F479125
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 751 | 382 | 730 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0000564|Ga0466972_0000564_13386_14261 |
| Length | 291 |
| Sequence | MGRIVSSATMPPHRLSAAVSFRKPSSSSESATMQHSPIIWLDDEAQPLPPSALALGPASEAPGLLAAGGRLSVARLTEAYSQGVFPWYSSGQPVLWWSPDPRMVLPVAEFKLSRSLRKTLQKFIRTPGCEVRIDSAFERVIRACAGTKRDGQQGTWIVPEMIQAYTAWHKAGRVHSVETWIDGELAGGLYGVSLGRMFFGESMFSHRTDASKIALAALICFCREHRIPLIDCQQKTSHLASMGAREIPRAHFERHLSLTLGAAPVRDWSYDVSLWEHIGLKAASALPEDPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 7 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 8 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 9 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 10 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 11 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 12 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 13 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 14 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 15 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 16 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 17 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 18 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 19 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 20 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 21 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 258 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 259 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 260 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 268 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 343 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 344 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 345 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 358 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 361 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 365 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 366 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 372 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 374 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 375 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 376 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 382 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.74 |
| Metatranscriptomes | 1.46 |
| Isolates | 2.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.3 |
| Nodule | 0.67 |
| Rhizoplane | 2.93 |
| Rhizosphere | 62.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1242637 | 2162886007 | Bacteria | 3450 |
| 2 | JGI24741J21665_1000156 | 3300001915 | Bacteria | 19419 |
| 3 | JGI24740J21852_10002175 | 3300001979 | Bacteria | 8963 |
| 4 | JGI24740J21852_10003164 | 3300001979 | Bacteria | 7264 |
| 5 | JGI24740J21852_10019148 | 3300001979 | Bacteria | 2416 |
| 6 | JGI24735J21928_10001336 | 3300002067 | Bacteria | 8727 |
| 7 | JGI24735J21928_10003035 | 3300002067 | Bacteria | 5760 |
| 8 | JGI24735J21928_10004088 | 3300002067 | Bacteria | 4925 |
| 9 | JGI25156J39149_1000076 | 3300002705 | Bacteria | 76265 |
| 10 | JGI25156J39149_1002013 | 3300002705 | Bacteria | 7769 |
| 11 | JGI25154J39366_1001073 | 3300002738 | Bacteria | 10769 |
| 12 | JGI25154J39366_1003428 | 3300002738 | Bacteria | 3334 |
| 13 | JGI25157J39369_1000037 | 3300002741 | Bacteria | 131578 |
| 14 | JGI25152J39213_1021263 | 3300002773 | Bacteria | 1141 |
| 15 | JGI25150J39212_1015037 | 3300002774 | Bacteria | 1299 |
| 16 | JGI25151J46595_10002737 | 3300003187 | Bacteria | 10278 |
| 17 | JGI25151J46595_10016772 | 3300003187 | Bacteria | 3195 |
| 18 | JGI25153J46596_10001674 | 3300003215 | Bacteria | 13142 |
| 19 | JGI25153J46596_10021502 | 3300003215 | Bacteria | 2403 |
| 20 | rootH1_10048059 | 3300003316 | Bacteria | 2400 |
| 21 | rootH1_10147659 | 3300003316 | Bacteria | 1286 |
| 22 | rootH2_10001011 | 3300003320 | Bacteria | 4777 |
| 23 | rootL2_10000128 | 3300003322 | Bacteria | 2760 |
| 24 | rootL2_10116308 | 3300003322 | Bacteria | 3265 |
| 25 | rootL2_10220982 | 3300003322 | Bacteria | 1171 |
| 26 | rootL2_10292878 | 3300003322 | Bacteria | 1491 |
| 27 | rootH1_10146187 | 3300003323 | Bacteria | 1509 |
| 28 | Ga0006562J51391_1072632 | 3300003578 | Bacteria | 1680 |
| 29 | Ga0055539_1000062 | 3300003752 | Bacteria | 141171 |
| 30 | Ga0055539_1000180 | 3300003752 | Bacteria | 53702 |
| 31 | Ga0055539_1003887 | 3300003752 | Bacteria | 2029 |
| 32 | Ga0055533_1000169 | 3300003756 | Bacteria | 59989 |
| 33 | Ga0055533_1000522 | 3300003756 | Bacteria | 13873 |
| 34 | Ga0055532_1000019 | 3300003758 | Bacteria | 286358 |
| 35 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 36 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 37 | Ga0055525_1000526 | 3300003759 | Bacteria | 18471 |
| 38 | Ga0055525_1000592 | 3300003759 | Bacteria | 15701 |
| 39 | Ga0055527_1000558 | 3300003760 | Bacteria | 12374 |
| 40 | Ga0055535_1000014 | 3300003761 | Bacteria | 286358 |
| 41 | Ga0055535_1000177 | 3300003761 | Bacteria | 68502 |
| 42 | Ga0055542_1008756 | 3300003762 | Bacteria | 1957 |
| 43 | Ga0055529_1000086 | 3300003763 | Bacteria | 140681 |
| 44 | Ga0055529_1000346 | 3300003763 | Bacteria | 51499 |
| 45 | Ga0055526_1001196 | 3300003771 | Bacteria | 18739 |
| 46 | Ga0055526_1008504 | 3300003771 | Bacteria | 5111 |
| 47 | Ga0055526_1011661 | 3300003771 | Bacteria | 3932 |
| 48 | Ga0055537_1000969 | 3300003773 | Bacteria | 13076 |
| 49 | Ga0055524_1000182 | 3300003775 | Bacteria | 70730 |
| 50 | Ga0055524_1001551 | 3300003775 | Bacteria | 12948 |
| 51 | Ga0055524_1015404 | 3300003775 | Bacteria | 2790 |
| 52 | Ga0055536_1000034 | 3300003781 | Bacteria | 148178 |
| 53 | Ga0055536_1001441 | 3300003781 | Bacteria | 14355 |
| 54 | Ga0055534_1001162 | 3300003784 | Bacteria | 11107 |
| 55 | Ga0055534_1007227 | 3300003784 | Bacteria | 2680 |
| 56 | Ga0055530_10003939 | 3300003791 | Bacteria | 8036 |
| 57 | Ga0055540_1000233 | 3300003792 | Bacteria | 51303 |
| 58 | Ga0055531_10021528 | 3300003794 | Bacteria | 2497 |
| 59 | Ga0055541_1000218 | 3300003841 | Bacteria | 23615 |
| 60 | Ga0055541_1001407 | 3300003841 | Bacteria | 5220 |
| 61 | Ga0065704_10000521 | 3300005289 | Bacteria | 27858 |
| 62 | Ga0070658_10142750 | 3300005327 | Bacteria | 2001 |
| 63 | Ga0070676_10120114 | 3300005328 | Bacteria | 1648 |
| 64 | Ga0070690_100064119 | 3300005330 | Bacteria | 2372 |
| 65 | Ga0070670_100052202 | 3300005331 | Bacteria | 3511 |
| 66 | Ga0068869_100185772 | 3300005334 | Bacteria | 1632 |
| 67 | Ga0068869_100256539 | 3300005334 | Bacteria | 1398 |
| 68 | Ga0070666_10045584 | 3300005335 | Bacteria | 2939 |
| 69 | Ga0070666_10128249 | 3300005335 | Bacteria | 1761 |
| 70 | Ga0068868_100355522 | 3300005338 | Bacteria | 1255 |
| 71 | Ga0070660_100062158 | 3300005339 | Bacteria | 2900 |
| 72 | Ga0070660_100126394 | 3300005339 | Bacteria | 2043 |
| 73 | Ga0070660_100289162 | 3300005339 | Bacteria | 1342 |
| 74 | Ga0070660_100563686 | 3300005339 | Bacteria | 951 |
| 75 | Ga0070689_100474448 | 3300005340 | Bacteria | 1068 |
| 76 | Ga0070661_100000088 | 3300005344 | Bacteria | 73636 |
| 77 | Ga0070661_100002048 | 3300005344 | Bacteria | 13895 |
| 78 | Ga0070668_100023518 | 3300005347 | Bacteria | 4661 |
| 79 | Ga0070668_100121311 | 3300005347 | Bacteria | 2090 |
| 80 | Ga0070669_100055294 | 3300005353 | Bacteria | 2908 |
| 81 | Ga0070675_100059896 | 3300005354 | Bacteria | 3142 |
| 82 | Ga0070675_100153211 | 3300005354 | Bacteria | 1977 |
| 83 | Ga0070675_100528340 | 3300005354 | Bacteria | 1065 |
| 84 | Ga0070671_100011544 | 3300005355 | Bacteria | 7104 |
| 85 | Ga0070671_100070434 | 3300005355 | Bacteria | 2917 |
| 86 | Ga0070671_100446201 | 3300005355 | Bacteria | 1110 |
| 87 | Ga0070674_100023714 | 3300005356 | Bacteria | 3975 |
| 88 | Ga0070674_100053542 | 3300005356 | Bacteria | 2787 |
| 89 | Ga0070674_100348270 | 3300005356 | Bacteria | 1196 |
| 90 | Ga0070674_100532635 | 3300005356 | Bacteria | 983 |
| 91 | Ga0070674_100800113 | 3300005356 | Bacteria | 814 |
| 92 | Ga0070659_100000684 | 3300005366 | Bacteria | 24663 |
| 93 | Ga0070659_100036638 | 3300005366 | Bacteria | 3824 |
| 94 | Ga0070659_100069361 | 3300005366 | Bacteria | 2798 |
| 95 | Ga0070659_100103256 | 3300005366 | Bacteria | 2296 |
| 96 | Ga0070667_100002698 | 3300005367 | Bacteria | 15368 |
| 97 | Ga0070667_100004949 | 3300005367 | Bacteria | 11163 |
| 98 | Ga0070667_100152363 | 3300005367 | Bacteria | 2031 |
| 99 | Ga0070667_100284036 | 3300005367 | Bacteria | 1487 |
| 100 | Ga0070663_100000010 | 3300005455 | Bacteria | 158193 |
| 101 | Ga0070663_100000172 | 3300005455 | Bacteria | 32702 |
| 102 | Ga0070678_100194506 | 3300005456 | Bacteria | 1670 |
| 103 | Ga0070662_100013398 | 3300005457 | Bacteria | 5456 |
| 104 | Ga0070662_100295166 | 3300005457 | Bacteria | 1315 |
| 105 | Ga0070662_100345238 | 3300005457 | Bacteria | 1218 |
| 106 | Ga0070662_100603149 | 3300005457 | Bacteria | 924 |
| 107 | Ga0068867_100000070 | 3300005459 | Bacteria | 61892 |
| 108 | Ga0068867_100075085 | 3300005459 | Bacteria | 2535 |
| 109 | Ga0068867_100188007 | 3300005459 | Bacteria | 1646 |
| 110 | Ga0070706_100012812 | 3300005467 | Bacteria | 7761 |
| 111 | Ga0070706_100154388 | 3300005467 | Bacteria | 2143 |
| 112 | Ga0070707_100034845 | 3300005468 | Bacteria | 4800 |
| 113 | Ga0070698_100243253 | 3300005471 | Bacteria | 1732 |
| 114 | Ga0070672_100004411 | 3300005543 | Bacteria | 9209 |
| 115 | Ga0070672_100081573 | 3300005543 | Bacteria | 2593 |
| 116 | Ga0070672_100089747 | 3300005543 | Bacteria | 2477 |
| 117 | Ga0070672_100155866 | 3300005543 | Bacteria | 1892 |
| 118 | Ga0070665_100011217 | 3300005548 | Bacteria | 9061 |
| 119 | Ga0070665_100184722 | 3300005548 | Bacteria | 2086 |
| 120 | Ga0070665_100772606 | 3300005548 | Bacteria | 974 |
| 121 | Ga0068855_100002721 | 3300005563 | Bacteria | 21787 |
| 122 | Ga0068855_100361027 | 3300005563 | Bacteria | 1598 |
| 123 | Ga0070664_100000005 | 3300005564 | Bacteria | 222746 |
| 124 | Ga0070664_100011468 | 3300005564 | Bacteria | 7193 |
| 125 | Ga0068857_100001142 | 3300005577 | Bacteria | 20694 |
| 126 | Ga0068857_100005050 | 3300005577 | Bacteria | 11209 |
| 127 | Ga0068857_100084990 | 3300005577 | Bacteria | 2827 |
| 128 | Ga0068857_100667754 | 3300005577 | Bacteria | 986 |
| 129 | Ga0068854_100000104 | 3300005578 | Bacteria | 58909 |
| 130 | Ga0068854_100422408 | 3300005578 | Bacteria | 1108 |
| 131 | Ga0068856_100000054 | 3300005614 | Bacteria | 104246 |
| 132 | Ga0068856_100005635 | 3300005614 | Bacteria | 12324 |
| 133 | Ga0068852_100007651 | 3300005616 | Bacteria | 7899 |
| 134 | Ga0068852_100063109 | 3300005616 | Bacteria | 3225 |
| 135 | Ga0068852_100075588 | 3300005616 | Bacteria | 2972 |
| 136 | Ga0068859_100041965 | 3300005617 | Bacteria | 4595 |
| 137 | Ga0068859_100442506 | 3300005617 | Bacteria | 1396 |
| 138 | Ga0068859_100445831 | 3300005617 | Bacteria | 1390 |
| 139 | Ga0068864_100006013 | 3300005618 | Bacteria | 9963 |
| 140 | Ga0068864_100119003 | 3300005618 | Bacteria | 2359 |
| 141 | Ga0068864_100122122 | 3300005618 | Bacteria | 2330 |
| 142 | Ga0068864_100457003 | 3300005618 | Bacteria | 1222 |
| 143 | Ga0068866_10018175 | 3300005718 | Bacteria | 3174 |
| 144 | Ga0068861_100038355 | 3300005719 | Bacteria | 3566 |
| 145 | Ga0068861_100091450 | 3300005719 | Bacteria | 2402 |
| 146 | Ga0068863_100010184 | 3300005841 | Bacteria | 9142 |
| 147 | Ga0068863_100052311 | 3300005841 | Bacteria | 3871 |
| 148 | Ga0068858_100003457 | 3300005842 | Bacteria | 15673 |
| 149 | Ga0068860_100010521 | 3300005843 | Bacteria | 9145 |
| 150 | Ga0068860_100147158 | 3300005843 | Bacteria | 2267 |
| 151 | Ga0068860_100938260 | 3300005843 | Bacteria | 882 |
| 152 | Ga0068862_100046531 | 3300005844 | Bacteria | 3701 |
| 153 | Ga0075368_10115570 | 3300006042 | Bacteria | 1108 |
| 154 | Ga0075368_10207221 | 3300006042 | Bacteria | 830 |
| 155 | Ga0075363_100076420 | 3300006048 | Bacteria | 1826 |
| 156 | Ga0075363_100078873 | 3300006048 | Bacteria | 1798 |
| 157 | Ga0075364_10000093 | 3300006051 | Bacteria | 36230 |
| 158 | Ga0075364_10187187 | 3300006051 | Bacteria | 1402 |
| 159 | Ga0075364_10205482 | 3300006051 | Bacteria | 1335 |
| 160 | Ga0075362_10015684 | 3300006177 | Bacteria | 3086 |
| 161 | Ga0075362_10174037 | 3300006177 | Bacteria | 1041 |
| 162 | Ga0075367_10005261 | 3300006178 | Bacteria | 6398 |
| 163 | Ga0075367_10051646 | 3300006178 | Bacteria | 2430 |
| 164 | Ga0075367_10056457 | 3300006178 | Bacteria | 2333 |
| 165 | Ga0075367_10118351 | 3300006178 | Bacteria | 1631 |
| 166 | Ga0075369_10050419 | 3300006186 | Bacteria | 1800 |
| 167 | Ga0075366_10003640 | 3300006195 | Bacteria | 8167 |
| 168 | Ga0075366_10018595 | 3300006195 | Bacteria | 4013 |
| 169 | Ga0075366_10066650 | 3300006195 | Bacteria | 2142 |
| 170 | Ga0075366_10068126 | 3300006195 | Bacteria | 2118 |
| 171 | Ga0075366_10069318 | 3300006195 | Bacteria | 2099 |
| 172 | Ga0075366_10073311 | 3300006195 | Bacteria | 2040 |
| 173 | Ga0075366_10087441 | 3300006195 | Bacteria | 1865 |
| 174 | Ga0097621_100018737 | 3300006237 | Bacteria | 5295 |
| 175 | Ga0075370_10003212 | 3300006353 | Bacteria | 7738 |
| 176 | Ga0075370_10007548 | 3300006353 | Bacteria | 5543 |
| 177 | Ga0075370_10016620 | 3300006353 | Bacteria | 3960 |
| 178 | Ga0075370_10038128 | 3300006353 | Bacteria | 2704 |
| 179 | Ga0075370_10062349 | 3300006353 | Bacteria | 2124 |
| 180 | Ga0075370_10217247 | 3300006353 | Bacteria | 1129 |
| 181 | Ga0075370_10260648 | 3300006353 | Bacteria | 1028 |
| 182 | Ga0075370_10298349 | 3300006353 | Bacteria | 958 |
| 183 | Ga0068865_100021548 | 3300006881 | Bacteria | 4192 |
| 184 | Ga0097620_100041965 | 3300006931 | Bacteria | 4595 |
| 185 | Ga0097620_100442472 | 3300006931 | Bacteria | 1396 |
| 186 | Ga0097620_100445867 | 3300006931 | Bacteria | 1390 |
| 187 | Ga0079104_1000333 | 3300006946 | Bacteria | 57718 |
| 188 | Ga0105251_10001385 | 3300009011 | Bacteria | 20970 |
| 189 | Ga0105240_10038201 | 3300009093 | Bacteria | 6160 |
| 190 | Ga0105240_10050723 | 3300009093 | Bacteria | 5229 |
| 191 | Ga0105240_10052231 | 3300009093 | Bacteria | 5139 |
| 192 | Ga0105240_10169962 | 3300009093 | Bacteria | 2583 |
| 193 | Ga0111539_10870216 | 3300009094 | Bacteria | 1048 |
| 194 | Ga0105245_10140169 | 3300009098 | Bacteria | 2276 |
| 195 | Ga0105245_10204521 | 3300009098 | Bacteria | 1897 |
| 196 | Ga0105245_10238116 | 3300009098 | Bacteria | 1763 |
| 197 | Ga0114129_10118444 | 3300009147 | Bacteria | 3647 |
| 198 | Ga0105243_10001208 | 3300009148 | Bacteria | 23242 |
| 199 | Ga0105243_10017699 | 3300009148 | Bacteria | 5389 |
| 200 | Ga0105243_10046506 | 3300009148 | Bacteria | 3414 |
| 201 | Ga0105241_10530253 | 3300009174 | Bacteria | 1054 |
| 202 | Ga0105241_10566064 | 3300009174 | Bacteria | 1022 |
| 203 | Ga0105242_10179872 | 3300009176 | Bacteria | 1865 |
| 204 | Ga0105248_10001394 | 3300009177 | Bacteria | 26961 |
| 205 | Ga0105248_10502049 | 3300009177 | Bacteria | 1368 |
| 206 | Ga0105237_10002681 | 3300009545 | Bacteria | 21822 |
| 207 | Ga0105237_10111846 | 3300009545 | Bacteria | 2723 |
| 208 | Ga0105237_10129910 | 3300009545 | Bacteria | 2514 |
| 209 | Ga0105238_10010268 | 3300009551 | Bacteria | 9391 |
| 210 | Ga0105238_10256926 | 3300009551 | Bacteria | 1726 |
| 211 | Ga0105249_10071057 | 3300009553 | Bacteria | 3215 |
| 212 | Ga0105239_10001896 | 3300010375 | Bacteria | 27329 |
| 213 | Ga0105239_10010428 | 3300010375 | Bacteria | 10391 |
| 214 | Ga0105239_10149036 | 3300010375 | Bacteria | 2611 |
| 215 | Ga0105239_10829492 | 3300010375 | Bacteria | 1060 |
| 216 | Ga0157373_10029907 | 3300013100 | Bacteria | 3922 |
| 217 | Ga0157371_10000103 | 3300013102 | Bacteria | 128611 |
| 218 | Ga0157370_10000966 | 3300013104 | Bacteria | 36379 |
| 219 | Ga0157369_10003969 | 3300013105 | Bacteria | 17540 |
| 220 | Ga0157374_10118342 | 3300013296 | Bacteria | 2555 |
| 221 | Ga0157374_10123028 | 3300013296 | Bacteria | 2506 |
| 222 | Ga0157374_10131273 | 3300013296 | Bacteria | 2424 |
| 223 | Ga0157374_10219015 | 3300013296 | Bacteria | 1867 |
| 224 | Ga0157374_10454282 | 3300013296 | Bacteria | 1283 |
| 225 | Ga0157378_10066654 | 3300013297 | Bacteria | 3225 |
| 226 | Ga0157378_10196196 | 3300013297 | Bacteria | 1907 |
| 227 | Ga0163162_10033348 | 3300013306 | Bacteria | 5116 |
| 228 | Ga0163162_10081416 | 3300013306 | Bacteria | 3308 |
| 229 | Ga0163162_10261071 | 3300013306 | Bacteria | 1864 |
| 230 | Ga0163162_10440953 | 3300013306 | Bacteria | 1434 |
| 231 | Ga0163162_10579391 | 3300013306 | Bacteria | 1249 |
| 232 | Ga0163162_11030625 | 3300013306 | Bacteria | 931 |
| 233 | Ga0157375_10134869 | 3300013308 | Bacteria | 2591 |
| 234 | Ga0157375_10176788 | 3300013308 | Bacteria | 2284 |
| 235 | Ga0157375_10178174 | 3300013308 | Bacteria | 2276 |
| 236 | Ga0157380_10039716 | 3300014326 | Bacteria | 3661 |
| 237 | Ga0157380_10111468 | 3300014326 | Bacteria | 2300 |
| 238 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 239 | Ga0157377_10143964 | 3300014745 | Bacteria | 1467 |
| 240 | Ga0157379_10020286 | 3300014968 | Bacteria | 5876 |
| 241 | Ga0157379_10177099 | 3300014968 | Bacteria | 1926 |
| 242 | Ga0157376_10562464 | 3300014969 | Bacteria | 1130 |
| 243 | Ga0182006_1000468 | 3300015261 | Bacteria | 31596 |
| 244 | Ga0182006_1005546 | 3300015261 | Bacteria | 5995 |
| 245 | Ga0182007_10040374 | 3300015262 | Bacteria | 1558 |
| 246 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 247 | Ga0163161_10272440 | 3300017792 | Bacteria | 1325 |
| 248 | Ga0197907_11038722 | 3300020069 | Bacteria | 2812 |
| 249 | Ga0206355_1479823 | 3300020076 | Bacteria | 3847 |
| 250 | Ga0206351_10121833 | 3300020077 | Bacteria | 6469 |
| 251 | Ga0206350_11084827 | 3300020080 | Bacteria | 2842 |
| 252 | Ga0206353_11440426 | 3300020082 | Bacteria | 1309 |
| 253 | Ga0154015_1286480 | 3300020610 | Bacteria | 42278 |
| 254 | Ga0213872_10000051 | 3300021361 | Bacteria | 107261 |
| 255 | Ga0213872_10000074 | 3300021361 | Bacteria | 90986 |
| 256 | Ga0213872_10000710 | 3300021361 | Bacteria | 25046 |
| 257 | Ga0213872_10020308 | 3300021361 | Bacteria | 3061 |
| 258 | Ga0213872_10051886 | 3300021361 | Bacteria | 1861 |
| 259 | Ga0213872_10161368 | 3300021361 | Bacteria | 975 |
| 260 | Ga0224712_10012271 | 3300022467 | Bacteria | 2689 |
| 261 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 262 | Ga0209784_100328 | 3300025224 | Bacteria | 24020 |
| 263 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 264 | Ga0209566_100621 | 3300025225 | Bacteria | 21899 |
| 265 | Ga0209566_100782 | 3300025225 | Bacteria | 16940 |
| 266 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 267 | Ga0209674_100165 | 3300025226 | Bacteria | 86006 |
| 268 | Ga0209674_100239 | 3300025226 | Bacteria | 46704 |
| 269 | Ga0209672_100246 | 3300025228 | Bacteria | 40789 |
| 270 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 271 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 272 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 273 | Ga0209563_100137 | 3300025230 | Bacteria | 87321 |
| 274 | Ga0209563_103216 | 3300025230 | Bacteria | 3438 |
| 275 | Ga0209563_111937 | 3300025230 | Bacteria | 1207 |
| 276 | Ga0207427_101146 | 3300025231 | Bacteria | 10442 |
| 277 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 278 | Ga0209258_100146 | 3300025242 | Bacteria | 163331 |
| 279 | Ga0209258_100973 | 3300025242 | Bacteria | 13413 |
| 280 | Ga0207425_1000332 | 3300025245 | Bacteria | 33095 |
| 281 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 282 | Ga0209646_1000062 | 3300025246 | Bacteria | 252045 |
| 283 | Ga0209026_1000026 | 3300025250 | Bacteria | 352109 |
| 284 | Ga0209026_1001896 | 3300025250 | Bacteria | 8498 |
| 285 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 286 | Ga0209677_100124 | 3300025253 | Bacteria | 79576 |
| 287 | Ga0209677_100191 | 3300025253 | Bacteria | 50010 |
| 288 | Ga0209677_101539 | 3300025253 | Bacteria | 9834 |
| 289 | Ga0209677_106364 | 3300025253 | Bacteria | 2809 |
| 290 | Ga0209148_1000471 | 3300025254 | Bacteria | 42915 |
| 291 | Ga0209148_1004089 | 3300025254 | Bacteria | 3695 |
| 292 | Ga0209759_1000050 | 3300025256 | Bacteria | 215979 |
| 293 | Ga0209759_1001102 | 3300025256 | Bacteria | 17442 |
| 294 | Ga0209759_1001190 | 3300025256 | Bacteria | 16317 |
| 295 | Ga0209759_1001457 | 3300025256 | Bacteria | 13288 |
| 296 | Ga0209759_1006480 | 3300025256 | Bacteria | 3923 |
| 297 | Ga0209759_1008489 | 3300025256 | Bacteria | 3194 |
| 298 | Ga0209759_1011545 | 3300025256 | Bacteria | 2503 |
| 299 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 300 | Ga0209565_1000191 | 3300025263 | Bacteria | 75148 |
| 301 | Ga0209565_1004996 | 3300025263 | Bacteria | 3928 |
| 302 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 303 | Ga0209455_1000076 | 3300025272 | Bacteria | 284092 |
| 304 | Ga0209130_1011141 | 3300025284 | Bacteria | 2423 |
| 305 | Ga0209675_1000084 | 3300025291 | Bacteria | 152066 |
| 306 | Ga0209675_1001550 | 3300025291 | Bacteria | 13072 |
| 307 | Ga0209675_1008884 | 3300025291 | Bacteria | 3619 |
| 308 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 309 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 310 | Ga0209025_1000323 | 3300025294 | Bacteria | 106442 |
| 311 | Ga0209025_1000363 | 3300025294 | Bacteria | 96763 |
| 312 | Ga0209025_1009587 | 3300025294 | Bacteria | 6718 |
| 313 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 314 | Ga0209564_1000953 | 3300025295 | Bacteria | 36860 |
| 315 | Ga0209564_1001000 | 3300025295 | Bacteria | 35296 |
| 316 | Ga0209758_1000356 | 3300025297 | Bacteria | 82914 |
| 317 | Ga0209758_1000708 | 3300025297 | Bacteria | 49463 |
| 318 | Ga0209050_1002670 | 3300025298 | Bacteria | 14557 |
| 319 | Ga0209050_1016415 | 3300025298 | Bacteria | 3030 |
| 320 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 321 | Ga0209256_1000466 | 3300025299 | Bacteria | 61247 |
| 322 | Ga0209256_1003509 | 3300025299 | Bacteria | 10925 |
| 323 | Ga0209051_1000155 | 3300025303 | Bacteria | 129560 |
| 324 | Ga0209051_1005150 | 3300025303 | Bacteria | 7752 |
| 325 | Ga0209051_1007719 | 3300025303 | Bacteria | 5833 |
| 326 | Ga0209051_1012820 | 3300025303 | Bacteria | 4032 |
| 327 | Ga0209257_1000236 | 3300025304 | Bacteria | 129543 |
| 328 | Ga0207682_10003745 | 3300025893 | Bacteria | 6537 |
| 329 | Ga0207682_10075488 | 3300025893 | Bacteria | 1435 |
| 330 | Ga0207642_10215411 | 3300025899 | Bacteria | 1070 |
| 331 | Ga0207688_10061796 | 3300025901 | Bacteria | 2112 |
| 332 | Ga0207680_10289776 | 3300025903 | Bacteria | 1139 |
| 333 | Ga0207645_10037411 | 3300025907 | Bacteria | 3114 |
| 334 | Ga0207705_10196295 | 3300025909 | Bacteria | 1528 |
| 335 | Ga0207705_10506943 | 3300025909 | Bacteria | 937 |
| 336 | Ga0207684_10047582 | 3300025910 | Bacteria | 3637 |
| 337 | Ga0207654_10385906 | 3300025911 | Bacteria | 971 |
| 338 | Ga0207695_10018539 | 3300025913 | Bacteria | 8042 |
| 339 | Ga0207695_10033764 | 3300025913 | Bacteria | 5575 |
| 340 | Ga0207695_10037040 | 3300025913 | Bacteria | 5265 |
| 341 | Ga0207671_10002325 | 3300025914 | Bacteria | 20511 |
| 342 | Ga0207657_10010303 | 3300025919 | Bacteria | 9332 |
| 343 | Ga0207657_10342379 | 3300025919 | Bacteria | 1180 |
| 344 | Ga0207657_10500555 | 3300025919 | Bacteria | 952 |
| 345 | Ga0207649_10000098 | 3300025920 | Bacteria | 71539 |
| 346 | Ga0207649_10005919 | 3300025920 | Bacteria | 6628 |
| 347 | Ga0207649_10235460 | 3300025920 | Bacteria | 1312 |
| 348 | Ga0207649_10297286 | 3300025920 | Bacteria | 1179 |
| 349 | Ga0207681_10020476 | 3300025923 | Bacteria | 4192 |
| 350 | Ga0207681_10065945 | 3300025923 | Bacteria | 2505 |
| 351 | Ga0207681_10112910 | 3300025923 | Bacteria | 1980 |
| 352 | Ga0207650_10006156 | 3300025925 | Bacteria | 8179 |
| 353 | Ga0207650_10098602 | 3300025925 | Bacteria | 2245 |
| 354 | Ga0207650_10584120 | 3300025925 | Bacteria | 938 |
| 355 | Ga0207659_10099075 | 3300025926 | Bacteria | 2193 |
| 356 | Ga0207659_10127859 | 3300025926 | Bacteria | 1957 |
| 357 | Ga0207659_10153708 | 3300025926 | Bacteria | 1799 |
| 358 | Ga0207659_10351705 | 3300025926 | Bacteria | 1223 |
| 359 | Ga0207687_10064217 | 3300025927 | Bacteria | 2602 |
| 360 | Ga0207687_10072680 | 3300025927 | Bacteria | 2461 |
| 361 | Ga0207687_10136902 | 3300025927 | Bacteria | 1853 |
| 362 | Ga0207644_10000924 | 3300025931 | Bacteria | 18658 |
| 363 | Ga0207644_10166966 | 3300025931 | Bacteria | 1715 |
| 364 | Ga0207690_10005848 | 3300025932 | Bacteria | 7278 |
| 365 | Ga0207690_10019643 | 3300025932 | Bacteria | 4164 |
| 366 | Ga0207690_10167488 | 3300025932 | Bacteria | 1643 |
| 367 | Ga0207706_10005864 | 3300025933 | Bacteria | 11427 |
| 368 | Ga0207706_10054989 | 3300025933 | Bacteria | 3512 |
| 369 | Ga0207706_10071708 | 3300025933 | Bacteria | 3047 |
| 370 | Ga0207706_10101818 | 3300025933 | Bacteria | 2527 |
| 371 | Ga0207706_10401590 | 3300025933 | Bacteria | 1188 |
| 372 | Ga0207686_10168180 | 3300025934 | Bacteria | 1543 |
| 373 | Ga0207709_10002246 | 3300025935 | Bacteria | 12298 |
| 374 | Ga0207709_10020701 | 3300025935 | Bacteria | 3714 |
| 375 | Ga0207669_10076721 | 3300025937 | Bacteria | 2122 |
| 376 | Ga0207669_10163304 | 3300025937 | Bacteria | 1576 |
| 377 | Ga0207704_10111664 | 3300025938 | Bacteria | 1849 |
| 378 | Ga0207691_10039297 | 3300025940 | Bacteria | 4377 |
| 379 | Ga0207691_10510833 | 3300025940 | Bacteria | 1020 |
| 380 | Ga0207711_10006498 | 3300025941 | Bacteria | 9843 |
| 381 | Ga0207711_10128462 | 3300025941 | Bacteria | 2269 |
| 382 | Ga0207711_10237146 | 3300025941 | Bacteria | 1672 |
| 383 | Ga0207689_10003940 | 3300025942 | Bacteria | 13512 |
| 384 | Ga0207679_10000020 | 3300025945 | Bacteria | 225727 |
| 385 | Ga0207679_10003912 | 3300025945 | Bacteria | 9243 |
| 386 | Ga0207679_10059750 | 3300025945 | Bacteria | 2830 |
| 387 | Ga0207667_10001993 | 3300025949 | Bacteria | 25611 |
| 388 | Ga0207667_10267199 | 3300025949 | Bacteria | 1749 |
| 389 | Ga0207667_10539739 | 3300025949 | Bacteria | 1180 |
| 390 | Ga0207651_10000893 | 3300025960 | Bacteria | 13093 |
| 391 | Ga0207712_10136980 | 3300025961 | Bacteria | 1874 |
| 392 | Ga0207668_10590580 | 3300025972 | Bacteria | 966 |
| 393 | Ga0207640_10000092 | 3300025981 | Bacteria | 71354 |
| 394 | Ga0207658_10000596 | 3300025986 | Bacteria | 32369 |
| 395 | Ga0207658_10031648 | 3300025986 | Bacteria | 3758 |
| 396 | Ga0207658_10137657 | 3300025986 | Bacteria | 1971 |
| 397 | Ga0207677_10050885 | 3300026023 | Bacteria | 2805 |
| 398 | Ga0207677_10410906 | 3300026023 | Bacteria | 1150 |
| 399 | Ga0207703_10066736 | 3300026035 | Bacteria | 2960 |
| 400 | Ga0207703_10118572 | 3300026035 | Bacteria | 2269 |
| 401 | Ga0207703_10444667 | 3300026035 | Bacteria | 1210 |
| 402 | Ga0207639_10083956 | 3300026041 | Bacteria | 2529 |
| 403 | Ga0207678_10000181 | 3300026067 | Bacteria | 53999 |
| 404 | Ga0207678_10000478 | 3300026067 | Bacteria | 36328 |
| 405 | Ga0207678_10157820 | 3300026067 | Bacteria | 1937 |
| 406 | Ga0207708_10178413 | 3300026075 | Bacteria | 1686 |
| 407 | Ga0207702_10000017 | 3300026078 | Bacteria | 222964 |
| 408 | Ga0207702_10000573 | 3300026078 | Bacteria | 40848 |
| 409 | Ga0207702_10209508 | 3300026078 | Bacteria | 1811 |
| 410 | Ga0207641_10064210 | 3300026088 | Bacteria | 3137 |
| 411 | Ga0207641_10081066 | 3300026088 | Bacteria | 2817 |
| 412 | Ga0207641_10538458 | 3300026088 | Bacteria | 1137 |
| 413 | Ga0207648_10000412 | 3300026089 | Bacteria | 47573 |
| 414 | Ga0207648_10117120 | 3300026089 | Bacteria | 2342 |
| 415 | Ga0207648_10426260 | 3300026089 | Bacteria | 1205 |
| 416 | Ga0207648_10559589 | 3300026089 | Bacteria | 1051 |
| 417 | Ga0207676_10175468 | 3300026095 | Bacteria | 1871 |
| 418 | Ga0207676_10215227 | 3300026095 | Bacteria | 1707 |
| 419 | Ga0207676_10624225 | 3300026095 | Bacteria | 1037 |
| 420 | Ga0207676_10625593 | 3300026095 | Bacteria | 1036 |
| 421 | Ga0207674_10001842 | 3300026116 | Bacteria | 27012 |
| 422 | Ga0207674_10009965 | 3300026116 | Bacteria | 10813 |
| 423 | Ga0207674_10014163 | 3300026116 | Bacteria | 8813 |
| 424 | Ga0207674_10315985 | 3300026116 | Bacteria | 1511 |
| 425 | Ga0207675_100036720 | 3300026118 | Bacteria | 4570 |
| 426 | Ga0207675_100038606 | 3300026118 | Bacteria | 4456 |
| 427 | Ga0207675_100122801 | 3300026118 | Bacteria | 2458 |
| 428 | Ga0207683_10442906 | 3300026121 | Bacteria | 1197 |
| 429 | Ga0207683_10548935 | 3300026121 | Bacteria | 1068 |
| 430 | Ga0207698_10059115 | 3300026142 | Bacteria | 2975 |
| 431 | Ga0207698_10236080 | 3300026142 | Bacteria | 1663 |
| 432 | Ga0207698_10305646 | 3300026142 | Bacteria | 1483 |
| 433 | Ga0209281_1000322 | 3300027111 | Bacteria | 84374 |
| 434 | Ga0209966_1000005 | 3300027695 | Bacteria | 103734 |
| 435 | Ga0209974_10005889 | 3300027876 | Bacteria | 4297 |
| 436 | Ga0209974_10006645 | 3300027876 | Bacteria | 4024 |
| 437 | Ga0268266_10013898 | 3300028379 | Bacteria | 6932 |
| 438 | Ga0268266_10139229 | 3300028379 | Bacteria | 2177 |
| 439 | Ga0268266_10435893 | 3300028379 | Bacteria | 1244 |
| 440 | Ga0268266_10629987 | 3300028379 | Bacteria | 1031 |
| 441 | Ga0268265_10024728 | 3300028380 | Bacteria | 4254 |
| 442 | Ga0268264_10006835 | 3300028381 | Bacteria | 9581 |
| 443 | Ga0268264_10114353 | 3300028381 | Bacteria | 2369 |
| 444 | Ga0268264_10599936 | 3300028381 | Bacteria | 1085 |
| 445 | Ga0268264_10633347 | 3300028381 | Bacteria | 1057 |
| 446 | Ga0265336_10000119 | 3300028666 | Bacteria | 59232 |
| 447 | Ga0307517_10010987 | 3300028786 | Bacteria | 12591 |
| 448 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 449 | Ga0307515_10000051 | 3300028794 | Bacteria | 272100 |
| 450 | Ga0307515_10000305 | 3300028794 | Bacteria | 121634 |
| 451 | Ga0307515_10004253 | 3300028794 | Bacteria | 29706 |
| 452 | Ga0307515_10006880 | 3300028794 | Bacteria | 22609 |
| 453 | Ga0307515_10025690 | 3300028794 | Bacteria | 10178 |
| 454 | Ga0307515_10095432 | 3300028794 | Bacteria | 3660 |
| 455 | Ga0307515_10103254 | 3300028794 | Bacteria | 3419 |
| 456 | Ga0307515_10137858 | 3300028794 | Bacteria | 2638 |
| 457 | Ga0265324_10009959 | 3300029957 | Bacteria | 3691 |
| 458 | Ga0307512_10024522 | 3300030522 | Bacteria | 5365 |
| 459 | Ga0307512_10098240 | 3300030522 | Bacteria | 1999 |
| 460 | Ga0265328_10008350 | 3300031239 | Bacteria | 4277 |
| 461 | Ga0265331_10010000 | 3300031250 | Bacteria | 5276 |
| 462 | Ga0265327_10000078 | 3300031251 | Bacteria | 207398 |
| 463 | Ga0307513_10012007 | 3300031456 | Bacteria | 10723 |
| 464 | Ga0307513_10015459 | 3300031456 | Bacteria | 9251 |
| 465 | Ga0307513_10039983 | 3300031456 | Bacteria | 5191 |
| 466 | Ga0307513_10046000 | 3300031456 | Bacteria | 4765 |
| 467 | Ga0307513_10064266 | 3300031456 | Bacteria | 3868 |
| 468 | Ga0307513_10243770 | 3300031456 | Bacteria | 1600 |
| 469 | Ga0307513_10322523 | 3300031456 | Bacteria | 1302 |
| 470 | Ga0307509_10001286 | 3300031507 | Bacteria | 42598 |
| 471 | Ga0307509_10010432 | 3300031507 | Bacteria | 11388 |
| 472 | Ga0307509_10013769 | 3300031507 | Bacteria | 9545 |
| 473 | Ga0307509_10192000 | 3300031507 | Bacteria | 1892 |
| 474 | Ga0307408_100120145 | 3300031548 | Bacteria | 2034 |
| 475 | Ga0307508_10000098 | 3300031616 | Bacteria | 103295 |
| 476 | Ga0307508_10000159 | 3300031616 | Bacteria | 81150 |
| 477 | Ga0307508_10313926 | 3300031616 | Bacteria | 1159 |
| 478 | Ga0307514_10006986 | 3300031649 | Bacteria | 9760 |
| 479 | Ga0307514_10008269 | 3300031649 | Bacteria | 8878 |
| 480 | Ga0307516_10002826 | 3300031730 | Bacteria | 22886 |
| 481 | Ga0307516_10003066 | 3300031730 | Bacteria | 21791 |
| 482 | Ga0307516_10004343 | 3300031730 | Bacteria | 17529 |
| 483 | Ga0307516_10030498 | 3300031730 | Bacteria | 5440 |
| 484 | Ga0307516_10176912 | 3300031730 | Bacteria | 1870 |
| 485 | Ga0307405_10004366 | 3300031731 | Bacteria | 6671 |
| 486 | Ga0307413_10008901 | 3300031824 | Bacteria | 4770 |
| 487 | Ga0307518_10235322 | 3300031838 | Bacteria | 1181 |
| 488 | Ga0307410_10073767 | 3300031852 | Bacteria | 2374 |
| 489 | Ga0307410_10167566 | 3300031852 | Bacteria | 1652 |
| 490 | Ga0307410_10341530 | 3300031852 | Bacteria | 1194 |
| 491 | Ga0307406_10083144 | 3300031901 | Bacteria | 2134 |
| 492 | Ga0307412_10081044 | 3300031911 | Bacteria | 2243 |
| 493 | Ga0307416_100097304 | 3300032002 | Bacteria | 2548 |
| 494 | Ga0307414_10130313 | 3300032004 | Bacteria | 1951 |
| 495 | Ga0307414_10184698 | 3300032004 | Bacteria | 1681 |
| 496 | Ga0307411_10010018 | 3300032005 | Bacteria | 5024 |
| 497 | Ga0307507_10064389 | 3300033179 | Bacteria | 3384 |
| 498 | Ga0307510_10002924 | 3300033180 | Bacteria | 19645 |
| 499 | Ga0373953_0068769 | 3300035117 | Bacteria | 1458 |
| 500 | Ga0373927_0093092 | 3300035695 | Bacteria | 1958 |
| 501 | Ga0373937_0259585 | 3300036401 | Bacteria | 1638 |
| 502 | Ga0395899_0155022 | 3300037312 | Bacteria | 1621 |
| 503 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 504 | Ga0395900_0008520 | 3300037418 | Bacteria | 10540 |
| 505 | Ga0395898_0000817 | 3300037466 | Bacteria | 52136 |
| 506 | Ga0395898_0134229 | 3300037466 | Bacteria | 2370 |
| 507 | Ga0395905_0013384 | 3300037471 | Bacteria | 7860 |
| 508 | Ga0395905_0255121 | 3300037471 | Bacteria | 1638 |
| 509 | Ga0395905_0386006 | 3300037471 | Bacteria | 1295 |
| 510 | Ga0395901_0001599 | 3300038443 | Bacteria | 23451 |
| 511 | Ga0436361_0060431 | 3300039447 | Bacteria | 1307 |
| 512 | Ga0436361_0146317 | 3300039447 | Bacteria | 92155 |
| 513 | Ga0436361_0180496 | 3300039447 | Bacteria | 1798 |
| 514 | Ga0436361_0362737 | 3300039447 | Bacteria | 5180 |
| 515 | Ga0436361_0768142 | 3300039447 | Bacteria | 56393 |
| 516 | Ga0436361_0855507 | 3300039447 | Bacteria | 1812 |
| 517 | Ga0436361_0939166 | 3300039447 | Bacteria | 85026 |
| 518 | Ga0451793_0207973 | 3300041452 | Bacteria | 2114 |
| 519 | Ga0451793_1769215 | 3300041452 | Bacteria | 4829 |
| 520 | Ga0451833_1270813 | 3300041491 | Bacteria | 2084 |
| 521 | Ga0451839_1057768 | 3300041496 | Bacteria | 1488 |
| 522 | Ga0451847_0972424 | 3300041503 | Bacteria | 1053 |
| 523 | Ga0451851_0448762 | 3300041507 | Bacteria | 2378 |
| 524 | Ga0451853_1890114 | 3300041512 | Bacteria | 1662 |
| 525 | Ga0439434_0116469 | 3300042435 | Bacteria | 869 |
| 526 | Ga0450918_000287 | 3300042531 | Bacteria | 11389 |
| 527 | Ga0451577_0003543 | 3300042876 | Bacteria | 17252 |
| 528 | Ga0451577_0178794 | 3300042876 | Bacteria | 1912 |
| 529 | Ga0451577_0186179 | 3300042876 | Bacteria | 1872 |
| 530 | Ga0451577_0576409 | 3300042876 | Bacteria | 1021 |
| 531 | Ga0466969_0023854 | 3300044656 | Bacteria | 3148 |
| 532 | Ga0466969_0025097 | 3300044656 | Bacteria | 3065 |
| 533 | Ga0466969_0050747 | 3300044656 | Bacteria | 2044 |
| 534 | Ga0466969_0097828 | 3300044656 | Bacteria | 1384 |
| 535 | Ga0466972_0000564 | 3300044658 | Bacteria | 18111 |
| 536 | Ga0466972_0033620 | 3300044658 | Bacteria | 2514 |
| 537 | Ga0466972_0047073 | 3300044658 | Bacteria | 2086 |
| 538 | Ga0466972_0116790 | 3300044658 | Bacteria | 1259 |
| 539 | Ga0466975_0331127 | 3300044661 | Bacteria | 964 |
| 540 | Ga0466982_0062127 | 3300044672 | Bacteria | 2300 |
| 541 | Ga0466965_0002967 | 3300044683 | Bacteria | 7350 |
| 542 | Ga0466965_0018420 | 3300044683 | Bacteria | 3347 |
| 543 | Ga0466965_0024197 | 3300044683 | Bacteria | 2935 |
| 544 | Ga0466965_0045731 | 3300044683 | Bacteria | 2166 |
| 545 | Ga0466966_0003862 | 3300044684 | Bacteria | 9890 |
| 546 | Ga0466966_0005496 | 3300044684 | Bacteria | 8326 |
| 547 | Ga0466966_0076484 | 3300044684 | Bacteria | 2090 |
| 548 | Ga0466961_0000202 | 3300044693 | Bacteria | 40048 |
| 549 | Ga0466961_0000655 | 3300044693 | Bacteria | 21750 |
| 550 | Ga0466961_0012612 | 3300044693 | Bacteria | 5412 |
| 551 | Ga0466961_0016936 | 3300044693 | Bacteria | 4683 |
| 552 | Ga0466964_0004693 | 3300044706 | Bacteria | 5050 |
| 553 | Ga0466964_0046890 | 3300044706 | Bacteria | 1762 |
| 554 | Ga0466964_0069619 | 3300044706 | Bacteria | 1484 |
| 555 | Ga0453684_0071583 | 3300044712 | Bacteria | 4383 |
| 556 | Ga0466971_0011261 | 3300044719 | Bacteria | 3918 |
| 557 | Ga0466971_0016744 | 3300044719 | Bacteria | 3237 |
| 558 | Ga0466968_0010399 | 3300044735 | Bacteria | 3606 |
| 559 | Ga0466968_0031325 | 3300044735 | Bacteria | 2206 |
| 560 | Ga0466970_0004900 | 3300044765 | Bacteria | 6610 |
| 561 | Ga0466970_0075768 | 3300044765 | Bacteria | 1812 |
| 562 | Ga0466970_0079395 | 3300044765 | Bacteria | 1771 |
| 563 | Ga0466970_0271794 | 3300044765 | Bacteria | 952 |
| 564 | Ga0466957_0005869 | 3300044842 | Bacteria | 6916 |
| 565 | Ga0466957_0026350 | 3300044842 | Bacteria | 3448 |
| 566 | Ga0466960_0219898 | 3300044901 | Bacteria | 1045 |
| 567 | Ga0466959_0000285 | 3300045049 | Bacteria | 30873 |
| 568 | Ga0466959_0044517 | 3300045049 | Bacteria | 3270 |
| 569 | Ga0466959_0046888 | 3300045049 | Bacteria | 3180 |
| 570 | Ga0451576_0024224 | 3300045051 | Bacteria | 6557 |
| 571 | Ga0451576_0823240 | 3300045051 | Bacteria | 975 |
| 572 | Ga0466958_0117702 | 3300045836 | Bacteria | 1661 |
| 573 | Ga0466967_0011318 | 3300045976 | Bacteria | 6747 |
| 574 | Ga0466967_0074550 | 3300045976 | Bacteria | 3048 |
| 575 | Ga0466967_0127300 | 3300045976 | Bacteria | 2360 |
| 576 | Ga0466967_0558205 | 3300045976 | Bacteria | 1127 |
| 577 | Ga0495592_0000205 | 3300046454 | Bacteria | 50544 |
| 578 | Ga0495603_0002742 | 3300046455 | Bacteria | 10387 |
| 579 | Ga0495629_0000480 | 3300046459 | Bacteria | 33539 |
| 580 | Ga0495638_0010534 | 3300046460 | Bacteria | 6406 |
| 581 | Ga0495651_0093157 | 3300046462 | Bacteria | 2256 |
| 582 | Ga0495651_0115987 | 3300046462 | Bacteria | 1974 |
| 583 | Ga0495650_0002453 | 3300046471 | Bacteria | 14961 |
| 584 | Ga0495650_0010155 | 3300046471 | Bacteria | 5279 |
| 585 | Ga0495582_0215042 | 3300046473 | Bacteria | 1099 |
| 586 | Ga0495605_0001336 | 3300046474 | Bacteria | 16318 |
| 587 | Ga0495639_0050769 | 3300046475 | Bacteria | 1885 |
| 588 | Ga0495639_0111927 | 3300046475 | Bacteria | 1296 |
| 589 | Ga0495662_0064672 | 3300046476 | Bacteria | 1768 |
| 590 | Ga0495596_0070535 | 3300046500 | Bacteria | 1358 |
| 591 | Ga0495583_0000585 | 3300046506 | Bacteria | 49928 |
| 592 | Ga0495583_0097552 | 3300046506 | Bacteria | 1258 |
| 593 | Ga0495606_0005296 | 3300046507 | Bacteria | 12423 |
| 594 | Ga0495606_0020534 | 3300046507 | Bacteria | 4866 |
| 595 | Ga0495610_0020856 | 3300046512 | Bacteria | 3623 |
| 596 | Ga0495632_0003624 | 3300046519 | Bacteria | 10853 |
| 597 | Ga0495632_0034350 | 3300046519 | Bacteria | 2596 |
| 598 | Ga0495644_0029675 | 3300046523 | Bacteria | 2066 |
| 599 | Ga0495648_0067868 | 3300046524 | Bacteria | 2084 |
| 600 | Ga0495642_0033579 | 3300046528 | Bacteria | 2063 |
| 601 | Ga0495586_0007585 | 3300046535 | Bacteria | 5791 |
| 602 | Ga0495597_0002614 | 3300046542 | Bacteria | 11205 |
| 603 | Ga0495645_0009654 | 3300046543 | Bacteria | 6749 |
| 604 | Ga0495667_0119798 | 3300046559 | Bacteria | 1700 |
| 605 | Ga0495668_0020891 | 3300046616 | Bacteria | 3760 |
| 606 | Ga0495668_0065020 | 3300046616 | Bacteria | 2008 |
| 607 | Ga0495668_0149498 | 3300046616 | Bacteria | 1279 |
| 608 | Ga0495625_0002218 | 3300046660 | Bacteria | 21465 |
| 609 | Ga0495625_0051677 | 3300046660 | Bacteria | 2946 |
| 610 | Ga0495625_0234894 | 3300046660 | Bacteria | 1196 |
| 611 | Ga0495646_0084861 | 3300046680 | Bacteria | 1838 |
| 612 | Ga0495658_0073883 | 3300046683 | Bacteria | 1986 |
| 613 | Ga0495669_0020999 | 3300046684 | Bacteria | 2830 |
| 614 | Ga0495669_0108198 | 3300046684 | Bacteria | 1296 |
| 615 | Ga0495613_0356586 | 3300046689 | Bacteria | 1003 |
| 616 | Ga0495649_0007041 | 3300046694 | Bacteria | 6922 |
| 617 | Ga0495649_0008123 | 3300046694 | Bacteria | 6333 |
| 618 | Ga0495660_0016584 | 3300046810 | Bacteria | 4247 |
| 619 | Ga0495687_000078 | 3300047443 | Bacteria | 148202 |
| 620 | Ga0495687_000473 | 3300047443 | Bacteria | 48762 |
| 621 | Ga0495687_010018 | 3300047443 | Bacteria | 5236 |
| 622 | Ga0495673_0063698 | 3300047469 | Bacteria | 1571 |
| 623 | Ga0495681_0130243 | 3300047470 | Bacteria | 1071 |
| 624 | Ga0495686_0000042 | 3300047472 | Bacteria | 293968 |
| 625 | Ga0495686_0007475 | 3300047472 | Bacteria | 8186 |
| 626 | Ga0495686_0066710 | 3300047472 | Bacteria | 2223 |
| 627 | Ga0495686_0068404 | 3300047472 | Bacteria | 2191 |
| 628 | Ga0495686_0081042 | 3300047472 | Bacteria | 1983 |
| 629 | Ga0495593_0126967 | 3300047673 | Bacteria | 1296 |
| 630 | Ga0496100_0123382 | 3300048903 | Bacteria | 1815 |
| 631 | Ga0496101_0245804 | 3300048904 | Bacteria | 1393 |
| 632 | Ga0496101_0402824 | 3300048904 | Bacteria | 1077 |
| 633 | Ga0496102_0008536 | 3300048905 | Bacteria | 8785 |
| 634 | Ga0496104_0008971 | 3300048907 | Bacteria | 8892 |
| 635 | Ga0496105_0029841 | 3300048908 | Bacteria | 4465 |
| 636 | Ga0496105_0381150 | 3300048908 | Bacteria | 1122 |
| 637 | Ga0496106_0004373 | 3300048909 | Bacteria | 10498 |
| 638 | Ga0496106_0025809 | 3300048909 | Bacteria | 4372 |
| 639 | Ga0496107_0156247 | 3300048910 | Bacteria | 1689 |
| 640 | Ga0496108_0147760 | 3300048911 | Bacteria | 2027 |
| 641 | Ga0496109_0098397 | 3300048912 | Bacteria | 2712 |
| 642 | Ga0496110_0204149 | 3300048913 | Bacteria | 1796 |
| 643 | Ga0496111_0114549 | 3300048914 | Bacteria | 1988 |
| 644 | Ga0496112_0013286 | 3300048915 | Bacteria | 7601 |
| 645 | Ga0496113_0330230 | 3300048916 | Bacteria | 1223 |
| 646 | Ga0496114_0002351 | 3300048917 | Bacteria | 14395 |
| 647 | Ga0496114_0022878 | 3300048917 | Bacteria | 5094 |
| 648 | Ga0496114_0134827 | 3300048917 | Bacteria | 2134 |
| 649 | Ga0496121_0035317 | 3300048924 | Bacteria | 4482 |
| 650 | Ga0496124_0002098 | 3300048927 | Bacteria | 26914 |
| 651 | Ga0496125_0004872 | 3300048928 | Bacteria | 15234 |
| 652 | Ga0496125_0020567 | 3300048928 | Bacteria | 6192 |
| 653 | Ga0496125_0051782 | 3300048928 | Bacteria | 3382 |
| 654 | Ga0496126_0049526 | 3300048929 | Bacteria | 3835 |
| 655 | Ga0495682_0041378 | 3300049460 | Bacteria | 1689 |
| 656 | Ga0501034_0000761 | 3300049571 | Bacteria | 48401 |
| 657 | Ga0501034_0187644 | 3300049571 | Bacteria | 2030 |
| 658 | Ga0501034_0391458 | 3300049571 | Bacteria | 1314 |
| 659 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 660 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 661 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 662 | Ga0501048_0000097 | 3300049582 | Bacteria | 47728 |
| 663 | Ga0501198_000039 | 3300049649 | Bacteria | 47786 |
| 664 | Ga0501222_000043 | 3300049662 | Bacteria | 47790 |
| 665 | Ga0501265_002175 | 3300049762 | Bacteria | 2227 |
| 666 | Ga0501281_03204 | 3300049777 | Bacteria | 1176 |
| 667 | Ga0501035_0036476 | 3300049822 | Bacteria | 4456 |
| 668 | Ga0501045_0002894 | 3300049824 | Bacteria | 11731 |
| 669 | nmdc:mga03683_11744_c1 | 3300050489 | Bacteria | 3182 |
| 670 | nmdc:mga03683_121581_c1 | 3300050489 | Bacteria | 1161 |
| 671 | nmdc:mga03683_4370_c1 | 3300050489 | Bacteria | 4684 |
| 672 | nmdc:mga03n38_50977_c1 | 3300050490 | Bacteria | 1846 |
| 673 | nmdc:mga03n38_57588_c1 | 3300050490 | Bacteria | 1758 |
| 674 | nmdc:mga00v17_40775_c1 | 3300050491 | Bacteria | 2786 |
| 675 | nmdc:mga00v17_817_c1 | 3300050491 | Bacteria | 16934 |
| 676 | nmdc:mga00v17_85501_c1 | 3300050491 | Bacteria | 1975 |
| 677 | nmdc:mga0k408_11730_c1 | 3300050493 | Bacteria | 4780 |
| 678 | nmdc:mga0k408_13369_c1 | 3300050493 | Bacteria | 4500 |
| 679 | nmdc:mga0k408_17075_c1 | 3300050493 | Bacteria | 4037 |
| 680 | nmdc:mga0k408_17184_c1 | 3300050493 | Bacteria | 4027 |
| 681 | nmdc:mga0k408_19881_c1 | 3300050493 | Bacteria | 3759 |
| 682 | nmdc:mga0k408_33077_c1 | 3300050493 | Bacteria | 2956 |
| 683 | nmdc:mga0k408_50451_c1 | 3300050493 | Bacteria | 2409 |
| 684 | nmdc:mga0k408_59089_c1 | 3300050493 | Bacteria | 2227 |
| 685 | nmdc:mga0k408_59284_c1 | 3300050493 | Bacteria | 2224 |
| 686 | nmdc:mga0k408_96875_c1 | 3300050493 | Bacteria | 1737 |
| 687 | nmdc:mga06z11_6776_c1 | 3300050494 | Bacteria | 4680 |
| 688 | nmdc:mga07m45_103845_c1 | 3300050496 | Bacteria | 1634 |
| 689 | nmdc:mga07m45_11799_c1 | 3300050496 | Bacteria | 4600 |
| 690 | nmdc:mga07m45_220_c1 | 3300050496 | Bacteria | 22633 |
| 691 | nmdc:mga07m45_23119_c1 | 3300050496 | Bacteria | 3396 |
| 692 | nmdc:mga07m45_8131_c1 | 3300050496 | Bacteria | 5377 |
| 693 | nmdc:mga07m45_85631_c1 | 3300050496 | Bacteria | 1802 |
| 694 | nmdc:mga07m45_98223_c1 | 3300050496 | Bacteria | 1681 |
| 695 | nmdc:mga05p37_129068_c1 | 3300050507 | Bacteria | 3103 |
| 696 | nmdc:mga09592_965_c1 | 3300050508 | Bacteria | 22699 |
| 697 | nmdc:mga0sz30_13382_c1 | 3300050516 | Bacteria | 3212 |
| 698 | Ga0500635_0000129 | 3300053080 | Bacteria | 44308 |
| 699 | Ga0500644_0025707 | 3300053088 | Bacteria | 1815 |
| 700 | Ga0500644_0042148 | 3300053088 | Bacteria | 1520 |
| 701 | Ga0500651_0003537 | 3300053093 | Bacteria | 8548 |
| 702 | Ga0500651_0018573 | 3300053093 | Bacteria | 4306 |
| 703 | Ga0500650_0081160 | 3300053098 | Bacteria | 1517 |
| 704 | Ga0500650_0154431 | 3300053098 | Bacteria | 1060 |
| 705 | Ga0500594_0001531 | 3300053118 | Bacteria | 5031 |
| 706 | Ga0500618_002404 | 3300053125 | Bacteria | 7121 |
| 707 | Ga0500642_0002183 | 3300053130 | Bacteria | 5686 |
| 708 | Ga0500652_000757 | 3300053131 | Bacteria | 10901 |
| 709 | Ga0500655_037154 | 3300053133 | Bacteria | 949 |
| 710 | Ga0500658_0002272 | 3300053134 | Bacteria | 7435 |
| 711 | Ga0500658_0002796 | 3300053134 | Bacteria | 6699 |
| 712 | Ga0500559_0000134 | 3300053136 | Bacteria | 56963 |
| 713 | Ga0500568_0011123 | 3300053139 | Bacteria | 4192 |
| 714 | Ga0500568_0076934 | 3300053139 | Bacteria | 1270 |
| 715 | Ga0500577_0150637 | 3300053142 | Bacteria | 986 |
| 716 | Ga0500619_000137 | 3300053154 | Bacteria | 18737 |
| 717 | Ga0500622_0001329 | 3300053156 | Bacteria | 20074 |
| 718 | Ga0500622_0134851 | 3300053156 | Bacteria | 1183 |
| 719 | Ga0500634_0103218 | 3300053161 | Bacteria | 1422 |
| 720 | Ga0500587_004869 | 3300053739 | Bacteria | 1831 |
| 721 | Ga0500587_005872 | 3300053739 | Bacteria | 1641 |
| 722 | Ga0500661_006420 | 3300055283 | Bacteria | 2187 |
| 723 | Ga0590071_001197 | 3300059421 | Bacteria | 7016 |
| 724 | Ga0587088_003217 | 3300059508 | Bacteria | 1956 |
| 725 | Ga0587067_000317 | 3300059640 | Bacteria | 3964 |
| 726 | Ga0587072_000189 | 3300059643 | Bacteria | 5370 |
| 727 | Ga0501082_0866279 | 3300060353 | Bacteria | 790 |
| 728 | Ga0466962_0003867 | 3300061719 | Bacteria | 7154 |
| 729 | Ga0466962_0009971 | 3300061719 | Bacteria | 4556 |
| 730 | Ga0466962_0022710 | 3300061719 | Bacteria | 3015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100103256 | Ga0070659_1001032562 | 215 |
| 2 | 3300046519 | Ga0495632_0034350 | Ga0495632_0034350_14_718 | 220 |
| 3 | 3300025303 | Ga0209051_1007719 | Ga0209051_10077196 | 223 |
| 4 | 3300002067 | JGI24735J21928_10001336 | JGI24735J21928_1000133610 | 224 |
| 5 | 3300002067 | JGI24735J21928_10003035 | JGI24735J21928_100030356 | 224 |
| 6 | 3300002067 | JGI24735J21928_10004088 | JGI24735J21928_100040882 | 224 |
| 7 | 3300009011 | Ga0105251_10001385 | Ga0105251_1000138520 | 224 |
| 8 | 3300027876 | Ga0209974_10006645 | Ga0209974_100066454 | 224 |
| 9 | 3300048916 | Ga0496113_0330230 | Ga0496113_0330230_169_939 | 224 |
| 10 | 3300031649 | Ga0307514_10006986 | Ga0307514_100069865 | 225 |
| 11 | 3300003781 | Ga0055536_1001441 | Ga0055536_10014415 | 226 |
| 12 | 3300005289 | Ga0065704_10000521 | Ga0065704_1000052118 | 226 |
| 13 | 3300048917 | Ga0496114_0022878 | Ga0496114_0022878_2520_3200 | 226 |
| 14 | 3300048929 | Ga0496126_0049526 | Ga0496126_0049526_1198_1878 | 226 |
| 15 | 3300005548 | Ga0070665_100772606 | Ga0070665_1007726061 | 232 |
| 16 | 3300042876 | Ga0451577_0003543 | Ga0451577_0003543_2806_3576 | 233 |
| 17 | iso_pu_bacteria | 2513237150 | 2513952765 | 233 |
| 18 | iso_pu_bacteria | 2585428057 | 2587730066 | 233 |
| 19 | iso_pu_bacteria | 2596583598 | 2597032150 | 233 |
| 20 | iso_pu_bacteria | 2599185178 | 2599444270 | 233 |
| 21 | iso_pu_bacteria | 2643221654 | 2644302002 | 233 |
| 22 | iso_pu_bacteria | 2834641062 | 2834641950 | 233 |
| 23 | iso_pu_bacteria | 2885266251 | 2885268480 | 233 |
| 24 | iso_pu_bacteria | 2900577576 | 2900578811 | 233 |
| 25 | iso_pu_bacteria | 2901300506 | 2901301147 | 233 |
| 26 | iso_pu_bacteria | 2928058823 | 2928063247 | 233 |
| 27 | iso_pu_bacteria | 644736347 | 644747630 | 233 |
| 28 | iso_pu_bacteria | 8003400568 | 8003404505 | 233 |
| 29 | 3300053125 | Ga0500618_002404 | Ga0500618_002404_96_821 | 234 |
| 30 | iso_pu_bacteria | 2585428062 | 2587760233 | 234 |
| 31 | 3300003841 | Ga0055541_1000218 | Ga0055541_10002182 | 235 |
| 32 | 3300025934 | Ga0207686_10168180 | Ga0207686_101681802 | 235 |
| 33 | 3300025941 | Ga0207711_10128462 | Ga0207711_101284623 | 235 |
| 34 | 3300025986 | Ga0207658_10137657 | Ga0207658_101376572 | 235 |
| 35 | 3300026067 | Ga0207678_10157820 | Ga0207678_101578202 | 235 |
| 36 | 3300031507 | Ga0307509_10192000 | Ga0307509_101920002 | 235 |
| 37 | 3300031730 | Ga0307516_10004343 | Ga0307516_1000434319 | 235 |
| 38 | 3300046455 | Ga0495603_0002742 | Ga0495603_0002742_9639_10370 | 235 |
| 39 | 3300046459 | Ga0495629_0000480 | Ga0495629_0000480_5964_6695 | 235 |
| 40 | 3300046460 | Ga0495638_0010534 | Ga0495638_0010534_452_1183 | 235 |
| 41 | 3300046462 | Ga0495651_0093157 | Ga0495651_0093157_1458_2189 | 235 |
| 42 | 3300046471 | Ga0495650_0002453 | Ga0495650_0002453_2909_3640 | 235 |
| 43 | 3300046473 | Ga0495582_0215042 | Ga0495582_0215042_158_889 | 235 |
| 44 | 3300046474 | Ga0495605_0001336 | Ga0495605_0001336_14542_15273 | 235 |
| 45 | 3300046475 | Ga0495639_0111927 | Ga0495639_0111927_498_1229 | 235 |
| 46 | 3300046476 | Ga0495662_0064672 | Ga0495662_0064672_597_1328 | 235 |
| 47 | 3300046507 | Ga0495606_0020534 | Ga0495606_0020534_3655_4386 | 235 |
| 48 | 3300046523 | Ga0495644_0029675 | Ga0495644_0029675_1071_1802 | 235 |
| 49 | 3300046528 | Ga0495642_0033579 | Ga0495642_0033579_693_1424 | 235 |
| 50 | 3300046543 | Ga0495645_0009654 | Ga0495645_0009654_5897_6628 | 235 |
| 51 | 3300046559 | Ga0495667_0119798 | Ga0495667_0119798_669_1400 | 235 |
| 52 | 3300046616 | Ga0495668_0149498 | Ga0495668_0149498_51_782 | 235 |
| 53 | 3300046680 | Ga0495646_0084861 | Ga0495646_0084861_855_1586 | 235 |
| 54 | 3300046684 | Ga0495669_0108198 | Ga0495669_0108198_345_1076 | 235 |
| 55 | 3300046689 | Ga0495613_0356586 | Ga0495613_0356586_45_776 | 235 |
| 56 | 3300047470 | Ga0495681_0130243 | Ga0495681_0130243_200_931 | 235 |
| 57 | 3300047673 | Ga0495593_0126967 | Ga0495593_0126967_411_1142 | 235 |
| 58 | 3300048903 | Ga0496100_0123382 | Ga0496100_0123382_946_1677 | 235 |
| 59 | 3300048904 | Ga0496101_0245804 | Ga0496101_0245804_333_1064 | 235 |
| 60 | 3300048904 | Ga0496101_0402824 | Ga0496101_0402824_217_948 | 235 |
| 61 | 3300048908 | Ga0496105_0029841 | Ga0496105_0029841_3248_3979 | 235 |
| 62 | 3300048908 | Ga0496105_0381150 | Ga0496105_0381150_238_969 | 235 |
| 63 | 3300048909 | Ga0496106_0004373 | Ga0496106_0004373_9566_10297 | 235 |
| 64 | 3300048910 | Ga0496107_0156247 | Ga0496107_0156247_912_1643 | 235 |
| 65 | 3300048914 | Ga0496111_0114549 | Ga0496111_0114549_956_1687 | 235 |
| 66 | 3300048917 | Ga0496114_0002351 | Ga0496114_0002351_6633_7364 | 235 |
| 67 | 3300060353 | Ga0501082_0866279 | Ga0501082_0866279_11_754 | 235 |
| 68 | 3300009174 | Ga0105241_10530253 | Ga0105241_105302532 | 236 |
| 69 | 3300013306 | Ga0163162_10033348 | Ga0163162_100333486 | 236 |
| 70 | 3300028794 | Ga0307515_10103254 | Ga0307515_101032545 | 236 |
| 71 | 3300031456 | Ga0307513_10012007 | Ga0307513_100120079 | 236 |
| 72 | 3300047472 | Ga0495686_0000042 | Ga0495686_0000042_33834_34577 | 236 |
| 73 | 3300001915 | JGI24741J21665_1000156 | JGI24741J21665_100015615 | 237 |
| 74 | 3300001979 | JGI24740J21852_10002175 | JGI24740J21852_100021754 | 237 |
| 75 | 3300001979 | JGI24740J21852_10003164 | JGI24740J21852_100031643 | 237 |
| 76 | 3300001979 | JGI24740J21852_10019148 | JGI24740J21852_100191484 | 237 |
| 77 | 3300002705 | JGI25156J39149_1002013 | JGI25156J39149_10020135 | 237 |
| 78 | 3300002738 | JGI25154J39366_1001073 | JGI25154J39366_10010738 | 237 |
| 79 | 3300002773 | JGI25152J39213_1021263 | JGI25152J39213_10212632 | 237 |
| 80 | 3300002774 | JGI25150J39212_1015037 | JGI25150J39212_10150372 | 237 |
| 81 | 3300003187 | JGI25151J46595_10002737 | JGI25151J46595_100027376 | 237 |
| 82 | 3300003187 | JGI25151J46595_10016772 | JGI25151J46595_100167724 | 237 |
| 83 | 3300003215 | JGI25153J46596_10001674 | JGI25153J46596_100016742 | 237 |
| 84 | 3300003215 | JGI25153J46596_10021502 | JGI25153J46596_100215023 | 237 |
| 85 | 3300003578 | Ga0006562J51391_1072632 | Ga0006562J51391_10726322 | 237 |
| 86 | 3300003752 | Ga0055539_1000062 | Ga0055539_100006241 | 237 |
| 87 | 3300003756 | Ga0055533_1000522 | Ga0055533_100052212 | 237 |
| 88 | 3300003758 | Ga0055532_1000019 | Ga0055532_1000019217 | 237 |
| 89 | 3300003759 | Ga0055525_1000592 | Ga0055525_10005928 | 237 |
| 90 | 3300003760 | Ga0055527_1000558 | Ga0055527_100055810 | 237 |
| 91 | 3300003761 | Ga0055535_1000014 | Ga0055535_100001463 | 237 |
| 92 | 3300003762 | Ga0055542_1008756 | Ga0055542_10087562 | 237 |
| 93 | 3300003763 | Ga0055529_1000086 | Ga0055529_100008643 | 237 |
| 94 | 3300003771 | Ga0055526_1001196 | Ga0055526_10011968 | 237 |
| 95 | 3300003771 | Ga0055526_1008504 | Ga0055526_10085043 | 237 |
| 96 | 3300003771 | Ga0055526_1011661 | Ga0055526_10116613 | 237 |
| 97 | 3300003773 | Ga0055537_1000969 | Ga0055537_10009694 | 237 |
| 98 | 3300003775 | Ga0055524_1001551 | Ga0055524_10015519 | 237 |
| 99 | 3300003775 | Ga0055524_1015404 | Ga0055524_10154043 | 237 |
| 100 | 3300003781 | Ga0055536_1000034 | Ga0055536_1000034117 | 237 |
| 101 | 3300003784 | Ga0055534_1001162 | Ga0055534_10011629 | 237 |
| 102 | 3300003784 | Ga0055534_1007227 | Ga0055534_10072273 | 237 |
| 103 | 3300003841 | Ga0055541_1001407 | Ga0055541_10014074 | 237 |
| 104 | 3300005328 | Ga0070676_10120114 | Ga0070676_101201142 | 237 |
| 105 | 3300005339 | Ga0070660_100289162 | Ga0070660_1002891622 | 237 |
| 106 | 3300005344 | Ga0070661_100000088 | Ga0070661_10000008859 | 237 |
| 107 | 3300005366 | Ga0070659_100069361 | Ga0070659_1000693612 | 237 |
| 108 | 3300005367 | Ga0070667_100002698 | Ga0070667_10000269810 | 237 |
| 109 | 3300005455 | Ga0070663_100000010 | Ga0070663_10000001046 | 237 |
| 110 | 3300005459 | Ga0068867_100188007 | Ga0068867_1001880072 | 237 |
| 111 | 3300005543 | Ga0070672_100089747 | Ga0070672_1000897473 | 237 |
| 112 | 3300005548 | Ga0070665_100184722 | Ga0070665_1001847222 | 237 |
| 113 | 3300005564 | Ga0070664_100000005 | Ga0070664_100000005154 | 237 |
| 114 | 3300005577 | Ga0068857_100005050 | Ga0068857_10000505010 | 237 |
| 115 | 3300005578 | Ga0068854_100000104 | Ga0068854_10000010418 | 237 |
| 116 | 3300005614 | Ga0068856_100000054 | Ga0068856_10000005447 | 237 |
| 117 | 3300005616 | Ga0068852_100075588 | Ga0068852_1000755882 | 237 |
| 118 | 3300005843 | Ga0068860_100147158 | Ga0068860_1001471581 | 237 |
| 119 | 3300006195 | Ga0075366_10003640 | Ga0075366_100036406 | 237 |
| 120 | 3300006195 | Ga0075366_10073311 | Ga0075366_100733112 | 237 |
| 121 | 3300006353 | Ga0075370_10298349 | Ga0075370_102983491 | 237 |
| 122 | 3300009093 | Ga0105240_10038201 | Ga0105240_100382017 | 237 |
| 123 | 3300009098 | Ga0105245_10140169 | Ga0105245_101401692 | 237 |
| 124 | 3300013100 | Ga0157373_10029907 | Ga0157373_100299075 | 237 |
| 125 | 3300013102 | Ga0157371_10000103 | Ga0157371_1000010367 | 237 |
| 126 | 3300013104 | Ga0157370_10000966 | Ga0157370_100009669 | 237 |
| 127 | 3300013105 | Ga0157369_10003969 | Ga0157369_100039697 | 237 |
| 128 | 3300013296 | Ga0157374_10454282 | Ga0157374_104542822 | 237 |
| 129 | 3300013306 | Ga0163162_10579391 | Ga0163162_105793912 | 237 |
| 130 | 3300013308 | Ga0157375_10134869 | Ga0157375_101348694 | 237 |
| 131 | 3300014968 | Ga0157379_10020286 | Ga0157379_100202868 | 237 |
| 132 | 3300015261 | Ga0182006_1000468 | Ga0182006_100046822 | 237 |
| 133 | 3300015261 | Ga0182006_1005546 | Ga0182006_10055462 | 237 |
| 134 | 3300015262 | Ga0182007_10040374 | Ga0182007_100403741 | 237 |
| 135 | 3300020069 | Ga0197907_11038722 | Ga0197907_110387224 | 237 |
| 136 | 3300020076 | Ga0206355_1479823 | Ga0206355_14798235 | 237 |
| 137 | 3300020077 | Ga0206351_10121833 | Ga0206351_101218333 | 237 |
| 138 | 3300020080 | Ga0206350_11084827 | Ga0206350_110848272 | 237 |
| 139 | 3300020610 | Ga0154015_1286480 | Ga0154015_128648016 | 237 |
| 140 | 3300021361 | Ga0213872_10000051 | Ga0213872_1000005137 | 237 |
| 141 | 3300021361 | Ga0213872_10000074 | Ga0213872_1000007418 | 237 |
| 142 | 3300022467 | Ga0224712_10012271 | Ga0224712_100122714 | 237 |
| 143 | 3300025224 | Ga0209784_100003 | Ga0209784_1000031213 | 237 |
| 144 | 3300025224 | Ga0209784_100328 | Ga0209784_1003289 | 237 |
| 145 | 3300025225 | Ga0209566_100002 | Ga0209566_1000022167 | 237 |
| 146 | 3300025225 | Ga0209566_100621 | Ga0209566_10062115 | 237 |
| 147 | 3300025225 | Ga0209566_100782 | Ga0209566_1007829 | 237 |
| 148 | 3300025226 | Ga0209674_100008 | Ga0209674_10000818 | 237 |
| 149 | 3300025226 | Ga0209674_100239 | Ga0209674_10023941 | 237 |
| 150 | 3300025228 | Ga0209672_100246 | Ga0209672_10024619 | 237 |
| 151 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021201 | 237 |
| 152 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041584 | 237 |
| 153 | 3300025230 | Ga0209563_103216 | Ga0209563_1032163 | 237 |
| 154 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021201 | 237 |
| 155 | 3300025245 | Ga0207425_1000332 | Ga0207425_100033228 | 237 |
| 156 | 3300025246 | Ga0209646_1000019 | Ga0209646_100001987 | 237 |
| 157 | 3300025250 | Ga0209026_1001896 | Ga0209026_100189611 | 237 |
| 158 | 3300025253 | Ga0209677_100009 | Ga0209677_10000948 | 237 |
| 159 | 3300025253 | Ga0209677_106364 | Ga0209677_1063644 | 237 |
| 160 | 3300025254 | Ga0209148_1000471 | Ga0209148_100047142 | 237 |
| 161 | 3300025254 | Ga0209148_1004089 | Ga0209148_10040892 | 237 |
| 162 | 3300025256 | Ga0209759_1001190 | Ga0209759_10011908 | 237 |
| 163 | 3300025256 | Ga0209759_1006480 | Ga0209759_10064804 | 237 |
| 164 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012500 | 237 |
| 165 | 3300025263 | Ga0209565_1000191 | Ga0209565_100019121 | 237 |
| 166 | 3300025263 | Ga0209565_1004996 | Ga0209565_10049962 | 237 |
| 167 | 3300025272 | Ga0209455_1000076 | Ga0209455_1000076215 | 237 |
| 168 | 3300025284 | Ga0209130_1011141 | Ga0209130_10111412 | 237 |
| 169 | 3300025291 | Ga0209675_1000084 | Ga0209675_100008419 | 237 |
| 170 | 3300025291 | Ga0209675_1001550 | Ga0209675_10015506 | 237 |
| 171 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014266 | 237 |
| 172 | 3300025294 | Ga0209025_1000323 | Ga0209025_100032319 | 237 |
| 173 | 3300025294 | Ga0209025_1000363 | Ga0209025_100036323 | 237 |
| 174 | 3300025294 | Ga0209025_1009587 | Ga0209025_10095874 | 237 |
| 175 | 3300025295 | Ga0209564_1000022 | Ga0209564_100002214 | 237 |
| 176 | 3300025295 | Ga0209564_1000953 | Ga0209564_100095326 | 237 |
| 177 | 3300025295 | Ga0209564_1001000 | Ga0209564_10010009 | 237 |
| 178 | 3300025297 | Ga0209758_1000356 | Ga0209758_100035662 | 237 |
| 179 | 3300025297 | Ga0209758_1000708 | Ga0209758_100070814 | 237 |
| 180 | 3300025299 | Ga0209256_1000466 | Ga0209256_100046636 | 237 |
| 181 | 3300025299 | Ga0209256_1003509 | Ga0209256_10035095 | 237 |
| 182 | 3300025303 | Ga0209051_1005150 | Ga0209051_10051502 | 237 |
| 183 | 3300025913 | Ga0207695_10033764 | Ga0207695_100337647 | 237 |
| 184 | 3300025919 | Ga0207657_10342379 | Ga0207657_103423792 | 237 |
| 185 | 3300025920 | Ga0207649_10000098 | Ga0207649_1000009819 | 237 |
| 186 | 3300025923 | Ga0207681_10112910 | Ga0207681_101129102 | 237 |
| 187 | 3300025926 | Ga0207659_10351705 | Ga0207659_103517052 | 237 |
| 188 | 3300025927 | Ga0207687_10136902 | Ga0207687_101369022 | 237 |
| 189 | 3300025932 | Ga0207690_10019643 | Ga0207690_100196435 | 237 |
| 190 | 3300025940 | Ga0207691_10039297 | Ga0207691_100392974 | 237 |
| 191 | 3300025945 | Ga0207679_10000020 | Ga0207679_10000020149 | 237 |
| 192 | 3300025949 | Ga0207667_10267199 | Ga0207667_102671992 | 237 |
| 193 | 3300025981 | Ga0207640_10000092 | Ga0207640_1000009228 | 237 |
| 194 | 3300025986 | Ga0207658_10000596 | Ga0207658_1000059626 | 237 |
| 195 | 3300026067 | Ga0207678_10000181 | Ga0207678_100001813 | 237 |
| 196 | 3300026078 | Ga0207702_10000017 | Ga0207702_10000017149 | 237 |
| 197 | 3300026089 | Ga0207648_10117120 | Ga0207648_101171202 | 237 |
| 198 | 3300026116 | Ga0207674_10009965 | Ga0207674_1000996510 | 237 |
| 199 | 3300028379 | Ga0268266_10139229 | Ga0268266_101392293 | 237 |
| 200 | 3300028381 | Ga0268264_10114353 | Ga0268264_101143533 | 237 |
| 201 | 3300031456 | Ga0307513_10046000 | Ga0307513_100460002 | 237 |
| 202 | 3300031548 | Ga0307408_100120145 | Ga0307408_1001201452 | 237 |
| 203 | 3300031730 | Ga0307516_10176912 | Ga0307516_101769122 | 237 |
| 204 | 3300031731 | Ga0307405_10004366 | Ga0307405_100043663 | 237 |
| 205 | 3300031824 | Ga0307413_10008901 | Ga0307413_100089012 | 237 |
| 206 | 3300031852 | Ga0307410_10073767 | Ga0307410_100737673 | 237 |
| 207 | 3300031852 | Ga0307410_10341530 | Ga0307410_103415301 | 237 |
| 208 | 3300031901 | Ga0307406_10083144 | Ga0307406_100831442 | 237 |
| 209 | 3300031911 | Ga0307412_10081044 | Ga0307412_100810442 | 237 |
| 210 | 3300032002 | Ga0307416_100097304 | Ga0307416_1000973043 | 237 |
| 211 | 3300032004 | Ga0307414_10130313 | Ga0307414_101303132 | 237 |
| 212 | 3300032005 | Ga0307411_10010018 | Ga0307411_100100183 | 237 |
| 213 | 3300035695 | Ga0373927_0093092 | Ga0373927_0093092_183_938 | 237 |
| 214 | 3300037312 | Ga0395899_0155022 | Ga0395899_0155022_622_1368 | 237 |
| 215 | 3300037418 | Ga0395900_0008520 | Ga0395900_0008520_986_1732 | 237 |
| 216 | 3300037471 | Ga0395905_0255121 | Ga0395905_0255121_401_1147 | 237 |
| 217 | 3300039447 | Ga0436361_0768142 | Ga0436361_0768142_1400_2137 | 237 |
| 218 | 3300039447 | Ga0436361_0939166 | Ga0436361_0939166_55146_55886 | 237 |
| 219 | 3300041452 | Ga0451793_1769215 | Ga0451793_1769215_3747_4508 | 237 |
| 220 | 3300041503 | Ga0451847_0972424 | Ga0451847_0972424_245_1006 | 237 |
| 221 | 3300044656 | Ga0466969_0097828 | Ga0466969_0097828_186_932 | 237 |
| 222 | 3300044658 | Ga0466972_0033620 | Ga0466972_0033620_477_1223 | 237 |
| 223 | 3300044672 | Ga0466982_0062127 | Ga0466982_0062127_1236_1982 | 237 |
| 224 | 3300044693 | Ga0466961_0000202 | Ga0466961_0000202_36729_37475 | 237 |
| 225 | 3300044706 | Ga0466964_0069619 | Ga0466964_0069619_284_1030 | 237 |
| 226 | 3300044735 | Ga0466968_0031325 | Ga0466968_0031325_1143_1889 | 237 |
| 227 | 3300044765 | Ga0466970_0004900 | Ga0466970_0004900_3493_4239 | 237 |
| 228 | 3300044842 | Ga0466957_0026350 | Ga0466957_0026350_2525_3271 | 237 |
| 229 | 3300044901 | Ga0466960_0219898 | Ga0466960_0219898_123_869 | 237 |
| 230 | 3300045051 | Ga0451576_0823240 | Ga0451576_0823240_96_830 | 237 |
| 231 | 3300045976 | Ga0466967_0127300 | Ga0466967_0127300_875_1621 | 237 |
| 232 | 3300047472 | Ga0495686_0068404 | Ga0495686_0068404_257_1015 | 237 |
| 233 | 3300048909 | Ga0496106_0025809 | Ga0496106_0025809_2596_3354 | 237 |
| 234 | 3300048928 | Ga0496125_0020567 | Ga0496125_0020567_2257_3003 | 237 |
| 235 | 3300049571 | Ga0501034_0000761 | Ga0501034_0000761_20466_21218 | 237 |
| 236 | 3300049571 | Ga0501034_0187644 | Ga0501034_0187644_74_808 | 237 |
| 237 | 3300050489 | nmdc:mga03683_121581_c1 | nmdc:mga03683_121581_c1_384_1148 | 237 |
| 238 | 3300050490 | nmdc:mga03n38_50977_c1 | nmdc:mga03n38_50977_c1_1070_1831 | 237 |
| 239 | 3300050493 | nmdc:mga0k408_33077_c1 | nmdc:mga0k408_33077_c1_351_1115 | 237 |
| 240 | 3300050493 | nmdc:mga0k408_59089_c1 | nmdc:mga0k408_59089_c1_870_1634 | 237 |
| 241 | 3300050496 | nmdc:mga07m45_85631_c1 | nmdc:mga07m45_85631_c1_214_975 | 237 |
| 242 | 3300053088 | Ga0500644_0025707 | Ga0500644_0025707_442_1203 | 237 |
| 243 | 3300053088 | Ga0500644_0042148 | Ga0500644_0042148_453_1208 | 237 |
| 244 | 3300053093 | Ga0500651_0003537 | Ga0500651_0003537_2878_3639 | 237 |
| 245 | 3300053098 | Ga0500650_0154431 | Ga0500650_0154431_89_850 | 237 |
| 246 | 3300053130 | Ga0500642_0002183 | Ga0500642_0002183_386_1147 | 237 |
| 247 | 3300053131 | Ga0500652_000757 | Ga0500652_000757_6421_7182 | 237 |
| 248 | 3300053133 | Ga0500655_037154 | Ga0500655_037154_34_795 | 237 |
| 249 | 3300053139 | Ga0500568_0011123 | Ga0500568_0011123_3285_4046 | 237 |
| 250 | 3300053142 | Ga0500577_0150637 | Ga0500577_0150637_71_832 | 237 |
| 251 | 3300053156 | Ga0500622_0001329 | Ga0500622_0001329_11576_12337 | 237 |
| 252 | 3300053156 | Ga0500622_0134851 | Ga0500622_0134851_339_1100 | 237 |
| 253 | 3300059508 | Ga0587088_003217 | Ga0587088_003217_514_1260 | 237 |
| 254 | 3300059640 | Ga0587067_000317 | Ga0587067_000317_642_1388 | 237 |
| 255 | 3300059643 | Ga0587072_000189 | Ga0587072_000189_843_1589 | 237 |
| 256 | 3300061719 | Ga0466962_0009971 | Ga0466962_0009971_2526_3272 | 237 |
| 257 | iso_pu_bacteria | 2643221644 | 2644248966 | 237 |
| 258 | iso_pu_bacteria | 2643221660 | 2644340064 | 237 |
| 259 | 3300005340 | Ga0070689_100474448 | Ga0070689_1004744482 | 238 |
| 260 | 3300005356 | Ga0070674_100800113 | Ga0070674_1008001131 | 238 |
| 261 | 3300005548 | Ga0070665_100011217 | Ga0070665_10001121710 | 238 |
| 262 | 3300005617 | Ga0068859_100445831 | Ga0068859_1004458312 | 238 |
| 263 | 3300005618 | Ga0068864_100006013 | Ga0068864_1000060137 | 238 |
| 264 | 3300005618 | Ga0068864_100457003 | Ga0068864_1004570032 | 238 |
| 265 | 3300005841 | Ga0068863_100010184 | Ga0068863_1000101846 | 238 |
| 266 | 3300006048 | Ga0075363_100076420 | Ga0075363_1000764202 | 238 |
| 267 | 3300006048 | Ga0075363_100078873 | Ga0075363_1000788732 | 238 |
| 268 | 3300006051 | Ga0075364_10205482 | Ga0075364_102054821 | 238 |
| 269 | 3300006178 | Ga0075367_10051646 | Ga0075367_100516462 | 238 |
| 270 | 3300006178 | Ga0075367_10118351 | Ga0075367_101183512 | 238 |
| 271 | 3300006186 | Ga0075369_10050419 | Ga0075369_100504192 | 238 |
| 272 | 3300006195 | Ga0075366_10066650 | Ga0075366_100666502 | 238 |
| 273 | 3300006195 | Ga0075366_10068126 | Ga0075366_100681262 | 238 |
| 274 | 3300006195 | Ga0075366_10087441 | Ga0075366_100874412 | 238 |
| 275 | 3300006353 | Ga0075370_10038128 | Ga0075370_100381282 | 238 |
| 276 | 3300006353 | Ga0075370_10217247 | Ga0075370_102172472 | 238 |
| 277 | 3300006931 | Ga0097620_100445867 | Ga0097620_1004458672 | 238 |
| 278 | 3300009098 | Ga0105245_10238116 | Ga0105245_102381162 | 238 |
| 279 | 3300009177 | Ga0105248_10502049 | Ga0105248_105020492 | 238 |
| 280 | 3300009545 | Ga0105237_10111846 | Ga0105237_101118463 | 238 |
| 281 | 3300013296 | Ga0157374_10219015 | Ga0157374_102190152 | 238 |
| 282 | 3300013297 | Ga0157378_10066654 | Ga0157378_100666542 | 238 |
| 283 | 3300013306 | Ga0163162_10261071 | Ga0163162_102610712 | 238 |
| 284 | 3300014968 | Ga0157379_10177099 | Ga0157379_101770992 | 238 |
| 285 | 3300021361 | Ga0213872_10020308 | Ga0213872_100203081 | 238 |
| 286 | 3300021361 | Ga0213872_10161368 | Ga0213872_101613681 | 238 |
| 287 | 3300025920 | Ga0207649_10297286 | Ga0207649_102972862 | 238 |
| 288 | 3300025927 | Ga0207687_10072680 | Ga0207687_100726803 | 238 |
| 289 | 3300026023 | Ga0207677_10050885 | Ga0207677_100508851 | 238 |
| 290 | 3300026035 | Ga0207703_10118572 | Ga0207703_101185722 | 238 |
| 291 | 3300026078 | Ga0207702_10209508 | Ga0207702_102095082 | 238 |
| 292 | 3300026088 | Ga0207641_10538458 | Ga0207641_105384582 | 238 |
| 293 | 3300026095 | Ga0207676_10175468 | Ga0207676_101754682 | 238 |
| 294 | 3300027876 | Ga0209974_10005889 | Ga0209974_100058893 | 238 |
| 295 | 3300028379 | Ga0268266_10013898 | Ga0268266_100138988 | 238 |
| 296 | 3300028786 | Ga0307517_10010987 | Ga0307517_100109879 | 238 |
| 297 | 3300028794 | Ga0307515_10000026 | Ga0307515_10000026109 | 238 |
| 298 | 3300028794 | Ga0307515_10000051 | Ga0307515_10000051199 | 238 |
| 299 | 3300028794 | Ga0307515_10000305 | Ga0307515_1000030519 | 238 |
| 300 | 3300028794 | Ga0307515_10004253 | Ga0307515_100042533 | 238 |
| 301 | 3300028794 | Ga0307515_10006880 | Ga0307515_100068809 | 238 |
| 302 | 3300028794 | Ga0307515_10025690 | Ga0307515_100256908 | 238 |
| 303 | 3300028794 | Ga0307515_10095432 | Ga0307515_100954322 | 238 |
| 304 | 3300030522 | Ga0307512_10098240 | Ga0307512_100982402 | 238 |
| 305 | 3300031456 | Ga0307513_10015459 | Ga0307513_100154595 | 238 |
| 306 | 3300031456 | Ga0307513_10039983 | Ga0307513_100399834 | 238 |
| 307 | 3300031456 | Ga0307513_10243770 | Ga0307513_102437702 | 238 |
| 308 | 3300031507 | Ga0307509_10010432 | Ga0307509_1001043210 | 238 |
| 309 | 3300031507 | Ga0307509_10013769 | Ga0307509_100137697 | 238 |
| 310 | 3300031616 | Ga0307508_10000098 | Ga0307508_1000009810 | 238 |
| 311 | 3300031616 | Ga0307508_10000159 | Ga0307508_1000015948 | 238 |
| 312 | 3300031616 | Ga0307508_10313926 | Ga0307508_103139262 | 238 |
| 313 | 3300031649 | Ga0307514_10008269 | Ga0307514_100082694 | 238 |
| 314 | 3300031730 | Ga0307516_10003066 | Ga0307516_100030663 | 238 |
| 315 | 3300031730 | Ga0307516_10030498 | Ga0307516_100304982 | 238 |
| 316 | 3300033179 | Ga0307507_10064389 | Ga0307507_100643893 | 238 |
| 317 | 3300035117 | Ga0373953_0068769 | Ga0373953_0068769_482_1249 | 238 |
| 318 | 3300036401 | Ga0373937_0259585 | Ga0373937_0259585_363_1130 | 238 |
| 319 | 3300039447 | Ga0436361_0060431 | Ga0436361_0060431_159_899 | 238 |
| 320 | 3300041452 | Ga0451793_0207973 | Ga0451793_0207973_1164_1943 | 238 |
| 321 | 3300041491 | Ga0451833_1270813 | Ga0451833_1270813_825_1604 | 238 |
| 322 | 3300041496 | Ga0451839_1057768 | Ga0451839_1057768_379_1158 | 238 |
| 323 | 3300041507 | Ga0451851_0448762 | Ga0451851_0448762_326_1105 | 238 |
| 324 | 3300041512 | Ga0451853_1890114 | Ga0451853_1890114_143_922 | 238 |
| 325 | 3300042435 | Ga0439434_0116469 | Ga0439434_0116469_39_797 | 238 |
| 326 | 3300042876 | Ga0451577_0178794 | Ga0451577_0178794_354_1091 | 238 |
| 327 | 3300042876 | Ga0451577_0576409 | Ga0451577_0576409_68_841 | 238 |
| 328 | 3300044712 | Ga0453684_0071583 | Ga0453684_0071583_339_1115 | 238 |
| 329 | 3300046500 | Ga0495596_0070535 | Ga0495596_0070535_258_998 | 238 |
| 330 | 3300046506 | Ga0495583_0097552 | Ga0495583_0097552_335_1099 | 238 |
| 331 | 3300046512 | Ga0495610_0020856 | Ga0495610_0020856_2422_3201 | 238 |
| 332 | 3300046524 | Ga0495648_0067868 | Ga0495648_0067868_370_1128 | 238 |
| 333 | 3300046542 | Ga0495597_0002614 | Ga0495597_0002614_4013_4780 | 238 |
| 334 | 3300046616 | Ga0495668_0065020 | Ga0495668_0065020_697_1470 | 238 |
| 335 | 3300046660 | Ga0495625_0002218 | Ga0495625_0002218_15314_16093 | 238 |
| 336 | 3300046660 | Ga0495625_0234894 | Ga0495625_0234894_196_954 | 238 |
| 337 | 3300046683 | Ga0495658_0073883 | Ga0495658_0073883_380_1138 | 238 |
| 338 | 3300047443 | Ga0495687_000078 | Ga0495687_000078_74017_74757 | 238 |
| 339 | 3300047469 | Ga0495673_0063698 | Ga0495673_0063698_380_1138 | 238 |
| 340 | 3300047472 | Ga0495686_0066710 | Ga0495686_0066710_1368_2147 | 238 |
| 341 | 3300047472 | Ga0495686_0081042 | Ga0495686_0081042_493_1251 | 238 |
| 342 | 3300048905 | Ga0496102_0008536 | Ga0496102_0008536_1473_2234 | 238 |
| 343 | 3300049571 | Ga0501034_0391458 | Ga0501034_0391458_59_817 | 238 |
| 344 | 3300050489 | nmdc:mga03683_4370_c1 | nmdc:mga03683_4370_c1_1819_2583 | 238 |
| 345 | 3300050490 | nmdc:mga03n38_57588_c1 | nmdc:mga03n38_57588_c1_397_1161 | 238 |
| 346 | 3300050491 | nmdc:mga00v17_40775_c1 | nmdc:mga00v17_40775_c1_178_942 | 238 |
| 347 | 3300050493 | nmdc:mga0k408_17075_c1 | nmdc:mga0k408_17075_c1_1053_1817 | 238 |
| 348 | 3300050493 | nmdc:mga0k408_19881_c1 | nmdc:mga0k408_19881_c1_555_1328 | 238 |
| 349 | 3300050493 | nmdc:mga0k408_59284_c1 | nmdc:mga0k408_59284_c1_868_1632 | 238 |
| 350 | 3300050494 | nmdc:mga06z11_6776_c1 | nmdc:mga06z11_6776_c1_3481_4245 | 238 |
| 351 | 3300050496 | nmdc:mga07m45_103845_c1 | nmdc:mga07m45_103845_c1_422_1201 | 238 |
| 352 | 3300050496 | nmdc:mga07m45_11799_c1 | nmdc:mga07m45_11799_c1_472_1236 | 238 |
| 353 | 3300050516 | nmdc:mga0sz30_13382_c1 | nmdc:mga0sz30_13382_c1_615_1379 | 238 |
| 354 | 3300053093 | Ga0500651_0018573 | Ga0500651_0018573_3236_3994 | 238 |
| 355 | 3300053118 | Ga0500594_0001531 | Ga0500594_0001531_730_1488 | 238 |
| 356 | 3300053134 | Ga0500658_0002796 | Ga0500658_0002796_2328_3107 | 238 |
| 357 | 3300053136 | Ga0500559_0000134 | Ga0500559_0000134_21674_22432 | 238 |
| 358 | 3300053139 | Ga0500568_0076934 | Ga0500568_0076934_140_904 | 238 |
| 359 | 3300053154 | Ga0500619_000137 | Ga0500619_000137_12018_12782 | 238 |
| 360 | 3300053739 | Ga0500587_004869 | Ga0500587_004869_366_1124 | 238 |
| 361 | 3300053739 | Ga0500587_005872 | Ga0500587_005872_539_1318 | 238 |
| 362 | 3300003316 | rootH1_10147659 | rootH1_101476591 | 239 |
| 363 | 3300003322 | rootL2_10000128 | rootL2_100001282 | 239 |
| 364 | 3300003322 | rootL2_10220982 | rootL2_102209822 | 239 |
| 365 | 3300003759 | Ga0055525_1000011 | Ga0055525_1000011457 | 239 |
| 366 | 3300003759 | Ga0055525_1000046 | Ga0055525_100004645 | 239 |
| 367 | 3300005330 | Ga0070690_100064119 | Ga0070690_1000641192 | 239 |
| 368 | 3300005334 | Ga0068869_100256539 | Ga0068869_1002565392 | 239 |
| 369 | 3300005335 | Ga0070666_10045584 | Ga0070666_100455842 | 239 |
| 370 | 3300005335 | Ga0070666_10128249 | Ga0070666_101282492 | 239 |
| 371 | 3300005338 | Ga0068868_100355522 | Ga0068868_1003555221 | 239 |
| 372 | 3300005347 | Ga0070668_100023518 | Ga0070668_1000235187 | 239 |
| 373 | 3300005353 | Ga0070669_100055294 | Ga0070669_1000552945 | 239 |
| 374 | 3300005354 | Ga0070675_100059896 | Ga0070675_1000598962 | 239 |
| 375 | 3300005354 | Ga0070675_100153211 | Ga0070675_1001532112 | 239 |
| 376 | 3300005355 | Ga0070671_100070434 | Ga0070671_1000704343 | 239 |
| 377 | 3300005355 | Ga0070671_100446201 | Ga0070671_1004462012 | 239 |
| 378 | 3300005356 | Ga0070674_100023714 | Ga0070674_1000237144 | 239 |
| 379 | 3300005356 | Ga0070674_100053542 | Ga0070674_1000535422 | 239 |
| 380 | 3300005356 | Ga0070674_100532635 | Ga0070674_1005326351 | 239 |
| 381 | 3300005367 | Ga0070667_100004949 | Ga0070667_10000494913 | 239 |
| 382 | 3300005367 | Ga0070667_100152363 | Ga0070667_1001523632 | 239 |
| 383 | 3300005455 | Ga0070663_100000172 | Ga0070663_1000001725 | 239 |
| 384 | 3300005456 | Ga0070678_100194506 | Ga0070678_1001945062 | 239 |
| 385 | 3300005457 | Ga0070662_100345238 | Ga0070662_1003452382 | 239 |
| 386 | 3300005459 | Ga0068867_100075085 | Ga0068867_1000750853 | 239 |
| 387 | 3300005467 | Ga0070706_100012812 | Ga0070706_1000128129 | 239 |
| 388 | 3300005467 | Ga0070706_100154388 | Ga0070706_1001543883 | 239 |
| 389 | 3300005468 | Ga0070707_100034845 | Ga0070707_1000348453 | 239 |
| 390 | 3300005471 | Ga0070698_100243253 | Ga0070698_1002432532 | 239 |
| 391 | 3300005543 | Ga0070672_100004411 | Ga0070672_10000441112 | 239 |
| 392 | 3300005577 | Ga0068857_100084990 | Ga0068857_1000849903 | 239 |
| 393 | 3300005577 | Ga0068857_100667754 | Ga0068857_1006677541 | 239 |
| 394 | 3300005616 | Ga0068852_100007651 | Ga0068852_10000765110 | 239 |
| 395 | 3300005616 | Ga0068852_100063109 | Ga0068852_1000631094 | 239 |
| 396 | 3300005617 | Ga0068859_100041965 | Ga0068859_1000419656 | 239 |
| 397 | 3300005617 | Ga0068859_100442506 | Ga0068859_1004425062 | 239 |
| 398 | 3300005618 | Ga0068864_100119003 | Ga0068864_1001190032 | 239 |
| 399 | 3300005618 | Ga0068864_100122122 | Ga0068864_1001221222 | 239 |
| 400 | 3300005718 | Ga0068866_10018175 | Ga0068866_100181752 | 239 |
| 401 | 3300005719 | Ga0068861_100091450 | Ga0068861_1000914502 | 239 |
| 402 | 3300005841 | Ga0068863_100052311 | Ga0068863_1000523115 | 239 |
| 403 | 3300005842 | Ga0068858_100003457 | Ga0068858_10000345712 | 239 |
| 404 | 3300005843 | Ga0068860_100010521 | Ga0068860_10001052110 | 239 |
| 405 | 3300005844 | Ga0068862_100046531 | Ga0068862_1000465315 | 239 |
| 406 | 3300006042 | Ga0075368_10207221 | Ga0075368_102072211 | 239 |
| 407 | 3300006051 | Ga0075364_10187187 | Ga0075364_101871872 | 239 |
| 408 | 3300006177 | Ga0075362_10015684 | Ga0075362_100156842 | 239 |
| 409 | 3300006178 | Ga0075367_10005261 | Ga0075367_100052617 | 239 |
| 410 | 3300006178 | Ga0075367_10056457 | Ga0075367_100564573 | 239 |
| 411 | 3300006195 | Ga0075366_10018595 | Ga0075366_100185953 | 239 |
| 412 | 3300006195 | Ga0075366_10069318 | Ga0075366_100693182 | 239 |
| 413 | 3300006237 | Ga0097621_100018737 | Ga0097621_1000187375 | 239 |
| 414 | 3300006353 | Ga0075370_10003212 | Ga0075370_100032128 | 239 |
| 415 | 3300006353 | Ga0075370_10007548 | Ga0075370_100075486 | 239 |
| 416 | 3300006353 | Ga0075370_10062349 | Ga0075370_100623492 | 239 |
| 417 | 3300006881 | Ga0068865_100021548 | Ga0068865_1000215485 | 239 |
| 418 | 3300006931 | Ga0097620_100041965 | Ga0097620_1000419656 | 239 |
| 419 | 3300006931 | Ga0097620_100442472 | Ga0097620_1004424722 | 239 |
| 420 | 3300009148 | Ga0105243_10001208 | Ga0105243_100012084 | 239 |
| 421 | 3300009553 | Ga0105249_10071057 | Ga0105249_100710572 | 239 |
| 422 | 3300010375 | Ga0105239_10829492 | Ga0105239_108294922 | 239 |
| 423 | 3300013296 | Ga0157374_10118342 | Ga0157374_101183422 | 239 |
| 424 | 3300013296 | Ga0157374_10131273 | Ga0157374_101312732 | 239 |
| 425 | 3300013306 | Ga0163162_10081416 | Ga0163162_100814165 | 239 |
| 426 | 3300013306 | Ga0163162_11030625 | Ga0163162_110306251 | 239 |
| 427 | 3300013308 | Ga0157375_10178174 | Ga0157375_101781743 | 239 |
| 428 | 3300014326 | Ga0157380_10039716 | Ga0157380_100397164 | 239 |
| 429 | 3300014745 | Ga0157377_10000016 | Ga0157377_1000001677 | 239 |
| 430 | 3300014969 | Ga0157376_10562464 | Ga0157376_105624642 | 239 |
| 431 | 3300017792 | Ga0163161_10272440 | Ga0163161_102724402 | 239 |
| 432 | 3300020082 | Ga0206353_11440426 | Ga0206353_114404261 | 239 |
| 433 | 3300021361 | Ga0213872_10000710 | Ga0213872_1000071010 | 239 |
| 434 | 3300025230 | Ga0209563_100005 | Ga0209563_100005783 | 239 |
| 435 | 3300025893 | Ga0207682_10003745 | Ga0207682_100037457 | 239 |
| 436 | 3300025903 | Ga0207680_10289776 | Ga0207680_102897762 | 239 |
| 437 | 3300025907 | Ga0207645_10037411 | Ga0207645_100374112 | 239 |
| 438 | 3300025910 | Ga0207684_10047582 | Ga0207684_100475822 | 239 |
| 439 | 3300025923 | Ga0207681_10020476 | Ga0207681_100204762 | 239 |
| 440 | 3300025925 | Ga0207650_10006156 | Ga0207650_1000615610 | 239 |
| 441 | 3300025926 | Ga0207659_10127859 | Ga0207659_101278592 | 239 |
| 442 | 3300025926 | Ga0207659_10153708 | Ga0207659_101537082 | 239 |
| 443 | 3300025927 | Ga0207687_10064217 | Ga0207687_100642174 | 239 |
| 444 | 3300025931 | Ga0207644_10000924 | Ga0207644_1000092412 | 239 |
| 445 | 3300025932 | Ga0207690_10167488 | Ga0207690_101674882 | 239 |
| 446 | 3300025933 | Ga0207706_10054989 | Ga0207706_100549892 | 239 |
| 447 | 3300025933 | Ga0207706_10101818 | Ga0207706_101018182 | 239 |
| 448 | 3300025937 | Ga0207669_10076721 | Ga0207669_100767212 | 239 |
| 449 | 3300025938 | Ga0207704_10111664 | Ga0207704_101116643 | 239 |
| 450 | 3300025940 | Ga0207691_10510833 | Ga0207691_105108332 | 239 |
| 451 | 3300025941 | Ga0207711_10006498 | Ga0207711_1000649813 | 239 |
| 452 | 3300025941 | Ga0207711_10237146 | Ga0207711_102371461 | 239 |
| 453 | 3300025942 | Ga0207689_10003940 | Ga0207689_100039403 | 239 |
| 454 | 3300025961 | Ga0207712_10136980 | Ga0207712_101369802 | 239 |
| 455 | 3300025972 | Ga0207668_10590580 | Ga0207668_105905801 | 239 |
| 456 | 3300025986 | Ga0207658_10031648 | Ga0207658_100316482 | 239 |
| 457 | 3300026023 | Ga0207677_10410906 | Ga0207677_104109061 | 239 |
| 458 | 3300026035 | Ga0207703_10066736 | Ga0207703_100667365 | 239 |
| 459 | 3300026035 | Ga0207703_10444667 | Ga0207703_104446672 | 239 |
| 460 | 3300026067 | Ga0207678_10000478 | Ga0207678_100004786 | 239 |
| 461 | 3300026075 | Ga0207708_10178413 | Ga0207708_101784132 | 239 |
| 462 | 3300026088 | Ga0207641_10064210 | Ga0207641_100642103 | 239 |
| 463 | 3300026088 | Ga0207641_10081066 | Ga0207641_100810663 | 239 |
| 464 | 3300026089 | Ga0207648_10426260 | Ga0207648_104262602 | 239 |
| 465 | 3300026089 | Ga0207648_10559589 | Ga0207648_105595892 | 239 |
| 466 | 3300026095 | Ga0207676_10215227 | Ga0207676_102152272 | 239 |
| 467 | 3300026095 | Ga0207676_10624225 | Ga0207676_106242252 | 239 |
| 468 | 3300026095 | Ga0207676_10625593 | Ga0207676_106255932 | 239 |
| 469 | 3300026116 | Ga0207674_10014163 | Ga0207674_100141638 | 239 |
| 470 | 3300026116 | Ga0207674_10315985 | Ga0207674_103159852 | 239 |
| 471 | 3300026118 | Ga0207675_100038606 | Ga0207675_1000386062 | 239 |
| 472 | 3300026121 | Ga0207683_10548935 | Ga0207683_105489352 | 239 |
| 473 | 3300026142 | Ga0207698_10059115 | Ga0207698_100591153 | 239 |
| 474 | 3300028380 | Ga0268265_10024728 | Ga0268265_100247285 | 239 |
| 475 | 3300028381 | Ga0268264_10006835 | Ga0268264_100068355 | 239 |
| 476 | 3300028381 | Ga0268264_10633347 | Ga0268264_106333472 | 239 |
| 477 | 3300031239 | Ga0265328_10008350 | Ga0265328_100083503 | 239 |
| 478 | 3300031250 | Ga0265331_10010000 | Ga0265331_100100003 | 239 |
| 479 | 3300031251 | Ga0265327_10000078 | Ga0265327_10000078164 | 239 |
| 480 | 3300031456 | Ga0307513_10322523 | Ga0307513_103225232 | 239 |
| 481 | 3300031852 | Ga0307410_10167566 | Ga0307410_101675663 | 239 |
| 482 | 3300039447 | Ga0436361_0362737 | Ga0436361_0362737_2080_2844 | 239 |
| 483 | 3300039447 | Ga0436361_0855507 | Ga0436361_0855507_220_972 | 239 |
| 484 | 3300044656 | Ga0466969_0050747 | Ga0466969_0050747_116_919 | 239 |
| 485 | 3300044661 | Ga0466975_0331127 | Ga0466975_0331127_106_909 | 239 |
| 486 | 3300044683 | Ga0466965_0002967 | Ga0466965_0002967_2492_3295 | 239 |
| 487 | 3300044684 | Ga0466966_0003862 | Ga0466966_0003862_933_1736 | 239 |
| 488 | 3300044693 | Ga0466961_0016936 | Ga0466961_0016936_2126_2929 | 239 |
| 489 | 3300044706 | Ga0466964_0046890 | Ga0466964_0046890_817_1620 | 239 |
| 490 | 3300044735 | Ga0466968_0010399 | Ga0466968_0010399_117_920 | 239 |
| 491 | 3300044765 | Ga0466970_0075768 | Ga0466970_0075768_779_1582 | 239 |
| 492 | 3300044842 | Ga0466957_0005869 | Ga0466957_0005869_4850_5653 | 239 |
| 493 | 3300045049 | Ga0466959_0046888 | Ga0466959_0046888_1445_2248 | 239 |
| 494 | 3300045836 | Ga0466958_0117702 | Ga0466958_0117702_99_902 | 239 |
| 495 | 3300045976 | Ga0466967_0074550 | Ga0466967_0074550_1455_2258 | 239 |
| 496 | 3300045976 | Ga0466967_0558205 | Ga0466967_0558205_91_909 | 239 |
| 497 | 3300046475 | Ga0495639_0050769 | Ga0495639_0050769_638_1423 | 239 |
| 498 | 3300046519 | Ga0495632_0003624 | Ga0495632_0003624_5600_6373 | 239 |
| 499 | 3300046694 | Ga0495649_0007041 | Ga0495649_0007041_5331_6104 | 239 |
| 500 | 3300046810 | Ga0495660_0016584 | Ga0495660_0016584_1746_2519 | 239 |
| 501 | 3300047443 | Ga0495687_010018 | Ga0495687_010018_2009_2782 | 239 |
| 502 | 3300049579 | Ga0501043_0000149 | Ga0501043_0000149_28063_28818 | 239 |
| 503 | 3300049580 | Ga0501046_0000092 | Ga0501046_0000092_36441_37196 | 239 |
| 504 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_191636_192391 | 239 |
| 505 | 3300049582 | Ga0501048_0000097 | Ga0501048_0000097_27457_28212 | 239 |
| 506 | 3300049762 | Ga0501265_002175 | Ga0501265_002175_1258_2028 | 239 |
| 507 | 3300049777 | Ga0501281_03204 | Ga0501281_03204_17_787 | 239 |
| 508 | 3300049824 | Ga0501045_0002894 | Ga0501045_0002894_9864_10619 | 239 |
| 509 | 3300050493 | nmdc:mga0k408_13369_c1 | nmdc:mga0k408_13369_c1_3641_4414 | 239 |
| 510 | 3300050493 | nmdc:mga0k408_17184_c1 | nmdc:mga0k408_17184_c1_2618_3391 | 239 |
| 511 | 3300050493 | nmdc:mga0k408_50451_c1 | nmdc:mga0k408_50451_c1_372_1130 | 239 |
| 512 | 3300050493 | nmdc:mga0k408_96875_c1 | nmdc:mga0k408_96875_c1_432_1205 | 239 |
| 513 | 3300050496 | nmdc:mga07m45_220_c1 | nmdc:mga07m45_220_c1_14378_15151 | 239 |
| 514 | 3300050496 | nmdc:mga07m45_23119_c1 | nmdc:mga07m45_23119_c1_1467_2240 | 239 |
| 515 | 3300050508 | nmdc:mga09592_965_c1 | nmdc:mga09592_965_c1_2145_2966 | 239 |
| 516 | 3300053098 | Ga0500650_0081160 | Ga0500650_0081160_521_1294 | 239 |
| 517 | 3300053134 | Ga0500658_0002272 | Ga0500658_0002272_4537_5310 | 239 |
| 518 | 3300061719 | Ga0466962_0003867 | Ga0466962_0003867_5661_6464 | 239 |
| 519 | 3300002705 | JGI25156J39149_1000076 | JGI25156J39149_10000767 | 240 |
| 520 | 3300002738 | JGI25154J39366_1003428 | JGI25154J39366_10034284 | 240 |
| 521 | 3300002741 | JGI25157J39369_1000037 | JGI25157J39369_100003796 | 240 |
| 522 | 3300003316 | rootH1_10048059 | rootH1_100480591 | 240 |
| 523 | 3300003320 | rootH2_10001011 | rootH2_100010113 | 240 |
| 524 | 3300003322 | rootL2_10116308 | rootL2_101163085 | 240 |
| 525 | 3300003323 | rootH1_10146187 | rootH1_101461872 | 240 |
| 526 | 3300003752 | Ga0055539_1000180 | Ga0055539_100018036 | 240 |
| 527 | 3300003752 | Ga0055539_1003887 | Ga0055539_10038873 | 240 |
| 528 | 3300003756 | Ga0055533_1000169 | Ga0055533_10001698 | 240 |
| 529 | 3300003759 | Ga0055525_1000526 | Ga0055525_100052612 | 240 |
| 530 | 3300003761 | Ga0055535_1000177 | Ga0055535_100017755 | 240 |
| 531 | 3300003763 | Ga0055529_1000346 | Ga0055529_100034626 | 240 |
| 532 | 3300005327 | Ga0070658_10142750 | Ga0070658_101427502 | 240 |
| 533 | 3300005331 | Ga0070670_100052202 | Ga0070670_1000522022 | 240 |
| 534 | 3300005334 | Ga0068869_100185772 | Ga0068869_1001857722 | 240 |
| 535 | 3300005339 | Ga0070660_100062158 | Ga0070660_1000621582 | 240 |
| 536 | 3300005339 | Ga0070660_100563686 | Ga0070660_1005636861 | 240 |
| 537 | 3300005347 | Ga0070668_100121311 | Ga0070668_1001213112 | 240 |
| 538 | 3300005354 | Ga0070675_100528340 | Ga0070675_1005283401 | 240 |
| 539 | 3300005356 | Ga0070674_100348270 | Ga0070674_1003482702 | 240 |
| 540 | 3300005366 | Ga0070659_100036638 | Ga0070659_1000366384 | 240 |
| 541 | 3300005367 | Ga0070667_100284036 | Ga0070667_1002840362 | 240 |
| 542 | 3300005457 | Ga0070662_100295166 | Ga0070662_1002951662 | 240 |
| 543 | 3300005457 | Ga0070662_100603149 | Ga0070662_1006031491 | 240 |
| 544 | 3300005543 | Ga0070672_100081573 | Ga0070672_1000815734 | 240 |
| 545 | 3300005543 | Ga0070672_100155866 | Ga0070672_1001558662 | 240 |
| 546 | 3300005563 | Ga0068855_100002721 | Ga0068855_10000272110 | 240 |
| 547 | 3300005563 | Ga0068855_100361027 | Ga0068855_1003610272 | 240 |
| 548 | 3300005577 | Ga0068857_100001142 | Ga0068857_1000011427 | 240 |
| 549 | 3300005614 | Ga0068856_100005635 | Ga0068856_1000056354 | 240 |
| 550 | 3300005719 | Ga0068861_100038355 | Ga0068861_1000383552 | 240 |
| 551 | 3300005843 | Ga0068860_100938260 | Ga0068860_1009382601 | 240 |
| 552 | 3300006177 | Ga0075362_10174037 | Ga0075362_101740372 | 240 |
| 553 | 3300006353 | Ga0075370_10260648 | Ga0075370_102606482 | 240 |
| 554 | 3300009093 | Ga0105240_10169962 | Ga0105240_101699622 | 240 |
| 555 | 3300009094 | Ga0111539_10870216 | Ga0111539_108702161 | 240 |
| 556 | 3300009147 | Ga0114129_10118444 | Ga0114129_101184444 | 240 |
| 557 | 3300009148 | Ga0105243_10046506 | Ga0105243_100465063 | 240 |
| 558 | 3300009176 | Ga0105242_10179872 | Ga0105242_101798722 | 240 |
| 559 | 3300009551 | Ga0105238_10256926 | Ga0105238_102569262 | 240 |
| 560 | 3300010375 | Ga0105239_10010428 | Ga0105239_100104283 | 240 |
| 561 | 3300013296 | Ga0157374_10123028 | Ga0157374_101230283 | 240 |
| 562 | 3300013297 | Ga0157378_10196196 | Ga0157378_101961962 | 240 |
| 563 | 3300013306 | Ga0163162_10440953 | Ga0163162_104409532 | 240 |
| 564 | 3300013308 | Ga0157375_10176788 | Ga0157375_101767882 | 240 |
| 565 | 3300014326 | Ga0157380_10111468 | Ga0157380_101114682 | 240 |
| 566 | 3300014745 | Ga0157377_10143964 | Ga0157377_101439642 | 240 |
| 567 | 3300015683 | Ga0183362_10001 | Ga0183362_100011068 | 240 |
| 568 | 3300021361 | Ga0213872_10051886 | Ga0213872_100518862 | 240 |
| 569 | 3300025226 | Ga0209674_100165 | Ga0209674_10016525 | 240 |
| 570 | 3300025230 | Ga0209563_100137 | Ga0209563_10013725 | 240 |
| 571 | 3300025230 | Ga0209563_111937 | Ga0209563_1119372 | 240 |
| 572 | 3300025231 | Ga0207427_101146 | Ga0207427_1011466 | 240 |
| 573 | 3300025242 | Ga0209258_100146 | Ga0209258_100146146 | 240 |
| 574 | 3300025242 | Ga0209258_100973 | Ga0209258_1009735 | 240 |
| 575 | 3300025246 | Ga0209646_1000062 | Ga0209646_1000062193 | 240 |
| 576 | 3300025250 | Ga0209026_1000026 | Ga0209026_100002619 | 240 |
| 577 | 3300025253 | Ga0209677_100124 | Ga0209677_10012461 | 240 |
| 578 | 3300025253 | Ga0209677_100191 | Ga0209677_10019140 | 240 |
| 579 | 3300025253 | Ga0209677_101539 | Ga0209677_1015394 | 240 |
| 580 | 3300025256 | Ga0209759_1000050 | Ga0209759_1000050162 | 240 |
| 581 | 3300025256 | Ga0209759_1001102 | Ga0209759_10011027 | 240 |
| 582 | 3300025256 | Ga0209759_1001457 | Ga0209759_100145710 | 240 |
| 583 | 3300025256 | Ga0209759_1008489 | Ga0209759_10084893 | 240 |
| 584 | 3300025256 | Ga0209759_1011545 | Ga0209759_10115453 | 240 |
| 585 | 3300025272 | Ga0209455_1000059 | Ga0209455_1000059146 | 240 |
| 586 | 3300025303 | Ga0209051_1012820 | Ga0209051_10128203 | 240 |
| 587 | 3300025893 | Ga0207682_10075488 | Ga0207682_100754882 | 240 |
| 588 | 3300025899 | Ga0207642_10215411 | Ga0207642_102154111 | 240 |
| 589 | 3300025901 | Ga0207688_10061796 | Ga0207688_100617963 | 240 |
| 590 | 3300025909 | Ga0207705_10196295 | Ga0207705_101962952 | 240 |
| 591 | 3300025909 | Ga0207705_10506943 | Ga0207705_105069431 | 240 |
| 592 | 3300025913 | Ga0207695_10018539 | Ga0207695_100185393 | 240 |
| 593 | 3300025919 | Ga0207657_10010303 | Ga0207657_100103033 | 240 |
| 594 | 3300025919 | Ga0207657_10500555 | Ga0207657_105005551 | 240 |
| 595 | 3300025920 | Ga0207649_10235460 | Ga0207649_102354602 | 240 |
| 596 | 3300025925 | Ga0207650_10098602 | Ga0207650_100986022 | 240 |
| 597 | 3300025925 | Ga0207650_10584120 | Ga0207650_105841201 | 240 |
| 598 | 3300025926 | Ga0207659_10099075 | Ga0207659_100990752 | 240 |
| 599 | 3300025933 | Ga0207706_10071708 | Ga0207706_100717083 | 240 |
| 600 | 3300025933 | Ga0207706_10401590 | Ga0207706_104015901 | 240 |
| 601 | 3300025935 | Ga0207709_10020701 | Ga0207709_100207013 | 240 |
| 602 | 3300025937 | Ga0207669_10163304 | Ga0207669_101633042 | 240 |
| 603 | 3300025949 | Ga0207667_10001993 | Ga0207667_100019938 | 240 |
| 604 | 3300025949 | Ga0207667_10539739 | Ga0207667_105397392 | 240 |
| 605 | 3300025960 | Ga0207651_10000893 | Ga0207651_100008933 | 240 |
| 606 | 3300026078 | Ga0207702_10000573 | Ga0207702_1000057319 | 240 |
| 607 | 3300026116 | Ga0207674_10001842 | Ga0207674_1000184212 | 240 |
| 608 | 3300026118 | Ga0207675_100036720 | Ga0207675_1000367204 | 240 |
| 609 | 3300026118 | Ga0207675_100122801 | Ga0207675_1001228013 | 240 |
| 610 | 3300026121 | Ga0207683_10442906 | Ga0207683_104429062 | 240 |
| 611 | 3300026142 | Ga0207698_10236080 | Ga0207698_102360802 | 240 |
| 612 | 3300028379 | Ga0268266_10435893 | Ga0268266_104358932 | 240 |
| 613 | 3300028381 | Ga0268264_10599936 | Ga0268264_105999362 | 240 |
| 614 | 3300028666 | Ga0265336_10000119 | Ga0265336_1000011942 | 240 |
| 615 | 3300029957 | Ga0265324_10009959 | Ga0265324_100099592 | 240 |
| 616 | 3300030522 | Ga0307512_10024522 | Ga0307512_100245223 | 240 |
| 617 | 3300031456 | Ga0307513_10064266 | Ga0307513_100642664 | 240 |
| 618 | 3300031507 | Ga0307509_10001286 | Ga0307509_100012868 | 240 |
| 619 | 3300031730 | Ga0307516_10002826 | Ga0307516_100028266 | 240 |
| 620 | 3300031838 | Ga0307518_10235322 | Ga0307518_102353222 | 240 |
| 621 | 3300033180 | Ga0307510_10002924 | Ga0307510_100029248 | 240 |
| 622 | 3300037466 | Ga0395898_0134229 | Ga0395898_0134229_717_1502 | 240 |
| 623 | 3300038443 | Ga0395901_0001599 | Ga0395901_0001599_21950_22735 | 240 |
| 624 | 3300039447 | Ga0436361_0180496 | Ga0436361_0180496_431_1207 | 240 |
| 625 | 3300045051 | Ga0451576_0024224 | Ga0451576_0024224_3113_3871 | 240 |
| 626 | 3300046454 | Ga0495592_0000205 | Ga0495592_0000205_44732_45499 | 240 |
| 627 | 3300046462 | Ga0495651_0115987 | Ga0495651_0115987_879_1664 | 240 |
| 628 | 3300046506 | Ga0495583_0000585 | Ga0495583_0000585_20606_21391 | 240 |
| 629 | 3300046507 | Ga0495606_0005296 | Ga0495606_0005296_9202_9987 | 240 |
| 630 | 3300046616 | Ga0495668_0020891 | Ga0495668_0020891_1432_2217 | 240 |
| 631 | 3300046660 | Ga0495625_0051677 | Ga0495625_0051677_2119_2904 | 240 |
| 632 | 3300046684 | Ga0495669_0020999 | Ga0495669_0020999_1553_2338 | 240 |
| 633 | 3300046694 | Ga0495649_0008123 | Ga0495649_0008123_3559_4344 | 240 |
| 634 | 3300047443 | Ga0495687_000473 | Ga0495687_000473_23792_24586 | 240 |
| 635 | 3300048907 | Ga0496104_0008971 | Ga0496104_0008971_4448_5212 | 240 |
| 636 | 3300048924 | Ga0496121_0035317 | Ga0496121_0035317_3030_3794 | 240 |
| 637 | 3300048927 | Ga0496124_0002098 | Ga0496124_0002098_12805_13569 | 240 |
| 638 | 3300048928 | Ga0496125_0004872 | Ga0496125_0004872_13136_13900 | 240 |
| 639 | 3300049460 | Ga0495682_0041378 | Ga0495682_0041378_578_1345 | 240 |
| 640 | 3300050507 | nmdc:mga05p37_129068_c1 | nmdc:mga05p37_129068_c1_790_1578 | 240 |
| 641 | 3300053080 | Ga0500635_0000129 | Ga0500635_0000129_43397_44182 | 240 |
| 642 | 3300055283 | Ga0500661_006420 | Ga0500661_006420_555_1340 | 240 |
| 643 | iso_pu_bacteria | 2524614729 | 2525556656 | 240 |
| 644 | iso_pu_bacteria | 2627854209 | 2630648252 | 240 |
| 645 | 3300003322 | rootL2_10292878 | rootL2_102928782 | 241 |
| 646 | 3300003775 | Ga0055524_1000182 | Ga0055524_100018255 | 241 |
| 647 | 3300003791 | Ga0055530_10003939 | Ga0055530_100039393 | 241 |
| 648 | 3300003792 | Ga0055540_1000233 | Ga0055540_10002336 | 241 |
| 649 | 3300003794 | Ga0055531_10021528 | Ga0055531_100215283 | 241 |
| 650 | 3300005339 | Ga0070660_100126394 | Ga0070660_1001263942 | 241 |
| 651 | 3300005344 | Ga0070661_100002048 | Ga0070661_1000020486 | 241 |
| 652 | 3300005366 | Ga0070659_100000684 | Ga0070659_10000068417 | 241 |
| 653 | 3300005459 | Ga0068867_100000070 | Ga0068867_1000000706 | 241 |
| 654 | 3300005564 | Ga0070664_100011468 | Ga0070664_1000114682 | 241 |
| 655 | 3300005578 | Ga0068854_100422408 | Ga0068854_1004224081 | 241 |
| 656 | 3300006042 | Ga0075368_10115570 | Ga0075368_101155702 | 241 |
| 657 | 3300006946 | Ga0079104_1000333 | Ga0079104_10003338 | 241 |
| 658 | 3300009093 | Ga0105240_10052231 | Ga0105240_100522313 | 241 |
| 659 | 3300009098 | Ga0105245_10204521 | Ga0105245_102045212 | 241 |
| 660 | 3300009148 | Ga0105243_10017699 | Ga0105243_100176993 | 241 |
| 661 | 3300009545 | Ga0105237_10129910 | Ga0105237_101299103 | 241 |
| 662 | 3300010375 | Ga0105239_10149036 | Ga0105239_101490362 | 241 |
| 663 | 3300025291 | Ga0209675_1008884 | Ga0209675_10088843 | 241 |
| 664 | 3300025298 | Ga0209050_1002670 | Ga0209050_10026707 | 241 |
| 665 | 3300025298 | Ga0209050_1016415 | Ga0209050_10164153 | 241 |
| 666 | 3300025299 | Ga0209256_1000024 | Ga0209256_1000024436 | 241 |
| 667 | 3300025303 | Ga0209051_1000155 | Ga0209051_10001557 | 241 |
| 668 | 3300025304 | Ga0209257_1000236 | Ga0209257_10002367 | 241 |
| 669 | 3300025920 | Ga0207649_10005919 | Ga0207649_100059196 | 241 |
| 670 | 3300025932 | Ga0207690_10005848 | Ga0207690_100058483 | 241 |
| 671 | 3300025935 | Ga0207709_10002246 | Ga0207709_100022464 | 241 |
| 672 | 3300025945 | Ga0207679_10003912 | Ga0207679_100039127 | 241 |
| 673 | 3300025945 | Ga0207679_10059750 | Ga0207679_100597503 | 241 |
| 674 | 3300026089 | Ga0207648_10000412 | Ga0207648_100004126 | 241 |
| 675 | 3300027111 | Ga0209281_1000322 | Ga0209281_10003228 | 241 |
| 676 | 3300027695 | Ga0209966_1000005 | Ga0209966_100000579 | 241 |
| 677 | 3300028379 | Ga0268266_10629987 | Ga0268266_106299871 | 241 |
| 678 | 3300028794 | Ga0307515_10137858 | Ga0307515_101378582 | 241 |
| 679 | 3300039447 | Ga0436361_0146317 | Ga0436361_0146317_5267_6034 | 241 |
| 680 | 3300042531 | Ga0450918_000287 | Ga0450918_000287_5170_5937 | 241 |
| 681 | 3300042876 | Ga0451577_0186179 | Ga0451577_0186179_657_1436 | 241 |
| 682 | 3300046471 | Ga0495650_0010155 | Ga0495650_0010155_1383_2141 | 241 |
| 683 | 3300046535 | Ga0495586_0007585 | Ga0495586_0007585_3418_4200 | 241 |
| 684 | 3300047472 | Ga0495686_0007475 | Ga0495686_0007475_4132_4923 | 241 |
| 685 | 3300048917 | Ga0496114_0134827 | Ga0496114_0134827_161_928 | 241 |
| 686 | 3300048928 | Ga0496125_0051782 | Ga0496125_0051782_2452_3216 | 241 |
| 687 | 3300050489 | nmdc:mga03683_11744_c1 | nmdc:mga03683_11744_c1_1563_2363 | 241 |
| 688 | 3300050491 | nmdc:mga00v17_85501_c1 | nmdc:mga00v17_85501_c1_786_1586 | 241 |
| 689 | 3300050493 | nmdc:mga0k408_11730_c1 | nmdc:mga0k408_11730_c1_1531_2331 | 241 |
| 690 | 3300050496 | nmdc:mga07m45_8131_c1 | nmdc:mga07m45_8131_c1_2446_3246 | 241 |
| 691 | 3300053161 | Ga0500634_0103218 | Ga0500634_0103218_44_799 | 241 |
| 692 | 3300005355 | Ga0070671_100011544 | Ga0070671_1000115444 | 242 |
| 693 | 3300009093 | Ga0105240_10050723 | Ga0105240_100507232 | 242 |
| 694 | 3300009174 | Ga0105241_10566064 | Ga0105241_105660642 | 242 |
| 695 | 3300009177 | Ga0105248_10001394 | Ga0105248_1000139418 | 242 |
| 696 | 3300009545 | Ga0105237_10002681 | Ga0105237_1000268110 | 242 |
| 697 | 3300009551 | Ga0105238_10010268 | Ga0105238_100102682 | 242 |
| 698 | 3300010375 | Ga0105239_10001896 | Ga0105239_1000189613 | 242 |
| 699 | 3300025911 | Ga0207654_10385906 | Ga0207654_103859062 | 242 |
| 700 | 3300025913 | Ga0207695_10037040 | Ga0207695_100370406 | 242 |
| 701 | 3300025914 | Ga0207671_10002325 | Ga0207671_1000232519 | 242 |
| 702 | 3300025923 | Ga0207681_10065945 | Ga0207681_100659453 | 242 |
| 703 | 3300025931 | Ga0207644_10166966 | Ga0207644_101669662 | 242 |
| 704 | 3300026041 | Ga0207639_10083956 | Ga0207639_100839562 | 242 |
| 705 | 3300037418 | Ga0395900_0000050 | Ga0395900_0000050_222122_222919 | 242 |
| 706 | 3300037466 | Ga0395898_0000817 | Ga0395898_0000817_49723_50520 | 242 |
| 707 | 3300044656 | Ga0466969_0023854 | Ga0466969_0023854_2184_2954 | 242 |
| 708 | 3300044658 | Ga0466972_0116790 | Ga0466972_0116790_462_1217 | 242 |
| 709 | 3300044683 | Ga0466965_0024197 | Ga0466965_0024197_1749_2504 | 242 |
| 710 | 3300044683 | Ga0466965_0045731 | Ga0466965_0045731_282_1037 | 242 |
| 711 | 3300044684 | Ga0466966_0005496 | Ga0466966_0005496_5096_5866 | 242 |
| 712 | 3300044693 | Ga0466961_0012612 | Ga0466961_0012612_3144_3914 | 242 |
| 713 | 3300044706 | Ga0466964_0004693 | Ga0466964_0004693_3119_3889 | 242 |
| 714 | 3300044719 | Ga0466971_0016744 | Ga0466971_0016744_601_1371 | 242 |
| 715 | 3300044765 | Ga0466970_0079395 | Ga0466970_0079395_636_1406 | 242 |
| 716 | 3300045049 | Ga0466959_0000285 | Ga0466959_0000285_188_958 | 242 |
| 717 | 3300045976 | Ga0466967_0011318 | Ga0466967_0011318_1867_2637 | 242 |
| 718 | 3300048911 | Ga0496108_0147760 | Ga0496108_0147760_155_925 | 242 |
| 719 | 3300048912 | Ga0496109_0098397 | Ga0496109_0098397_803_1573 | 242 |
| 720 | 3300048913 | Ga0496110_0204149 | Ga0496110_0204149_283_1053 | 242 |
| 721 | 3300048915 | Ga0496112_0013286 | Ga0496112_0013286_3064_3834 | 242 |
| 722 | 3300049649 | Ga0501198_000039 | Ga0501198_000039_44790_45605 | 242 |
| 723 | 3300049662 | Ga0501222_000043 | Ga0501222_000043_44790_45605 | 242 |
| 724 | 3300049822 | Ga0501035_0036476 | Ga0501035_0036476_2415_3185 | 242 |
| 725 | 3300059421 | Ga0590071_001197 | Ga0590071_001197_2585_3349 | 242 |
| 726 | 3300061719 | Ga0466962_0022710 | Ga0466962_0022710_1292_2062 | 242 |
| 727 | 3300005457 | Ga0070662_100013398 | Ga0070662_1000133985 | 243 |
| 728 | 3300006353 | Ga0075370_10016620 | Ga0075370_100166203 | 243 |
| 729 | 3300025933 | Ga0207706_10005864 | Ga0207706_1000586411 | 243 |
| 730 | 3300026142 | Ga0207698_10305646 | Ga0207698_103056462 | 243 |
| 731 | 3300037471 | Ga0395905_0013384 | Ga0395905_0013384_2362_3120 | 243 |
| 732 | 3300037471 | Ga0395905_0386006 | Ga0395905_0386006_196_966 | 243 |
| 733 | 3300044656 | Ga0466969_0025097 | Ga0466969_0025097_1823_2608 | 243 |
| 734 | 3300044658 | Ga0466972_0000564 | Ga0466972_0000564_13386_14261 | 243 |
| 735 | 3300044658 | Ga0466972_0047073 | Ga0466972_0047073_889_1659 | 243 |
| 736 | 3300044683 | Ga0466965_0018420 | Ga0466965_0018420_1520_2305 | 243 |
| 737 | 3300044684 | Ga0466966_0076484 | Ga0466966_0076484_890_1675 | 243 |
| 738 | 3300044693 | Ga0466961_0000655 | Ga0466961_0000655_16800_17585 | 243 |
| 739 | 3300044719 | Ga0466971_0011261 | Ga0466971_0011261_890_1675 | 243 |
| 740 | 3300044765 | Ga0466970_0271794 | Ga0466970_0271794_148_933 | 243 |
| 741 | 3300045049 | Ga0466959_0044517 | Ga0466959_0044517_2116_2901 | 243 |
| 742 | 3300050496 | nmdc:mga07m45_98223_c1 | nmdc:mga07m45_98223_c1_60_818 | 243 |
| 743 | iso_pu_bacteria | 2894414249 | 2894415630 | 243 |
| 744 | iso_pu_bacteria | 2643221579 | 2643907752 | 244 |
| 745 | iso_pu_bacteria | 2643221581 | 2643916041 | 244 |
| 746 | iso_pu_bacteria | 2923516293 | 2923518430 | 244 |
| 747 | 3300006051 | Ga0075364_10000093 | Ga0075364_1000009326 | 245 |
| 748 | 3300050491 | nmdc:mga00v17_817_c1 | nmdc:mga00v17_817_c1_14366_15103 | 245 |
| 749 | 2162886007 | SwRhRL2b_contig_1242637 | SwRhRL2b_0867.00001310 | 248 |
| 750 | 3300025292 | Ga0209676_1000086 | Ga0209676_1000086227 | 248 |
| 751 | 3300032004 | Ga0307414_10184698 | Ga0307414_101846982 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z3l-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9687 | 4 | 230 |
| 2cxa-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.965 | 4 | 230 |
| 2dps-assembly1.cif.gz_A | structure of leucyl/phenylalanyl-trna-protein transferase | 0.96 | 6 | 230 |
| 2z3o-assembly1.cif.gz_A | complex structure of lf-transferase and phenylalanine | 0.9593 | 4 | 230 |
| 2z3n-assembly1.cif.gz_B | complex structure of lf-transferase and peptide b | 0.9486 | 4 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z3kA02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain | 0.949 | 65 | 230 | 3.40.630.70 |
| 2dpsB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9367 | 4 | 64 | 3.30.70.3550 |
| 2z3lB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9318 | 4 | 64 | 3.30.70.3550 |
| 2z3lB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9174 | 4 | 64 | 3.30.70.3550 |
| 2dpsB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9079 | 4 | 64 | 3.30.70.3550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A518N0Z5-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.99 | 2 | 245 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A7T8MQG1-F1-model_v4 | deleted | 0.988 | 2 | 243 |
|
| AF-A0A4V1KQN6-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9844 | 30 | 217 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-Q7MAC4-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9839 | 16 | 224 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A2M7WP89-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.983 | 14 | 217 |
GO:0005737
GO:0008914 GO:0030163 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar