga0500642_0002183 Ga0500642_0002183_386_1147 237
247 3300053131 Ga0500652_000757 Ga0500652_000757_6421_7182 237
248 3300053133 Ga0500655_037154 Ga0500655_037154_34_795 237
249 3300053139 Ga0500568_0011123 Ga0500568_0011123_3285_4046 237
250 3300053142 Ga0500577_0150637 Ga0500577_0150637_71_832 237
251 3300053156 Ga0500622_0001329 Ga0500622_0001329_11576_12337 237
252 3300053156 Ga0500622_0134851 Ga0500622_0134851_339_1100 237
253 3300059508 Ga0587088_003217 Ga0587088_003217_514_1260 237
254 3300059640 Ga0587067_000317 Ga0587067_000317_642_1388 237
255 3300059643 Ga0587072_000189 Ga0587072_000189_843_1589 237
256 3300061719 Ga0466962_0009971 Ga0466962_0009971_2526_3272 237
257 iso_pu_bacteria 2643221644 2644248966 237
258 iso_pu_bacteria 2643221660 2644340064 237
259 3300005340 Ga0070689_100474448 Ga0070689_1004744482 238
260 3300005356 Ga0070674_100800113 Ga0070674_1008001131 238
261 3300005548 Ga0070665_100011217 Ga0070665_10001121710 238
262 3300005617 Ga0068859_100445831 Ga0068859_1004458312 238
263 3300005618 Ga0068864_100006013 Ga0068864_1000060137 238
264 3300005618 Ga0068864_100457003 Ga0068864_1004570032 238
265 3300005841 Ga0068863_100010184 Ga0068863_1000101846 238
266 3300006048 Ga0075363_100076420 Ga0075363_1000764202 238
267 3300006048 Ga0075363_100078873 Ga0075363_1000788732 238
268 3300006051 Ga0075364_10205482 Ga0075364_102054821 238
269 3300006178 Ga0075367_10051646 Ga0075367_100516462 238
270 3300006178 Ga0075367_10118351 Ga0075367_101183512 238
271 3300006186 Ga0075369_10050419 Ga0075369_100504192 238
272 3300006195 Ga0075366_10066650 Ga0075366_100666502 238
273 3300006195 Ga0075366_10068126 Ga0075366_100681262 238
274 3300006195 Ga0075366_10087441 Ga0075366_100874412 238
275 3300006353 Ga0075370_10038128 Ga0075370_100381282 238
276 3300006353 Ga0075370_10217247 Ga0075370_102172472 238
277 3300006931 Ga0097620_100445867 Ga0097620_1004458672 238
278 3300009098 Ga0105245_10238116 Ga0105245_102381162 238
279 3300009177 Ga0105248_10502049 Ga0105248_105020492 238
280 3300009545 Ga0105237_10111846 Ga0105237_101118463 238
281 3300013296 Ga0157374_10219015 Ga0157374_102190152 238
282 3300013297 Ga0157378_10066654 Ga0157378_100666542 238
283 3300013306 Ga0163162_10261071 Ga0163162_102610712 238
284 3300014968 Ga0157379_10177099 Ga0157379_101770992 238
285 3300021361 Ga0213872_10020308 Ga0213872_100203081 238
286 3300021361 Ga0213872_10161368 Ga0213872_101613681 238
287 3300025920 Ga0207649_10297286 Ga0207649_102972862 238
288 3300025927 Ga0207687_10072680 Ga0207687_100726803 238
289 3300026023 Ga0207677_10050885 Ga0207677_100508851 238
290 3300026035 Ga0207703_10118572 Ga0207703_101185722 238
291 3300026078 Ga0207702_10209508 Ga0207702_102095082 238
292 3300026088 Ga0207641_10538458 Ga0207641_105384582 238
293 3300026095 Ga0207676_10175468 Ga0207676_101754682 238
294 3300027876 Ga0209974_10005889 Ga0209974_100058893 238
295 3300028379 Ga0268266_10013898 Ga0268266_100138988 238
296 3300028786 Ga0307517_10010987 Ga0307517_100109879 238
297 3300028794 Ga0307515_10000026 Ga0307515_10000026109 238
298 3300028794 Ga0307515_10000051 Ga0307515_10000051199 238
299 3300028794 Ga0307515_10000305 Ga0307515_1000030519 238
300 3300028794 Ga0307515_10004253 Ga0307515_100042533 238
301 3300028794 Ga0307515_10006880 Ga0307515_100068809 238
302 3300028794 Ga0307515_10025690 Ga0307515_100256908 238
303 3300028794 Ga0307515_10095432 Ga0307515_100954322 238
304 3300030522 Ga0307512_10098240 Ga0307512_100982402 238
305 3300031456 Ga0307513_10015459 Ga0307513_100154595 238
306 3300031456 Ga0307513_10039983 Ga0307513_100399834 238
307 3300031456 Ga0307513_10243770 Ga0307513_102437702 238
308 3300031507 Ga0307509_10010432 Ga0307509_1001043210 238
309 3300031507 Ga0307509_10013769 Ga0307509_100137697 238
310 3300031616 Ga0307508_10000098 Ga0307508_1000009810 238
311 3300031616 Ga0307508_10000159 Ga0307508_1000015948 238
312 3300031616 Ga0307508_10313926 Ga0307508_103139262 238
313 3300031649 Ga0307514_10008269 Ga0307514_100082694 238
314 3300031730 Ga0307516_10003066 Ga0307516_100030663 238
315 3300031730 Ga0307516_10030498 Ga0307516_100304982 238
316 3300033179 Ga0307507_10064389 Ga0307507_100643893 238
317 3300035117 Ga0373953_0068769 Ga0373953_0068769_482_1249 238
318 3300036401 Ga0373937_0259585 Ga0373937_0259585_363_1130 238
319 3300039447 Ga0436361_0060431 Ga0436361_0060431_159_899 238
320 3300041452 Ga0451793_0207973 Ga0451793_0207973_1164_1943 238
321 3300041491 Ga0451833_1270813 Ga0451833_1270813_825_1604 238
322 3300041496 Ga0451839_1057768 Ga0451839_1057768_379_1158 238
323 3300041507 Ga0451851_0448762 Ga0451851_0448762_326_1105 238
324 3300041512 Ga0451853_1890114 Ga0451853_1890114_143_922 238
325 3300042435 Ga0439434_0116469 Ga0439434_0116469_39_797 238
326 3300042876 Ga0451577_0178794 Ga0451577_0178794_354_1091 238
327 3300042876 Ga0451577_0576409 Ga0451577_0576409_68_841 238
328 3300044712 Ga0453684_0071583 Ga0453684_0071583_339_1115 238
329 3300046500 Ga0495596_0070535 Ga0495596_0070535_258_998 238
330 3300046506 Ga0495583_0097552 Ga0495583_0097552_335_1099 238
331 3300046512 Ga0495610_0020856 Ga0495610_0020856_2422_3201 238
332 3300046524 Ga0495648_0067868 Ga0495648_0067868_370_1128 238
333 3300046542 Ga0495597_0002614 Ga0495597_0002614_4013_4780 238
334 3300046616 Ga0495668_0065020 Ga0495668_0065020_697_1470 238
335 3300046660 Ga0495625_0002218 Ga0495625_0002218_15314_16093 238
336 3300046660 Ga0495625_0234894 Ga0495625_0234894_196_954 238
337 3300046683 Ga0495658_0073883 Ga0495658_0073883_380_1138 238
338 3300047443 Ga0495687_000078 Ga0495687_000078_74017_74757 238
339 3300047469 Ga0495673_0063698 Ga0495673_0063698_380_1138 238
340 3300047472 Ga0495686_0066710 Ga0495686_0066710_1368_2147 238
341 3300047472 Ga0495686_0081042 Ga0495686_0081042_493_1251 238
342 3300048905 Ga0496102_0008536 Ga0496102_0008536_1473_2234 238
343 3300049571 Ga0501034_0391458 Ga0501034_0391458_59_817 238
344 3300050489 nmdc:mga03683_4370_c1 nmdc:mga03683_4370_c1_1819_2583 238
345 3300050490 nmdc:mga03n38_57588_c1 nmdc:mga03n38_57588_c1_397_1161 238
346 3300050491 nmdc:mga00v17_40775_c1 nmdc:mga00v17_40775_c1_178_942 238
347 3300050493 nmdc:mga0k408_17075_c1 nmdc:mga0k408_17075_c1_1053_1817 238
348 3300050493 nmdc:mga0k408_19881_c1 nmdc:mga0k408_19881_c1_555_1328 238
349 3300050493 nmdc:mga0k408_59284_c1 nmdc:mga0k408_59284_c1_868_1632 238
350 3300050494 nmdc:mga06z11_6776_c1 nmdc:mga06z11_6776_c1_3481_4245 238
351 3300050496 nmdc:mga07m45_103845_c1 nmdc:mga07m45_103845_c1_422_1201 238
352 3300050496 nmdc:mga07m45_11799_c1 nmdc:mga07m45_11799_c1_472_1236 238
353 3300050516 nmdc:mga0sz30_13382_c1 nmdc:mga0sz30_13382_c1_615_1379 238
354 3300053093 Ga0500651_0018573 Ga0500651_0018573_3236_3994 238
355 3300053118 Ga0500594_0001531 Ga0500594_0001531_730_1488 238
356 3300053134 Ga0500658_0002796 Ga0500658_0002796_2328_3107 238
357 3300053136 Ga0500559_0000134 Ga0500559_0000134_21674_22432 238
358 3300053139 Ga0500568_0076934 Ga0500568_0076934_140_904 238
359 3300053154 Ga0500619_000137 Ga0500619_000137_12018_12782 238
360 3300053739 Ga0500587_004869 Ga0500587_004869_366_1124 238
361 3300053739 Ga0500587_005872 Ga0500587_005872_539_1318 238
362 3300003316 rootH1_10147659 rootH1_101476591 239
363 3300003322 rootL2_10000128 rootL2_100001282 239
364 3300003322 rootL2_10220982 rootL2_102209822 239
365 3300003759 Ga0055525_1000011 Ga0055525_1000011457 239
366 3300003759 Ga0055525_1000046 Ga0055525_100004645 239
367 3300005330 Ga0070690_100064119 Ga0070690_1000641192 239
368 3300005334 Ga0068869_100256539 Ga0068869_1002565392 239
369 3300005335 Ga0070666_10045584 Ga0070666_100455842 239
370 3300005335 Ga0070666_10128249 Ga0070666_101282492 239
371 3300005338 Ga0068868_100355522 Ga0068868_1003555221 239
372 3300005347 Ga0070668_100023518 Ga0070668_1000235187 239
373 3300005353 Ga0070669_100055294 Ga0070669_1000552945 239
374 3300005354 Ga0070675_100059896 Ga0070675_1000598962 239
375 3300005354 Ga0070675_100153211 Ga0070675_1001532112 239
376 3300005355 Ga0070671_100070434 Ga0070671_1000704343 239
377 3300005355 Ga0070671_100446201 Ga0070671_1004462012 239
378 3300005356 Ga0070674_100023714 Ga0070674_1000237144 239
379 3300005356 Ga0070674_100053542 Ga0070674_1000535422 239
380 3300005356 Ga0070674_100532635 Ga0070674_1005326351 239
381 3300005367 Ga0070667_100004949 Ga0070667_10000494913 239
382 3300005367 Ga0070667_100152363 Ga0070667_1001523632 239
383 3300005455 Ga0070663_100000172 Ga0070663_1000001725 239
384 3300005456 Ga0070678_100194506 Ga0070678_1001945062 239
385 3300005457 Ga0070662_100345238 Ga0070662_1003452382 239
386 3300005459 Ga0068867_100075085 Ga0068867_1000750853 239
387 3300005467 Ga0070706_100012812 Ga0070706_1000128129 239
388 3300005467 Ga0070706_100154388 Ga0070706_1001543883 239
389 3300005468 Ga0070707_100034845 Ga0070707_1000348453 239
390 3300005471 Ga0070698_100243253 Ga0070698_1002432532 239
391 3300005543 Ga0070672_100004411 Ga0070672_10000441112 239
392 3300005577 Ga0068857_100084990 Ga0068857_1000849903 239
393 3300005577 Ga0068857_100667754 Ga0068857_1006677541 239
394 3300005616 Ga0068852_100007651 Ga0068852_10000765110 239
395 3300005616 Ga0068852_100063109 Ga0068852_1000631094 239
396 3300005617 Ga0068859_100041965 Ga0068859_1000419656 239
397 3300005617 Ga0068859_100442506 Ga0068859_1004425062 239
398 3300005618 Ga0068864_100119003 Ga0068864_1001190032 239
399 3300005618 Ga0068864_100122122 Ga0068864_1001221222 239
400 3300005718 Ga0068866_10018175 Ga0068866_100181752 239
401 3300005719 Ga0068861_100091450 Ga0068861_1000914502 239
402 3300005841 Ga0068863_100052311 Ga0068863_1000523115 239
403 3300005842 Ga0068858_100003457 Ga0068858_10000345712 239
404 3300005843 Ga0068860_100010521 Ga0068860_10001052110 239
405 3300005844 Ga0068862_100046531 Ga0068862_1000465315 239
406 3300006042 Ga0075368_10207221 Ga0075368_102072211 239
407 3300006051 Ga0075364_10187187 Ga0075364_101871872 239
408 3300006177 Ga0075362_10015684 Ga0075362_100156842 239
409 3300006178 Ga0075367_10005261 Ga0075367_100052617 239
410 3300006178 Ga0075367_10056457 Ga0075367_100564573 239
411 3300006195 Ga0075366_10018595 Ga0075366_100185953 239
412 3300006195 Ga0075366_10069318 Ga0075366_100693182 239
413 3300006237 Ga0097621_100018737 Ga0097621_1000187375 239
414 3300006353 Ga0075370_10003212 Ga0075370_100032128 239
415 3300006353 Ga0075370_10007548 Ga0075370_100075486 239
416 3300006353 Ga0075370_10062349 Ga0075370_100623492 239
417 3300006881 Ga0068865_100021548 Ga0068865_1000215485 239
418 3300006931 Ga0097620_100041965 Ga0097620_1000419656 239
419 3300006931 Ga0097620_100442472 Ga0097620_1004424722 239
420 3300009148 Ga0105243_10001208 Ga0105243_100012084 239
421 3300009553 Ga0105249_10071057 Ga0105249_100710572 239
422 3300010375 Ga0105239_10829492 Ga0105239_108294922 239
423 3300013296 Ga0157374_10118342 Ga0157374_101183422 239
424 3300013296 Ga0157374_10131273 Ga0157374_101312732 239
425 3300013306 Ga0163162_10081416 Ga0163162_100814165 239
426 3300013306 Ga0163162_11030625 Ga0163162_110306251 239
427 3300013308 Ga0157375_10178174 Ga0157375_101781743 239
428 3300014326 Ga0157380_10039716 Ga0157380_100397164 239
429 3300014745 Ga0157377_10000016 Ga0157377_1000001677 239
430 3300014969 Ga0157376_10562464 Ga0157376_105624642 239
431 3300017792 Ga0163161_10272440 Ga0163161_102724402 239
432 3300020082 Ga0206353_11440426 Ga0206353_114404261 239
433 3300021361 Ga0213872_10000710 Ga0213872_1000071010 239
434 3300025230 Ga0209563_100005 Ga0209563_100005783 239
435 3300025893 Ga0207682_10003745 Ga0207682_100037457 239
436 3300025903 Ga0207680_10289776 Ga0207680_102897762 239
437 3300025907 Ga0207645_10037411 Ga0207645_100374112 239
438 3300025910 Ga0207684_10047582 Ga0207684_100475822 239
439 3300025923 Ga0207681_10020476 Ga0207681_100204762 239
440 3300025925 Ga0207650_10006156 Ga0207650_1000615610 239
441 3300025926 Ga0207659_10127859 Ga0207659_101278592 239
442 3300025926 Ga0207659_10153708 Ga0207659_101537082 239
443 3300025927 Ga0207687_10064217 Ga0207687_100642174 239
444 3300025931 Ga0207644_10000924 Ga0207644_1000092412 239
445 3300025932 Ga0207690_10167488 Ga0207690_101674882 239
446 3300025933 Ga0207706_10054989 Ga0207706_100549892 239
447 3300025933 Ga0207706_10101818 Ga0207706_101018182 239
448 3300025937 Ga0207669_10076721 Ga0207669_100767212 239
449 3300025938 Ga0207704_10111664 Ga0207704_101116643 239
450 3300025940 Ga0207691_10510833 Ga0207691_105108332 239
451 3300025941 Ga0207711_10006498 Ga0207711_1000649813 239
452 3300025941 Ga0207711_10237146 Ga0207711_102371461 239
453 3300025942 Ga0207689_10003940 Ga0207689_100039403 239
454 3300025961 Ga0207712_10136980 Ga0207712_101369802 239
455 3300025972 Ga0207668_10590580 Ga0207668_105905801 239
456 3300025986 Ga0207658_10031648 Ga0207658_100316482 239
457 3300026023 Ga0207677_10410906 Ga0207677_104109061 239
458 3300026035 Ga0207703_10066736 Ga0207703_100667365 239
459 3300026035 Ga0207703_10444667 Ga0207703_104446672 239
460 3300026067 Ga0207678_10000478 Ga0207678_100004786 239
461 3300026075 Ga0207708_10178413 Ga0207708_101784132 239
462 3300026088 Ga0207641_10064210 Ga0207641_100642103 239
463 3300026088 Ga0207641_10081066 Ga0207641_100810663 239
464 3300026089 Ga0207648_10426260 Ga0207648_104262602 239
465 3300026089 Ga0207648_10559589 Ga0207648_105595892 239
466 3300026095 Ga0207676_10215227 Ga0207676_102152272 239
467 3300026095 Ga0207676_10624225 Ga0207676_106242252 239
468 3300026095 Ga0207676_10625593 Ga0207676_106255932 239
469 3300026116 Ga0207674_10014163 Ga0207674_100141638 239
470 3300026116 Ga0207674_10315985 Ga0207674_103159852 239
471 3300026118 Ga0207675_100038606 Ga0207675_1000386062 239
472 3300026121 Ga0207683_10548935 Ga0207683_105489352 239
473 3300026142 Ga0207698_10059115 Ga0207698_100591153 239
474 3300028380 Ga0268265_10024728 Ga0268265_100247285 239
475 3300028381 Ga0268264_10006835 Ga0268264_100068355 239
476 3300028381 Ga0268264_10633347 Ga0268264_106333472 239
477 3300031239 Ga0265328_10008350 Ga0265328_100083503 239
478 3300031250 Ga0265331_10010000 Ga0265331_100100003 239
479 3300031251 Ga0265327_10000078 Ga0265327_10000078164 239
480 3300031456 Ga0307513_10322523 Ga0307513_103225232 239
481 3300031852 Ga0307410_10167566 Ga0307410_101675663 239
482 3300039447 Ga0436361_0362737 Ga0436361_0362737_2080_2844 239
483 3300039447 Ga0436361_0855507 Ga0436361_0855507_220_972 239
484 3300044656 Ga0466969_0050747 Ga0466969_0050747_116_919 239
485 3300044661 Ga0466975_0331127 Ga0466975_0331127_106_909 239
486 3300044683 Ga0466965_0002967 Ga0466965_0002967_2492_3295 239
487 3300044684 Ga0466966_0003862 Ga0466966_0003862_933_1736 239
488 3300044693 Ga0466961_0016936 Ga0466961_0016936_2126_2929 239
489 3300044706 Ga0466964_0046890 Ga0466964_0046890_817_1620 239
490 3300044735 Ga0466968_0010399 Ga0466968_0010399_117_920 239
491 3300044765 Ga0466970_0075768 Ga0466970_0075768_779_1582 239
492 3300044842 Ga0466957_0005869 Ga0466957_0005869_4850_5653 239
493 3300045049 Ga0466959_0046888 Ga0466959_0046888_1445_2248 239
494 3300045836 Ga0466958_0117702 Ga0466958_0117702_99_902 239
495 3300045976 Ga0466967_0074550 Ga0466967_0074550_1455_2258 239
496 3300045976 Ga0466967_0558205 Ga0466967_0558205_91_909 239
497 3300046475 Ga0495639_0050769 Ga0495639_0050769_638_1423 239
498 3300046519 Ga0495632_0003624 Ga0495632_0003624_5600_6373 239
499 3300046694 Ga0495649_0007041 Ga0495649_0007041_5331_6104 239
500 3300046810 Ga0495660_0016584 Ga0495660_0016584_1746_2519 239
501 3300047443 Ga0495687_010018 Ga0495687_010018_2009_2782 239
502 3300049579 Ga0501043_0000149 Ga0501043_0000149_28063_28818 239
503 3300049580 Ga0501046_0000092 Ga0501046_0000092_36441_37196 239
504 3300049581 Ga0501047_0000028 Ga0501047_0000028_191636_192391 239
505 3300049582 Ga0501048_0000097 Ga0501048_0000097_27457_28212 239
506 3300049762 Ga0501265_002175 Ga0501265_002175_1258_2028 239
507 3300049777 Ga0501281_03204 Ga0501281_03204_17_787 239
508 3300049824 Ga0501045_0002894 Ga0501045_0002894_9864_10619 239
509 3300050493 nmdc:mga0k408_13369_c1 nmdc:mga0k408_13369_c1_3641_4414 239
510 3300050493 nmdc:mga0k408_17184_c1 nmdc:mga0k408_17184_c1_2618_3391 239
511 3300050493 nmdc:mga0k408_50451_c1 nmdc:mga0k408_50451_c1_372_1130 239
512 3300050493 nmdc:mga0k408_96875_c1 nmdc:mga0k408_96875_c1_432_1205 239
513 3300050496 nmdc:mga07m45_220_c1 nmdc:mga07m45_220_c1_14378_15151 239
514 3300050496 nmdc:mga07m45_23119_c1 nmdc:mga07m45_23119_c1_1467_2240 239
515 3300050508 nmdc:mga09592_965_c1 nmdc:mga09592_965_c1_2145_2966 239
516 3300053098 Ga0500650_0081160 Ga0500650_0081160_521_1294 239
517 3300053134 Ga0500658_0002272 Ga0500658_0002272_4537_5310 239
518 3300061719 Ga0466962_0003867 Ga0466962_0003867_5661_6464 239
519 3300002705 JGI25156J39149_1000076 JGI25156J39149_10000767 240
520 3300002738 JGI25154J39366_1003428 JGI25154J39366_10034284 240
521 3300002741 JGI25157J39369_1000037 JGI25157J39369_100003796 240
522 3300003316 rootH1_10048059 rootH1_100480591 240
523 3300003320 rootH2_10001011 rootH2_100010113 240
524 3300003322 rootL2_10116308 rootL2_101163085 240
525 3300003323 rootH1_10146187 rootH1_101461872 240
526 3300003752 Ga0055539_1000180 Ga0055539_100018036 240
527 3300003752 Ga0055539_1003887 Ga0055539_10038873 240
528 3300003756 Ga0055533_1000169 Ga0055533_10001698 240
529 3300003759 Ga0055525_1000526 Ga0055525_100052612 240
530 3300003761 Ga0055535_1000177 Ga0055535_100017755 240
531 3300003763 Ga0055529_1000346 Ga0055529_100034626 240
532 3300005327 Ga0070658_10142750 Ga0070658_101427502 240
533 3300005331 Ga0070670_100052202 Ga0070670_1000522022 240
534 3300005334 Ga0068869_100185772 Ga0068869_1001857722 240
535 3300005339 Ga0070660_100062158 Ga0070660_1000621582 240
536 3300005339 Ga0070660_100563686 Ga0070660_1005636861 240
537 3300005347 Ga0070668_100121311 Ga0070668_1001213112 240
538 3300005354 Ga0070675_100528340 Ga0070675_1005283401 240
539 3300005356 Ga0070674_100348270 Ga0070674_1003482702 240
540 3300005366 Ga0070659_100036638 Ga0070659_1000366384 240
541 3300005367 Ga0070667_100284036 Ga0070667_1002840362 240
542 3300005457 Ga0070662_100295166 Ga0070662_1002951662 240
543 3300005457 Ga0070662_100603149 Ga0070662_1006031491 240
544 3300005543 Ga0070672_100081573 Ga0070672_1000815734 240
545 3300005543 Ga0070672_100155866 Ga0070672_1001558662 240
546 3300005563 Ga0068855_100002721 Ga0068855_10000272110 240
547 3300005563 Ga0068855_100361027 Ga0068855_1003610272 240
548 3300005577 Ga0068857_100001142 Ga0068857_1000011427 240
549 3300005614 Ga0068856_100005635 Ga0068856_1000056354 240
550 3300005719 Ga0068861_100038355 Ga0068861_1000383552 240
551 3300005843 Ga0068860_100938260 Ga0068860_1009382601 240
552 3300006177 Ga0075362_10174037 Ga0075362_101740372 240
553 3300006353 Ga0075370_10260648 Ga0075370_102606482 240
554 3300009093 Ga0105240_10169962 Ga0105240_101699622 240
555 3300009094 Ga0111539_10870216 Ga0111539_108702161 240
556 3300009147 Ga0114129_10118444 Ga0114129_101184444 240
557 3300009148 Ga0105243_10046506 Ga0105243_100465063 240
558 3300009176 Ga0105242_10179872 Ga0105242_101798722 240
559 3300009551 Ga0105238_10256926 Ga0105238_102569262 240
560 3300010375 Ga0105239_10010428 Ga0105239_100104283 240
561 3300013296 Ga0157374_10123028 Ga0157374_101230283 240
562 3300013297 Ga0157378_10196196 Ga0157378_101961962 240
563 3300013306 Ga0163162_10440953 Ga0163162_104409532 240
564 3300013308 Ga0157375_10176788 Ga0157375_101767882 240
565 3300014326 Ga0157380_10111468 Ga0157380_101114682 240
566 3300014745 Ga0157377_10143964 Ga0157377_101439642 240
567 3300015683 Ga0183362_10001 Ga0183362_100011068 240
568 3300021361 Ga0213872_10051886 Ga0213872_100518862 240
569 3300025226 Ga0209674_100165 Ga0209674_10016525 240
570 3300025230 Ga0209563_100137 Ga0209563_10013725 240
571 3300025230 Ga0209563_111937 Ga0209563_1119372 240
572 3300025231 Ga0207427_101146 Ga0207427_1011466 240
573 3300025242 Ga0209258_100146 Ga0209258_100146146 240
574 3300025242 Ga0209258_100973 Ga0209258_1009735 240
575 3300025246 Ga0209646_1000062 Ga0209646_1000062193 240
576 3300025250 Ga0209026_1000026 Ga0209026_100002619 240
577 3300025253 Ga0209677_100124 Ga0209677_10012461 240
578 3300025253 Ga0209677_100191 Ga0209677_10019140 240
579 3300025253 Ga0209677_101539 Ga0209677_1015394 240
580 3300025256 Ga0209759_1000050 Ga0209759_1000050162 240
581 3300025256 Ga0209759_1001102 Ga0209759_10011027 240
582 3300025256 Ga0209759_1001457 Ga0209759_100145710 240
583 3300025256 Ga0209759_1008489 Ga0209759_10084893 240
584 3300025256 Ga0209759_1011545 Ga0209759_10115453 240
585 3300025272 Ga0209455_1000059 Ga0209455_1000059146 240
586 3300025303 Ga0209051_1012820 Ga0209051_10128203 240
587 3300025893 Ga0207682_10075488 Ga0207682_100754882 240
588 3300025899 Ga0207642_10215411 Ga0207642_102154111 240
589 3300025901 Ga0207688_10061796 Ga0207688_100617963 240
590 3300025909 Ga0207705_10196295 Ga0207705_101962952 240
591 3300025909 Ga0207705_10506943 Ga0207705_105069431 240
592 3300025913 Ga0207695_10018539 Ga0207695_100185393 240
593 3300025919 Ga0207657_10010303 Ga0207657_100103033 240
594 3300025919 Ga0207657_10500555 Ga0207657_105005551 240
595 3300025920 Ga0207649_10235460 Ga0207649_102354602 240
596 3300025925 Ga0207650_10098602 Ga0207650_100986022 240
597 3300025925 Ga0207650_10584120 Ga0207650_105841201 240
598 3300025926 Ga0207659_10099075 Ga0207659_100990752 240
599 3300025933 Ga0207706_10071708 Ga0207706_100717083 240
600 3300025933 Ga0207706_10401590 Ga0207706_104015901 240
601 3300025935 Ga0207709_10020701 Ga0207709_100207013 240
602 3300025937 Ga0207669_10163304 Ga0207669_101633042 240
603 3300025949 Ga0207667_10001993 Ga0207667_100019938 240
604 3300025949 Ga0207667_10539739 Ga0207667_105397392 240
605 3300025960 Ga0207651_10000893 Ga0207651_100008933 240
606 3300026078 Ga0207702_10000573 Ga0207702_1000057319 240
607 3300026116 Ga0207674_10001842 Ga0207674_1000184212 240
608 3300026118 Ga0207675_100036720 Ga0207675_1000367204 240
609 3300026118 Ga0207675_100122801 Ga0207675_1001228013 240
610 3300026121 Ga0207683_10442906 Ga0207683_104429062 240
611 3300026142 Ga0207698_10236080 Ga0207698_102360802 240
612 3300028379 Ga0268266_10435893 Ga0268266_104358932 240
613 3300028381 Ga0268264_10599936 Ga0268264_105999362 240
614 3300028666 Ga0265336_10000119 Ga0265336_1000011942 240
615 3300029957 Ga0265324_10009959 Ga0265324_100099592 240
616 3300030522 Ga0307512_10024522 Ga0307512_100245223 240
617 3300031456 Ga0307513_10064266 Ga0307513_100642664 240
618 3300031507 Ga0307509_10001286 Ga0307509_100012868 240
619 3300031730 Ga0307516_10002826 Ga0307516_100028266 240
620 3300031838 Ga0307518_10235322 Ga0307518_102353222 240
621 3300033180 Ga0307510_10002924 Ga0307510_100029248 240
622 3300037466 Ga0395898_0134229 Ga0395898_0134229_717_1502 240
623 3300038443 Ga0395901_0001599 Ga0395901_0001599_21950_22735 240
624 3300039447 Ga0436361_0180496 Ga0436361_0180496_431_1207 240
625 3300045051 Ga0451576_0024224 Ga0451576_0024224_3113_3871 240
626 3300046454 Ga0495592_0000205 Ga0495592_0000205_44732_45499 240
627 3300046462 Ga0495651_0115987 Ga0495651_0115987_879_1664 240
628 3300046506 Ga0495583_0000585 Ga0495583_0000585_20606_21391 240
629 3300046507 Ga0495606_0005296 Ga0495606_0005296_9202_9987 240
630 3300046616 Ga0495668_0020891 Ga0495668_0020891_1432_2217 240
631 3300046660 Ga0495625_0051677 Ga0495625_0051677_2119_2904 240
632 3300046684 Ga0495669_0020999 Ga0495669_0020999_1553_2338 240
633 3300046694 Ga0495649_0008123 Ga0495649_0008123_3559_4344 240
634 3300047443 Ga0495687_000473 Ga0495687_000473_23792_24586 240
635 3300048907 Ga0496104_0008971 Ga0496104_0008971_4448_5212 240
636 3300048924 Ga0496121_0035317 Ga0496121_0035317_3030_3794 240
637 3300048927 Ga0496124_0002098 Ga0496124_0002098_12805_13569 240
638 3300048928 Ga0496125_0004872 Ga0496125_0004872_13136_13900 240
639 3300049460 Ga0495682_0041378 Ga0495682_0041378_578_1345 240
640 3300050507 nmdc:mga05p37_129068_c1 nmdc:mga05p37_129068_c1_790_1578 240
641 3300053080 Ga0500635_0000129 Ga0500635_0000129_43397_44182 240
642 3300055283 Ga0500661_006420 Ga0500661_006420_555_1340 240
643 iso_pu_bacteria 2524614729 2525556656 240
644 iso_pu_bacteria 2627854209 2630648252 240
645 3300003322 rootL2_10292878 rootL2_102928782 241
646 3300003775 Ga0055524_1000182 Ga0055524_100018255 241
647 3300003791 Ga0055530_10003939 Ga0055530_100039393 241
648 3300003792 Ga0055540_1000233 Ga0055540_10002336 241
649 3300003794 Ga0055531_10021528 Ga0055531_100215283 241
650 3300005339 Ga0070660_100126394 Ga0070660_1001263942 241
651 3300005344 Ga0070661_100002048 Ga0070661_1000020486 241
652 3300005366 Ga0070659_100000684 Ga0070659_10000068417 241
653 3300005459 Ga0068867_100000070 Ga0068867_1000000706 241
654 3300005564 Ga0070664_100011468 Ga0070664_1000114682 241
655 3300005578 Ga0068854_100422408 Ga0068854_1004224081 241
656 3300006042 Ga0075368_10115570 Ga0075368_101155702 241
657 3300006946 Ga0079104_1000333 Ga0079104_10003338 241
658 3300009093 Ga0105240_10052231 Ga0105240_100522313 241
659 3300009098 Ga0105245_10204521 Ga0105245_102045212 241
660 3300009148 Ga0105243_10017699 Ga0105243_100176993 241
661 3300009545 Ga0105237_10129910 Ga0105237_101299103 241
662 3300010375 Ga0105239_10149036 Ga0105239_101490362 241
663 3300025291 Ga0209675_1008884 Ga0209675_10088843 241
664 3300025298 Ga0209050_1002670 Ga0209050_10026707 241
665 3300025298 Ga0209050_1016415 Ga0209050_10164153 241
666 3300025299 Ga0209256_1000024 Ga0209256_1000024436 241
667 3300025303 Ga0209051_1000155 Ga0209051_10001557 241
668 3300025304 Ga0209257_1000236 Ga0209257_10002367 241
669 3300025920 Ga0207649_10005919 Ga0207649_100059196 241
670 3300025932 Ga0207690_10005848 Ga0207690_100058483 241
671 3300025935 Ga0207709_10002246 Ga0207709_100022464 241
672 3300025945 Ga0207679_10003912 Ga0207679_100039127 241
673 3300025945 Ga0207679_10059750 Ga0207679_100597503 241
674 3300026089 Ga0207648_10000412 Ga0207648_100004126 241
675 3300027111 Ga0209281_1000322 Ga0209281_10003228 241
676 3300027695 Ga0209966_1000005 Ga0209966_100000579 241
677 3300028379 Ga0268266_10629987 Ga0268266_106299871 241
678 3300028794 Ga0307515_10137858 Ga0307515_101378582 241
679 3300039447 Ga0436361_0146317 Ga0436361_0146317_5267_6034 241
680 3300042531 Ga0450918_000287 Ga0450918_000287_5170_5937 241
681 3300042876 Ga0451577_0186179 Ga0451577_0186179_657_1436 241
682 3300046471 Ga0495650_0010155 Ga0495650_0010155_1383_2141 241
683 3300046535 Ga0495586_0007585 Ga0495586_0007585_3418_4200 241
684 3300047472 Ga0495686_0007475 Ga0495686_0007475_4132_4923 241
685 3300048917 Ga0496114_0134827 Ga0496114_0134827_161_928 241
686 3300048928 Ga0496125_0051782 Ga0496125_0051782_2452_3216 241
687 3300050489 nmdc:mga03683_11744_c1 nmdc:mga03683_11744_c1_1563_2363 241
688 3300050491 nmdc:mga00v17_85501_c1 nmdc:mga00v17_85501_c1_786_1586 241
689 3300050493 nmdc:mga0k408_11730_c1 nmdc:mga0k408_11730_c1_1531_2331 241
690 3300050496 nmdc:mga07m45_8131_c1 nmdc:mga07m45_8131_c1_2446_3246 241
691 3300053161 Ga0500634_0103218 Ga0500634_0103218_44_799 241
692 3300005355 Ga0070671_100011544 Ga0070671_1000115444 242
693 3300009093 Ga0105240_10050723 Ga0105240_100507232 242
694 3300009174 Ga0105241_10566064 Ga0105241_105660642 242
695 3300009177 Ga0105248_10001394 Ga0105248_1000139418 242
696 3300009545 Ga0105237_10002681 Ga0105237_1000268110 242
697 3300009551 Ga0105238_10010268 Ga0105238_100102682 242
698 3300010375 Ga0105239_10001896 Ga0105239_1000189613 242
699 3300025911 Ga0207654_10385906 Ga0207654_103859062 242
700 3300025913 Ga0207695_10037040 Ga0207695_100370406 242
701 3300025914 Ga0207671_10002325 Ga0207671_1000232519 242
702 3300025923 Ga0207681_10065945 Ga0207681_100659453 242
703 3300025931 Ga0207644_10166966 Ga0207644_101669662 242
704 3300026041 Ga0207639_10083956 Ga0207639_100839562 242
705 3300037418 Ga0395900_0000050 Ga0395900_0000050_222122_222919 242
706 3300037466 Ga0395898_0000817 Ga0395898_0000817_49723_50520 242
707 3300044656 Ga0466969_0023854 Ga0466969_0023854_2184_2954 242
708 3300044658 Ga0466972_0116790 Ga0466972_0116790_462_1217 242
709 3300044683 Ga0466965_0024197 Ga0466965_0024197_1749_2504 242
710 3300044683 Ga0466965_0045731 Ga0466965_0045731_282_1037 242
711 3300044684 Ga0466966_0005496 Ga0466966_0005496_5096_5866 242
712 3300044693 Ga0466961_0012612 Ga0466961_0012612_3144_3914 242
713 3300044706 Ga0466964_0004693 Ga0466964_0004693_3119_3889 242
714 3300044719 Ga0466971_0016744 Ga0466971_0016744_601_1371 242
715 3300044765 Ga0466970_0079395 Ga0466970_0079395_636_1406 242
716 3300045049 Ga0466959_0000285 Ga0466959_0000285_188_958 242
717 3300045976 Ga0466967_0011318 Ga0466967_0011318_1867_2637 242
718 3300048911 Ga0496108_0147760 Ga0496108_0147760_155_925 242
719 3300048912 Ga0496109_0098397 Ga0496109_0098397_803_1573 242
720 3300048913 Ga0496110_0204149 Ga0496110_0204149_283_1053 242
721 3300048915 Ga0496112_0013286 Ga0496112_0013286_3064_3834 242
722 3300049649 Ga0501198_000039 Ga0501198_000039_44790_45605 242
723 3300049662 Ga0501222_000043 Ga0501222_000043_44790_45605 242
724 3300049822 Ga0501035_0036476 Ga0501035_0036476_2415_3185 242
725 3300059421 Ga0590071_001197 Ga0590071_001197_2585_3349 242
726 3300061719 Ga0466962_0022710 Ga0466962_0022710_1292_2062 242
727 3300005457 Ga0070662_100013398 Ga0070662_1000133985 243
728 3300006353 Ga0075370_10016620 Ga0075370_100166203 243
729 3300025933 Ga0207706_10005864 Ga0207706_1000586411 243
730 3300026142 Ga0207698_10305646 Ga0207698_103056462 243
731 3300037471 Ga0395905_0013384 Ga0395905_0013384_2362_3120 243
732 3300037471 Ga0395905_0386006 Ga0395905_0386006_196_966 243
733 3300044656 Ga0466969_0025097 Ga0466969_0025097_1823_2608 243
734 3300044658 Ga0466972_0000564 Ga0466972_0000564_13386_14261 243
735 3300044658 Ga0466972_0047073 Ga0466972_0047073_889_1659 243
736 3300044683 Ga0466965_0018420 Ga0466965_0018420_1520_2305 243
737 3300044684 Ga0466966_0076484 Ga0466966_0076484_890_1675 243
738 3300044693 Ga0466961_0000655 Ga0466961_0000655_16800_17585 243
739 3300044719 Ga0466971_0011261 Ga0466971_0011261_890_1675 243
740 3300044765 Ga0466970_0271794 Ga0466970_0271794_148_933 243
741 3300045049 Ga0466959_0044517 Ga0466959_0044517_2116_2901 243
742 3300050496 nmdc:mga07m45_98223_c1 nmdc:mga07m45_98223_c1_60_818 243
743 iso_pu_bacteria 2894414249 2894415630 243
744 iso_pu_bacteria 2643221579 2643907752 244
745 iso_pu_bacteria 2643221581 2643916041 244
746 iso_pu_bacteria 2923516293 2923518430 244
747 3300006051 Ga0075364_10000093 Ga0075364_1000009326 245
748 3300050491 nmdc:mga00v17_817_c1 nmdc:mga00v17_817_c1_14366_15103 245
749 2162886007 SwRhRL2b_contig_1242637 SwRhRL2b_0867.00001310 248
750 3300025292 Ga0209676_1000086 Ga0209676_1000086227 248
751 3300032004 Ga0307414_10184698 Ga0307414_101846982 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

73

248

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9687 4 230
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.965 4 230
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.96 6 230
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9593 4 230
2z3n-assembly1.cif.gz_B complex structure of lf-transferase and peptide b 0.9486 4 230
ID Description Score Start End Superfamily
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.949 65 230 3.40.630.70
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9367 4 64 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9318 4 64 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9174 4 64 3.30.70.3550
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9079 4 64 3.30.70.3550
ID Description Score Start End GO Terms
AF-A0A518N0Z5-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.99 2 245 GO:0005737
GO:0008914
GO:0030163
AF-A0A7T8MQG1-F1-model_v4 deleted 0.988 2 243
AF-A0A4V1KQN6-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9844 30 217 GO:0005737
GO:0008914
GO:0030163
AF-Q7MAC4-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9839 16 224 GO:0005737
GO:0008914
GO:0030163
AF-A0A2M7WP89-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.983 14 217 GO:0005737
GO:0008914
GO:0030163

Feature Viewer

pLDDT pTM Quality
91.11 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map