F478848

General Info

Members Datasets Scaffolds Average Seq Length
746 368 741 109

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100021366|Ga0068857_1000213665
Length 128
Sequence MSDRRMLPIRLDTALEEPTMTDDTQARIATAVASADVLLFMKGTPLFPQCGFSSRAIAILDHLGVEYATVDVLQDPEIRAGIKEFSDWPTIPQLYVGGEFVGGSDIMMEMYEAGELLQLLDAKGIAHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
106 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
191 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
226 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
284 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
285 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
286 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
287 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
288 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
289 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
290 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
304 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
305 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
306 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
307 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
308 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
309 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
310 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
311 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
312 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
313 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
317 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
318 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
319 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
320 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
321 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
322 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
323 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
324 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
325 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
326 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
327 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
328 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
329 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
330 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
331 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
335 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
346 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
350 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
351 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
352 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
353 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
356 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
357 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
366 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 2.14
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.66
Nodule 0
Rhizoplane 3.49
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_944437 2162886007 Bacteria 1095
2 LJQas_1037756 3300000549 Bacteria 570
3 JGI24736J21556_1000032 3300001904 Bacteria 24066
4 JGI24752J21851_1000082 3300001976 Bacteria 12689
5 JGI24752J21851_1000644 3300001976 Bacteria 4647
6 JGI24752J21851_1006793 3300001976 Bacteria 1495
7 JGI24740J21852_10005188 3300001979 Bacteria 5530
8 JGI24739J22299_10000162 3300001989 Bacteria 21912
9 JGI24739J22299_10025324 3300001989 Bacteria 2087
10 JGI24739J22299_10093354 3300001989 Bacteria 914
11 JGI24737J22298_10020755 3300001990 Bacteria 2096
12 JGI24750J21931_1000116 3300002070 Bacteria 12611
13 JGI24748J21848_1000036 3300002074 Bacteria 72512
14 JGI24738J21930_10000231 3300002075 Bacteria 15154
15 JGI24749J21850_1000049 3300002076 Bacteria 22639
16 JGI24749J21850_1048288 3300002076 Bacteria 632
17 JGI24034J26672_10000008 3300002239 Bacteria 200986
18 JGI24034J26672_10000038 3300002239 Bacteria 75372
19 JGI24034J26672_10003845 3300002239 Bacteria 2109
20 JGI24034J26672_10015831 3300002239 Bacteria 1157
21 JGI24034J26672_10041405 3300002239 Bacteria 774
22 JGI24742J22300_10005496 3300002244 Bacteria 2085
23 JGI24751J29686_10000216 3300002459 Bacteria 24503
24 JGI24751J29686_10018164 3300002459 Bacteria 1454
25 JGI25150J39212_1002047 3300002774 Bacteria 5243
26 JGI25153J46596_10000395 3300003215 Bacteria 29365
27 Ga0055536_1012135 3300003781 Bacteria 3225
28 Ga0055530_10007314 3300003791 Bacteria 4682
29 Ga0055540_1002064 3300003792 Bacteria 11085
30 Ga0058859_11187240 3300004798 Bacteria 615
31 Ga0065165_1062777 3300005262 Bacteria 1012
32 Ga0065165_1112184 3300005262 Bacteria 670
33 Ga0065704_10124492 3300005289 Bacteria 1717
34 Ga0065715_10344649 3300005293 Bacteria 924
35 Ga0065707_10000505 3300005295 Bacteria 50569
36 Ga0065707_10086198 3300005295 Bacteria 5602
37 Ga0065707_10098261 3300005295 Bacteria 3099
38 Ga0065707_10212812 3300005295 Bacteria 1258
39 Ga0065707_10414622 3300005295 Bacteria 837
40 Ga0070658_10000172 3300005327 Bacteria 56478
41 Ga0070658_10040826 3300005327 Bacteria 3744
42 Ga0070658_10603273 3300005327 Bacteria 951
43 Ga0070658_10707327 3300005327 Bacteria 875
44 Ga0070683_101233833 3300005329 Bacteria 718
45 Ga0070690_100000021 3300005330 Bacteria 74350
46 Ga0070690_100459866 3300005330 Bacteria 945
47 Ga0070670_100000003 3300005331 Bacteria 529510
48 Ga0070670_100000021 3300005331 Bacteria 202776
49 Ga0070670_100002377 3300005331 Bacteria 15504
50 Ga0070670_100004170 3300005331 Bacteria 12090
51 Ga0070670_100368417 3300005331 Bacteria 1264
52 Ga0070670_100426848 3300005331 Bacteria 1172
53 Ga0070677_10001197 3300005333 Bacteria 8311
54 Ga0070666_10000004 3300005335 Bacteria 372098
55 Ga0070666_10000184 3300005335 Bacteria 42807
56 Ga0070666_10033483 3300005335 Bacteria 3400
57 Ga0070666_11043600 3300005335 Bacteria 607
58 Ga0070666_11126734 3300005335 Bacteria 584
59 Ga0070682_100178661 3300005337 Bacteria 1481
60 Ga0070660_100000399 3300005339 Bacteria 28896
61 Ga0070660_101735441 3300005339 Bacteria 532
62 Ga0070689_100005020 3300005340 Bacteria 8993
63 Ga0070661_100246068 3300005344 Bacteria 1378
64 Ga0070661_100251887 3300005344 Bacteria 1363
65 Ga0070661_100988057 3300005344 Bacteria 698
66 Ga0070692_10000103 3300005345 Bacteria 19068
67 Ga0070692_10001265 3300005345 Bacteria 9029
68 Ga0070692_10002712 3300005345 Bacteria 6946
69 Ga0070668_100000026 3300005347 Bacteria 92584
70 Ga0070668_100288829 3300005347 Bacteria 1372
71 Ga0070668_100428915 3300005347 Bacteria 1133
72 Ga0070668_100518306 3300005347 Bacteria 1034
73 Ga0070669_100000008 3300005353 Bacteria 226764
74 Ga0070669_100000020 3300005353 Bacteria 181297
75 Ga0070669_100000457 3300005353 Bacteria 31025
76 Ga0070669_100093939 3300005353 Bacteria 2253
77 Ga0070669_100123994 3300005353 Bacteria 1975
78 Ga0070669_101376636 3300005353 Bacteria 612
79 Ga0070675_100018970 3300005354 Bacteria 5479
80 Ga0070671_100000015 3300005355 Bacteria 166132
81 Ga0070671_100000470 3300005355 Bacteria 28105
82 Ga0070671_100035948 3300005355 Bacteria 4105
83 Ga0070671_100060705 3300005355 Bacteria 3148
84 Ga0070688_100003653 3300005365 Bacteria 7942
85 Ga0070659_100013894 3300005366 Bacteria 6008
86 Ga0070659_100035203 3300005366 Bacteria 3899
87 Ga0070667_100000019 3300005367 Bacteria 224710
88 Ga0070667_100000089 3300005367 Bacteria 113661
89 Ga0070667_100000642 3300005367 Bacteria 33958
90 Ga0070667_100006367 3300005367 Bacteria 9810
91 Ga0070667_100010059 3300005367 Bacteria 7835
92 Ga0070667_100037194 3300005367 Bacteria 4081
93 Ga0070709_10012137 3300005434 Bacteria 4816
94 Ga0070714_100061476 3300005435 Bacteria 3226
95 Ga0070713_100002710 3300005436 Bacteria 11555
96 Ga0070713_100065476 3300005436 Bacteria 3053
97 Ga0070705_100054779 3300005440 Bacteria 2341
98 Ga0070694_101218665 3300005444 Bacteria 631
99 Ga0070708_100198374 3300005445 Bacteria 1878
100 Ga0070663_100075753 3300005455 Bacteria 2459
101 Ga0070663_100129274 3300005455 Bacteria 1916
102 Ga0070663_100588916 3300005455 Bacteria 934
103 Ga0070663_101747653 3300005455 Bacteria 557
104 Ga0070678_100593866 3300005456 Bacteria 988
105 Ga0070678_102081094 3300005456 Bacteria 537
106 Ga0070662_100112452 3300005457 Bacteria 2076
107 Ga0070685_10000724 3300005466 Bacteria 17961
108 Ga0070706_100327632 3300005467 Bacteria 1428
109 Ga0070698_101498001 3300005471 Bacteria 626
110 Ga0070679_100082753 3300005530 Bacteria 3199
111 Ga0070684_100168126 3300005535 Bacteria 1991
112 Ga0070684_100572744 3300005535 Bacteria 1049
113 Ga0070684_101012712 3300005535 Bacteria 780
114 Ga0068853_100003716 3300005539 Bacteria 11716
115 Ga0068853_100021557 3300005539 Bacteria 5374
116 Ga0068853_101121382 3300005539 Bacteria 759
117 Ga0070672_101519879 3300005543 Bacteria 600
118 Ga0070686_100000012 3300005544 Bacteria 176038
119 Ga0070686_100000352 3300005544 Bacteria 29658
120 Ga0070693_101031312 3300005547 Bacteria 624
121 Ga0070693_101227001 3300005547 Bacteria 577
122 Ga0070665_100000004 3300005548 Bacteria 785500
123 Ga0070665_100000361 3300005548 Bacteria 67731
124 Ga0070665_100001120 3300005548 Bacteria 32952
125 Ga0070665_100378831 3300005548 Bacteria 1422
126 Ga0070665_100736340 3300005548 Bacteria 999
127 Ga0070665_101432299 3300005548 Bacteria 700
128 Ga0068855_100135463 3300005563 Bacteria 2810
129 Ga0068855_100395754 3300005563 Bacteria 1515
130 Ga0068855_100577260 3300005563 Bacteria 1215
131 Ga0070664_100221374 3300005564 Bacteria 1693
132 Ga0070664_100391722 3300005564 Bacteria 1269
133 Ga0070664_102058436 3300005564 Bacteria 542
134 Ga0068857_100021366 3300005577 Bacteria 5697
135 Ga0068857_100089221 3300005577 Bacteria 2758
136 Ga0068854_100075543 3300005578 Bacteria 2474
137 Ga0068854_100178512 3300005578 Bacteria 1657
138 Ga0068854_101175013 3300005578 Bacteria 686
139 Ga0070702_101393985 3300005615 Bacteria 573
140 Ga0068852_100244943 3300005616 Bacteria 1715
141 Ga0068852_101465431 3300005616 Bacteria 705
142 Ga0068859_100003505 3300005617 Bacteria 15985
143 Ga0068859_100023533 3300005617 Bacteria 6181
144 Ga0068859_100028374 3300005617 Bacteria 5611
145 Ga0068859_100042554 3300005617 Bacteria 4563
146 Ga0068859_100216629 3300005617 Bacteria 2002
147 Ga0068864_100000004 3300005618 Bacteria 489341
148 Ga0068864_100000005 3300005618 Bacteria 400840
149 Ga0068864_100005620 3300005618 Bacteria 10277
150 Ga0068864_100007081 3300005618 Bacteria 9208
151 Ga0068864_100030140 3300005618 Bacteria 4598
152 Ga0068864_100466728 3300005618 Bacteria 1210
153 Ga0068861_100004980 3300005719 Bacteria 8951
154 Ga0068861_100020681 3300005719 Bacteria 4718
155 Ga0068861_100154977 3300005719 Bacteria 1883
156 Ga0068851_10064379 3300005834 Bacteria 1884
157 Ga0068870_10954518 3300005840 Bacteria 609
158 Ga0068863_100000002 3300005841 Bacteria 489510
159 Ga0068863_100000013 3300005841 Bacteria 220357
160 Ga0068863_100002259 3300005841 Bacteria 19135
161 Ga0068863_100067996 3300005841 Bacteria 3370
162 Ga0068858_100010355 3300005842 Bacteria 8831
163 Ga0068858_100034454 3300005842 Bacteria 4697
164 Ga0068858_100053891 3300005842 Bacteria 3719
165 Ga0068860_100000009 3300005843 Bacteria 372089
166 Ga0068860_100000036 3300005843 Bacteria 234917
167 Ga0068860_100000148 3300005843 Bacteria 113661
168 Ga0068860_100001081 3300005843 Bacteria 30047
169 Ga0068860_100048930 3300005843 Bacteria 4029
170 Ga0068862_100000001 3300005844 Bacteria 523031
171 Ga0068862_100000002 3300005844 Bacteria 489341
172 Ga0068862_100000169 3300005844 Bacteria 72633
173 Ga0068862_100000209 3300005844 Bacteria 65440
174 Ga0068862_100006085 3300005844 Bacteria 10046
175 Ga0081455_10601736 3300005937 Bacteria 716
176 Ga0081539_10009010 3300005985 Bacteria 8478
177 Ga0075368_10163199 3300006042 Bacteria 934
178 Ga0075363_100000799 3300006048 Bacteria 10875
179 Ga0075364_10033952 3300006051 Bacteria 3288
180 Ga0075432_10006371 3300006058 Bacteria 4014
181 Ga0070712_100064336 3300006175 Bacteria 2601
182 Ga0070712_101976943 3300006175 Bacteria 511
183 Ga0075362_10000003 3300006177 Bacteria 171099
184 Ga0075366_10000006 3300006195 Bacteria 106522
185 Ga0075366_10009002 3300006195 Bacteria 5569
186 Ga0075366_10043167 3300006195 Bacteria 2671
187 Ga0075370_10000008 3300006353 Bacteria 97966
188 Ga0068871_100100936 3300006358 Bacteria 2418
189 Ga0075434_100734299 3300006871 Bacteria 1004
190 Ga0097620_100003505 3300006931 Bacteria 15985
191 Ga0097620_100023532 3300006931 Bacteria 6181
192 Ga0097620_100028372 3300006931 Bacteria 5611
193 Ga0097620_100042555 3300006931 Bacteria 4563
194 Ga0097620_100216626 3300006931 Bacteria 2002
195 Ga0105251_10001284 3300009011 Bacteria 21706
196 Ga0105251_10091930 3300009011 Bacteria 1393
197 Ga0105251_10438344 3300009011 Bacteria 604
198 Ga0105250_10040167 3300009092 Bacteria 1876
199 Ga0105250_10487276 3300009092 Bacteria 558
200 Ga0105240_10015679 3300009093 Bacteria 10290
201 Ga0105240_10025126 3300009093 Bacteria 7835
202 Ga0105247_10144469 3300009101 Bacteria 1562
203 Ga0105243_10889364 3300009148 Bacteria 885
204 Ga0105243_10942050 3300009148 Bacteria 862
205 Ga0105243_11745006 3300009148 Bacteria 652
206 Ga0105241_10387501 3300009174 Bacteria 1223
207 Ga0105241_10707420 3300009174 Bacteria 920
208 Ga0105248_10000010 3300009177 Bacteria 344314
209 Ga0105248_10001558 3300009177 Bacteria 25511
210 Ga0105248_10006373 3300009177 Bacteria 12948
211 Ga0105248_10008696 3300009177 Bacteria 11156
212 Ga0105248_10059949 3300009177 Bacteria 4274
213 Ga0105248_10103436 3300009177 Bacteria 3210
214 Ga0105248_11064157 3300009177 Bacteria 914
215 Ga0105237_10044206 3300009545 Bacteria 4485
216 Ga0105237_10048537 3300009545 Bacteria 4268
217 Ga0105238_10102613 3300009551 Bacteria 2842
218 Ga0105238_10125483 3300009551 Bacteria 2546
219 Ga0105238_10972391 3300009551 Bacteria 869
220 Ga0105249_10000006 3300009553 Bacteria 354449
221 Ga0105249_10000041 3300009553 Bacteria 195999
222 Ga0105249_10019753 3300009553 Bacteria 6016
223 Ga0105249_11819029 3300009553 Bacteria 682
224 Ga0105148_100540 3300009978 Bacteria 3258
225 Ga0105147_110624 3300009982 Bacteria 781
226 Ga0105239_10000367 3300010375 Bacteria 66191
227 Ga0105239_10326543 3300010375 Bacteria 1730
228 Ga0157373_10087299 3300013100 Bacteria 2198
229 Ga0157373_10374068 3300013100 Bacteria 1018
230 Ga0157373_10428844 3300013100 Bacteria 950
231 Ga0157371_11547738 3300013102 Bacteria 518
232 Ga0157370_10062515 3300013104 Bacteria 3530
233 Ga0157369_10138988 3300013105 Bacteria 2571
234 Ga0157369_10921210 3300013105 Bacteria 896
235 Ga0157374_11882304 3300013296 Bacteria 624
236 Ga0157378_10501215 3300013297 Bacteria 1213
237 Ga0163162_10008623 3300013306 Bacteria 9934
238 Ga0163162_10019579 3300013306 Bacteria 6643
239 Ga0157372_10452741 3300013307 Bacteria 1496
240 Ga0157372_10679552 3300013307 Bacteria 1198
241 Ga0157372_11150177 3300013307 Bacteria 897
242 Ga0163163_10030114 3300014325 Bacteria 5225
243 Ga0163163_10071955 3300014325 Bacteria 3446
244 Ga0163163_11267920 3300014325 Bacteria 799
245 Ga0157380_10000029 3300014326 Bacteria 98248
246 Ga0157380_10000182 3300014326 Bacteria 36263
247 Ga0157380_10001161 3300014326 Bacteria 17056
248 Ga0157380_10058444 3300014326 Bacteria 3074
249 Ga0157380_10340692 3300014326 Bacteria 1398
250 Ga0157380_10808594 3300014326 Bacteria 955
251 Ga0157380_13380793 3300014326 Bacteria 510
252 Ga0157379_10049804 3300014968 Bacteria 3740
253 Ga0157379_10051644 3300014968 Bacteria 3672
254 Ga0157379_10128162 3300014968 Bacteria 2283
255 Ga0157376_12284786 3300014969 Bacteria 580
256 Ga0183363_1004 3300015690 Bacteria 416766
257 Ga0163161_10000101 3300017792 Bacteria 81604
258 Ga0163161_10867138 3300017792 Bacteria 763
259 Ga0163161_10901068 3300017792 Bacteria 749
260 Ga0197907_10257285 3300020069 Bacteria 567
261 Ga0213875_10009905 3300021388 Bacteria 4804
262 Ga0207672_1000641 3300025223 Bacteria 4088
263 Ga0207425_1000041 3300025245 Bacteria 210441
264 Ga0207425_1015629 3300025245 Bacteria 1699
265 Ga0209129_1002094 3300025258 Bacteria 10228
266 Ga0209565_1000008 3300025263 Bacteria 774179
267 Ga0209565_1000134 3300025263 Bacteria 104013
268 Ga0209673_1002352 3300025273 Bacteria 13340
269 Ga0209673_1029162 3300025273 Bacteria 1761
270 Ga0209675_1009250 3300025291 Bacteria 3499
271 Ga0209676_1026408 3300025292 Bacteria 1844
272 Ga0209025_1000068 3300025294 Bacteria 294129
273 Ga0209564_1013725 3300025295 Bacteria 3416
274 Ga0209564_1015447 3300025295 Bacteria 3103
275 Ga0209758_1000004 3300025297 Bacteria 1375322
276 Ga0209758_1012697 3300025297 Bacteria 4679
277 Ga0209050_1000001 3300025298 Bacteria 3563507
278 Ga0209050_1000581 3300025298 Bacteria 59224
279 Ga0209050_1007158 3300025298 Bacteria 6354
280 Ga0209050_1014306 3300025298 Bacteria 3430
281 Ga0209256_1000009 3300025299 Bacteria 922071
282 Ga0209256_1000010 3300025299 Bacteria 912110
283 Ga0209051_1000191 3300025303 Bacteria 108763
284 Ga0209051_1102885 3300025303 Bacteria 764
285 Ga0209257_1000876 3300025304 Bacteria 42634
286 Ga0209257_1002353 3300025304 Bacteria 19010
287 Ga0209257_1002898 3300025304 Bacteria 15899
288 Ga0209257_1003401 3300025304 Bacteria 13704
289 Ga0209257_1090367 3300025304 Bacteria 766
290 Ga0207697_10006525 3300025315 Bacteria 5267
291 Ga0207697_10046997 3300025315 Bacteria 1779
292 Ga0207656_10012218 3300025321 Bacteria 3260
293 Ga0207713_1001586 3300025735 Bacteria 17804
294 Ga0207682_10004224 3300025893 Bacteria 6067
295 Ga0207710_10007240 3300025900 Bacteria 4701
296 Ga0207680_10000010 3300025903 Bacteria 414170
297 Ga0207680_10000186 3300025903 Bacteria 30147
298 Ga0207647_10000038 3300025904 Bacteria 94897
299 Ga0207647_10650728 3300025904 Bacteria 578
300 Ga0207699_10020459 3300025906 Bacteria 3548
301 Ga0207705_10016944 3300025909 Bacteria 5219
302 Ga0207705_10135124 3300025909 Bacteria 1838
303 Ga0207684_10707388 3300025910 Bacteria 856
304 Ga0207654_10000375 3300025911 Bacteria 25999
305 Ga0207695_10001183 3300025913 Bacteria 45024
306 Ga0207695_10016421 3300025913 Bacteria 8662
307 Ga0207695_10021724 3300025913 Bacteria 7315
308 Ga0207671_10001192 3300025914 Bacteria 30866
309 Ga0207671_10027639 3300025914 Bacteria 4241
310 Ga0207693_10032011 3300025915 Bacteria 4154
311 Ga0207657_10387615 3300025919 Bacteria 1100
312 Ga0207649_10150506 3300025920 Bacteria 1602
313 Ga0207649_10848417 3300025920 Bacteria 715
314 Ga0207649_10899162 3300025920 Bacteria 694
315 Ga0207681_10000002 3300025923 Bacteria 985597
316 Ga0207681_10000005 3300025923 Bacteria 555724
317 Ga0207681_10000183 3300025923 Bacteria 51105
318 Ga0207681_10716631 3300025923 Bacteria 832
319 Ga0207694_10002087 3300025924 Bacteria 16502
320 Ga0207650_10000004 3300025925 Bacteria 743372
321 Ga0207650_10000083 3300025925 Bacteria 127270
322 Ga0207650_10002904 3300025925 Bacteria 11832
323 Ga0207650_10006404 3300025925 Bacteria 8018
324 Ga0207700_10133944 3300025928 Bacteria 2027
325 Ga0207700_10911749 3300025928 Bacteria 786
326 Ga0207644_10000002 3300025931 Bacteria 942221
327 Ga0207644_10000067 3300025931 Bacteria 76116
328 Ga0207644_10001857 3300025931 Bacteria 13746
329 Ga0207644_10112905 3300025931 Bacteria 2057
330 Ga0207706_10015340 3300025933 Bacteria 6923
331 Ga0207706_10138164 3300025933 Bacteria 2144
332 Ga0207709_11112615 3300025935 Bacteria 649
333 Ga0207670_10083992 3300025936 Bacteria 2235
334 Ga0207665_10021665 3300025939 Bacteria 4227
335 Ga0207691_10044352 3300025940 Bacteria 4094
336 Ga0207691_10788796 3300025940 Bacteria 799
337 Ga0207691_11030603 3300025940 Bacteria 686
338 Ga0207691_11267125 3300025940 Bacteria 610
339 Ga0207711_10000035 3300025941 Bacteria 177223
340 Ga0207711_10000075 3300025941 Bacteria 106870
341 Ga0207711_10006118 3300025941 Bacteria 10166
342 Ga0207711_10024088 3300025941 Bacteria 5096
343 Ga0207711_10153268 3300025941 Bacteria 2081
344 Ga0207711_10663848 3300025941 Bacteria 973
345 Ga0207711_11345137 3300025941 Bacteria 657
346 Ga0207661_10482382 3300025944 Bacteria 1132
347 Ga0207679_10123611 3300025945 Bacteria 2064
348 Ga0207679_10597498 3300025945 Bacteria 994
349 Ga0207679_11325829 3300025945 Bacteria 660
350 Ga0207667_10011748 3300025949 Bacteria 10154
351 Ga0207667_10498960 3300025949 Bacteria 1235
352 Ga0207712_10000014 3300025961 Bacteria 375393
353 Ga0207712_10000620 3300025961 Bacteria 28034
354 Ga0207712_10018137 3300025961 Bacteria 4580
355 Ga0207668_10000081 3300025972 Bacteria 72145
356 Ga0207668_10005340 3300025972 Bacteria 7558
357 Ga0207668_10085277 3300025972 Bacteria 2304
358 Ga0207640_10031448 3300025981 Bacteria 3280
359 Ga0207640_10062003 3300025981 Bacteria 2479
360 Ga0207640_11683279 3300025981 Bacteria 572
361 Ga0207658_10000002 3300025986 Bacteria 1364188
362 Ga0207658_10000069 3300025986 Bacteria 113687
363 Ga0207658_10000388 3300025986 Bacteria 42759
364 Ga0207658_10004095 3300025986 Bacteria 10169
365 Ga0207658_10008782 3300025986 Bacteria 6860
366 Ga0207658_10018656 3300025986 Bacteria 4795
367 Ga0207703_10005351 3300026035 Bacteria 10337
368 Ga0207703_10008030 3300026035 Bacteria 8339
369 Ga0207703_10009134 3300026035 Bacteria 7806
370 Ga0207703_12031310 3300026035 Bacteria 551
371 Ga0207639_10187001 3300026041 Bacteria 1766
372 Ga0207639_10312608 3300026041 Bacteria 1392
373 Ga0207639_10602963 3300026041 Bacteria 1013
374 Ga0207639_11412677 3300026041 Bacteria 653
375 Ga0207678_10034203 3300026067 Bacteria 4426
376 Ga0207678_10088208 3300026067 Bacteria 2651
377 Ga0207678_10889898 3300026067 Bacteria 787
378 Ga0207678_11627230 3300026067 Bacteria 568
379 Ga0207708_10468159 3300026075 Bacteria 1052
380 Ga0207702_10000887 3300026078 Bacteria 31141
381 Ga0207702_11265379 3300026078 Bacteria 732
382 Ga0207641_10000002 3300026088 Bacteria 981004
383 Ga0207641_10000099 3300026088 Bacteria 122892
384 Ga0207641_10003319 3300026088 Bacteria 14317
385 Ga0207641_10004490 3300026088 Bacteria 12070
386 Ga0207641_10004505 3300026088 Bacteria 12048
387 Ga0207641_10013693 3300026088 Bacteria 6656
388 Ga0207641_10014410 3300026088 Bacteria 6478
389 Ga0207676_10000005 3300026095 Bacteria 698744
390 Ga0207676_10000006 3300026095 Bacteria 681936
391 Ga0207676_10000770 3300026095 Bacteria 25065
392 Ga0207676_10022559 3300026095 Bacteria 4630
393 Ga0207676_10041840 3300026095 Bacteria 3520
394 Ga0207676_11532792 3300026095 Bacteria 664
395 Ga0207674_10016903 3300026116 Bacteria 7971
396 Ga0207674_10131652 3300026116 Bacteria 2464
397 Ga0207674_10202281 3300026116 Bacteria 1935
398 Ga0207674_12258894 3300026116 Bacteria 506
399 Ga0207675_100000358 3300026118 Bacteria 43765
400 Ga0207675_100001138 3300026118 Bacteria 26336
401 Ga0207675_100001918 3300026118 Bacteria 20742
402 Ga0207675_100230090 3300026118 Bacteria 1788
403 Ga0207683_11981229 3300026121 Bacteria 531
404 Ga0207698_10084139 3300026142 Bacteria 2578
405 Ga0207698_10130218 3300026142 Bacteria 2148
406 Ga0207698_10353465 3300026142 Bacteria 1389
407 Ga0209813_10029105 3300027866 Bacteria 1615
408 Ga0209974_10023499 3300027876 Bacteria 2040
409 Ga0209974_10465763 3300027876 Bacteria 503
410 Ga0207428_10045887 3300027907 Bacteria 3516
411 Ga0268266_10000009 3300028379 Bacteria 1097737
412 Ga0268266_10000181 3300028379 Bacteria 112266
413 Ga0268266_10211526 3300028379 Bacteria 1779
414 Ga0268266_10315170 3300028379 Bacteria 1462
415 Ga0268266_10850351 3300028379 Bacteria 882
416 Ga0268266_11019591 3300028379 Bacteria 801
417 Ga0268266_11068863 3300028379 Bacteria 781
418 Ga0268266_11514040 3300028379 Bacteria 646
419 Ga0268265_10000001 3300028380 Bacteria 1230727
420 Ga0268265_10000003 3300028380 Bacteria 949201
421 Ga0268265_10000047 3300028380 Bacteria 179354
422 Ga0268265_10000285 3300028380 Bacteria 57084
423 Ga0268265_10004726 3300028380 Bacteria 9397
424 Ga0268264_10000001 3300028381 Bacteria 1221000
425 Ga0268264_10000010 3300028381 Bacteria 596543
426 Ga0268264_10000023 3300028381 Bacteria 471408
427 Ga0268264_10000217 3300028381 Bacteria 113674
428 Ga0268264_10030665 3300028381 Bacteria 4408
429 Ga0307517_10024293 3300028786 Bacteria 7480
430 Ga0316177_1082224 3300030731 Bacteria 1786
431 Ga0314311_1203820 3300030733 Bacteria 1025
432 Ga0307513_10522361 3300031456 Bacteria 902
433 Ga0307408_100388134 3300031548 Bacteria 1195
434 Ga0307408_100471441 3300031548 Bacteria 1093
435 Ga0307408_100545382 3300031548 Bacteria 1022
436 Ga0307408_101212836 3300031548 Bacteria 704
437 Ga0307405_10165710 3300031731 Bacteria 1570
438 Ga0307405_10408947 3300031731 Bacteria 1064
439 Ga0307405_10442013 3300031731 Bacteria 1029
440 Ga0307405_10530365 3300031731 Bacteria 949
441 Ga0307405_11134964 3300031731 Bacteria 673
442 Ga0307405_11173503 3300031731 Bacteria 663
443 Ga0307405_11796864 3300031731 Bacteria 545
444 Ga0307405_11848273 3300031731 Bacteria 538
445 Ga0307413_10121532 3300031824 Bacteria 1770
446 Ga0307413_10229023 3300031824 Bacteria 1363
447 Ga0307413_10236039 3300031824 Bacteria 1346
448 Ga0307413_11727913 3300031824 Bacteria 558
449 Ga0307413_11858545 3300031824 Bacteria 540
450 Ga0307410_10192558 3300031852 Bacteria 1551
451 Ga0307410_10584196 3300031852 Bacteria 930
452 Ga0307406_10069949 3300031901 Bacteria 2296
453 Ga0307406_10071868 3300031901 Bacteria 2269
454 Ga0307406_10114532 3300031901 Bacteria 1862
455 Ga0307406_10132306 3300031901 Bacteria 1753
456 Ga0307406_10683111 3300031901 Bacteria 855
457 Ga0307406_11068797 3300031901 Bacteria 695
458 Ga0307407_10069618 3300031903 Bacteria 2089
459 Ga0307407_10202036 3300031903 Bacteria 1332
460 Ga0307407_11185019 3300031903 Bacteria 596
461 Ga0307412_10075035 3300031911 Bacteria 2318
462 Ga0307412_10257505 3300031911 Bacteria 1358
463 Ga0307412_10337741 3300031911 Bacteria 1204
464 Ga0307412_11563801 3300031911 Bacteria 601
465 Ga0307409_100074131 3300031995 Bacteria 2718
466 Ga0307409_100549682 3300031995 Bacteria 1133
467 Ga0307409_101773022 3300031995 Bacteria 646
468 Ga0307409_102542064 3300031995 Bacteria 541
469 Ga0307416_100152722 3300032002 Bacteria 2120
470 Ga0307416_100206250 3300032002 Bacteria 1870
471 Ga0307416_100476826 3300032002 Bacteria 1307
472 Ga0307416_101096960 3300032002 Bacteria 900
473 Ga0307416_101827298 3300032002 Bacteria 711
474 Ga0307414_10085486 3300032004 Bacteria 2324
475 Ga0307414_10139371 3300032004 Bacteria 1896
476 Ga0307414_10154867 3300032004 Bacteria 1812
477 Ga0307414_10392121 3300032004 Bacteria 1203
478 Ga0307414_10450820 3300032004 Bacteria 1128
479 Ga0307411_10122243 3300032005 Bacteria 1886
480 Ga0307411_10589128 3300032005 Bacteria 954
481 Ga0307411_10830711 3300032005 Bacteria 816
482 Ga0307411_11176066 3300032005 Bacteria 694
483 Ga0307411_11715192 3300032005 Bacteria 582
484 Ga0307411_12013200 3300032005 Bacteria 539
485 Ga0307415_100134218 3300032126 Bacteria 1879
486 Ga0307415_100438347 3300032126 Bacteria 1126
487 Ga0307415_100496024 3300032126 Bacteria 1066
488 Ga0307415_101294198 3300032126 Bacteria 690
489 Ga0307415_101420031 3300032126 Bacteria 661
490 Ga0307415_101828714 3300032126 Bacteria 588
491 Ga0373959_0167015 3300034820 Bacteria 565
492 Ga0373938_0176853 3300034957 Bacteria 581
493 Ga0373932_0031572 3300035112 Bacteria 1477
494 Ga0373935_0012992 3300035692 Bacteria 5019
495 Ga0373937_0267550 3300036401 Bacteria 1613
496 Ga0395899_0021279 3300037312 Bacteria 4920
497 Ga0395899_0077621 3300037312 Bacteria 2422
498 Ga0395900_0028261 3300037418 Bacteria 5745
499 Ga0395900_0063619 3300037418 Bacteria 3792
500 Ga0395898_0038273 3300037466 Bacteria 4755
501 Ga0395898_0121043 3300037466 Bacteria 2507
502 Ga0395898_1714884 3300037466 Bacteria 551
503 Ga0395905_0008374 3300037471 Bacteria 10198
504 Ga0395905_0013966 3300037471 Bacteria 7681
505 Ga0395905_1534650 3300037471 Bacteria 571
506 Ga0436364_0741438 3300037853 Bacteria 779
507 Ga0436364_0878110 3300037853 Bacteria 2836
508 Ga0395901_0014058 3300038443 Bacteria 8148
509 Ga0395901_0014440 3300038443 Bacteria 8037
510 Ga0436365_0600332 3300039437 Bacteria 1176
511 Ga0436365_0922307 3300039437 Bacteria 725
512 Ga0436363_0674844 3300039450 Bacteria 1010
513 Ga0436363_1090589 3300039450 Bacteria 1112
514 Ga0439436_0045695 3300041404 Bacteria 1245
515 Ga0439439_0001779 3300041406 Bacteria 4402
516 Ga0439439_0134264 3300041406 Bacteria 696
517 Ga0439461_0000498 3300041410 Bacteria 5666
518 Ga0439461_0080904 3300041410 Bacteria 766
519 Ga0439465_0004274 3300041413 Bacteria 4644
520 Ga0451793_1471615 3300041452 Bacteria 821
521 Ga0451807_1087972 3300041486 Bacteria 668
522 Ga0439431_0000140 3300041997 Bacteria 13006
523 Ga0439431_0010888 3300041997 Bacteria 2071
524 Ga0439437_027949 3300042000 Bacteria 701
525 Ga0439442_013335 3300042002 Bacteria 1685
526 Ga0439445_0033115 3300042004 Bacteria 1349
527 Ga0439445_0142362 3300042004 Bacteria 695
528 Ga0439432_000640 3300042006 Bacteria 13098
529 Ga0439452_018803 3300042010 Bacteria 1835
530 Ga0439462_0002776 3300042015 Bacteria 4116
531 Ga0439463_166786 3300042016 Bacteria 571
532 Ga0439434_0006562 3300042435 Bacteria 3398
533 Ga0466969_0268548 3300044656 Bacteria 773
534 Ga0466972_0046260 3300044658 Bacteria 2107
535 Ga0466965_0017759 3300044683 Bacteria 3403
536 Ga0466966_0052557 3300044684 Bacteria 2587
537 Ga0466966_0167157 3300044684 Bacteria 1337
538 Ga0466961_0029638 3300044693 Bacteria 3516
539 Ga0466963_0499988 3300044694 Bacteria 858
540 Ga0466964_0002736 3300044706 Bacteria 6330
541 Ga0466971_0012785 3300044719 Bacteria 3680
542 Ga0466968_0002823 3300044735 Bacteria 6421
543 Ga0466968_0038917 3300044735 Bacteria 1999
544 Ga0466970_0069617 3300044765 Bacteria 1891
545 Ga0466970_0632016 3300044765 Bacteria 622
546 Ga0466957_0066943 3300044842 Bacteria 2215
547 Ga0466959_0145104 3300045049 Bacteria 1675
548 Ga0466959_0181311 3300045049 Bacteria 1472
549 Ga0466959_0349939 3300045049 Bacteria 1007
550 Ga0466958_0007699 3300045836 Bacteria 5940
551 Ga0466958_0025958 3300045836 Bacteria 3458
552 Ga0466958_0383841 3300045836 Bacteria 906
553 Ga0466967_0089604 3300045976 Bacteria 2793
554 Ga0466967_2588529 3300045976 Bacteria 502
555 Ga0495596_0388920 3300046500 Bacteria 543
556 Ga0495616_0001456 3300046513 Bacteria 16481
557 Ga0495632_0253925 3300046519 Bacteria 788
558 Ga0495632_0317276 3300046519 Bacteria 689
559 Ga0495643_0460184 3300046522 Bacteria 552
560 Ga0495648_0042423 3300046524 Bacteria 2862
561 Ga0495663_0044618 3300046525 Bacteria 1357
562 Ga0495642_0032976 3300046528 Bacteria 2081
563 Ga0495654_0001073 3300046530 Bacteria 19918
564 Ga0495654_0020158 3300046530 Bacteria 3478
565 Ga0495654_0116202 3300046530 Bacteria 1215
566 Ga0495597_0031259 3300046542 Bacteria 2424
567 Ga0495668_0002221 3300046616 Bacteria 16492
568 Ga0495668_0011998 3300046616 Bacteria 5159
569 Ga0495625_0598070 3300046660 Bacteria 662
570 Ga0495589_0067756 3300046794 Bacteria 1747
571 Ga0495686_0001246 3300047472 Bacteria 29040
572 Ga0496100_0027383 3300048903 Bacteria 3505
573 Ga0496100_0652598 3300048903 Bacteria 819
574 Ga0496101_0016587 3300048904 Bacteria 4980
575 Ga0496101_0346342 3300048904 Bacteria 1167
576 Ga0496102_0000069 3300048905 Bacteria 156067
577 Ga0496102_0172254 3300048905 Bacteria 2037
578 Ga0496102_0681373 3300048905 Bacteria 951
579 Ga0496103_0000173 3300048906 Bacteria 67412
580 Ga0496103_0030066 3300048906 Bacteria 3304
581 Ga0496103_0033025 3300048906 Bacteria 3160
582 Ga0496103_0224202 3300048906 Bacteria 1209
583 Ga0496103_0233437 3300048906 Bacteria 1183
584 Ga0496104_0059792 3300048907 Bacteria 3608
585 Ga0496105_1191995 3300048908 Bacteria 561
586 Ga0496106_0042063 3300048909 Bacteria 3426
587 Ga0496106_0076352 3300048909 Bacteria 2568
588 Ga0496107_0044142 3300048910 Bacteria 3204
589 Ga0496107_0173558 3300048910 Bacteria 1600
590 Ga0496107_0252341 3300048910 Bacteria 1312
591 Ga0496107_1217068 3300048910 Bacteria 541
592 Ga0496113_0519615 3300048916 Bacteria 956
593 Ga0496114_0059906 3300048917 Bacteria 3181
594 Ga0496115_0001129 3300048918 Bacteria 19266
595 Ga0496115_0074035 3300048918 Bacteria 2765
596 Ga0496116_0000566 3300048919 Bacteria 49509
597 Ga0496116_0032138 3300048919 Bacteria 3745
598 Ga0496117_0000485 3300048920 Bacteria 65840
599 Ga0496117_0018342 3300048920 Bacteria 5800
600 Ga0496117_0089533 3300048920 Bacteria 1987
601 Ga0496117_0231937 3300048920 Bacteria 1019
602 Ga0496117_0251385 3300048920 Bacteria 964
603 Ga0496118_0000190 3300048921 Bacteria 108017
604 Ga0496118_0000463 3300048921 Bacteria 67382
605 Ga0496118_0015970 3300048921 Bacteria 6916
606 Ga0496118_0079363 3300048921 Bacteria 2316
607 Ga0496118_0139050 3300048921 Bacteria 1544
608 Ga0496119_0038129 3300048922 Bacteria 3111
609 Ga0496119_0072971 3300048922 Bacteria 2003
610 Ga0496120_0110614 3300048923 Bacteria 1436
611 Ga0496120_0178484 3300048923 Bacteria 1045
612 Ga0496121_0010499 3300048924 Bacteria 10435
613 Ga0496121_0016723 3300048924 Bacteria 7548
614 Ga0496121_0058069 3300048924 Bacteria 3202
615 Ga0496121_0295366 3300048924 Bacteria 1102
616 Ga0496124_0000546 3300048927 Bacteria 63624
617 Ga0496124_0081473 3300048927 Bacteria 2660
618 Ga0496125_0286884 3300048928 Bacteria 1016
619 Ga0496126_0016996 3300048929 Bacteria 7259
620 Ga0496126_0150910 3300048929 Bacteria 1992
621 Ga0501306_009105 3300049127 Bacteria 1225
622 Ga0501305_021695 3300049161 Bacteria 951
623 Ga0501307_005380 3300049162 Bacteria 1348
624 Ga0501290_000237 3300049513 Bacteria 9135
625 Ga0501292_000042 3300049515 Bacteria 29474
626 Ga0501293_008149 3300049516 Bacteria 877
627 Ga0501293_018406 3300049516 Bacteria 666
628 Ga0501294_000032 3300049517 Bacteria 13769
629 Ga0501297_009582 3300049520 Bacteria 1085
630 Ga0501298_063023 3300049521 Bacteria 789
631 Ga0501300_000392 3300049523 Bacteria 6689
632 Ga0501311_027272 3300049527 Bacteria 810
633 Ga0501312_025302 3300049528 Bacteria 904
634 Ga0501313_020213 3300049529 Bacteria 819
635 Ga0501315_000962 3300049531 Bacteria 2273
636 Ga0501315_046231 3300049531 Bacteria 672
637 Ga0501317_002915 3300049533 Bacteria 1662
638 Ga0501320_006506 3300049536 Bacteria 1097
639 Ga0501335_013930 3300049551 Bacteria 808
640 Ga0501335_029598 3300049551 Bacteria 615
641 Ga0501032_0113352 3300049569 Bacteria 1793
642 Ga0501039_1595636 3300049575 Bacteria 501
643 Ga0501042_0260954 3300049578 Bacteria 1251
644 Ga0501043_0049166 3300049579 Bacteria 3315
645 Ga0501043_0113159 3300049579 Bacteria 2131
646 Ga0501046_0030454 3300049580 Bacteria 4380
647 Ga0501047_0000731 3300049581 Bacteria 34159
648 Ga0501047_0450251 3300049581 Bacteria 1117
649 Ga0501047_0885518 3300049581 Bacteria 706
650 Ga0501201_046218 3300049651 Bacteria 534
651 Ga0501202_063125 3300049652 Bacteria 841
652 Ga0501206_008325 3300049653 Bacteria 1369
653 Ga0501207_021740 3300049654 Bacteria 1032
654 Ga0501222_001746 3300049662 Bacteria 3014
655 Ga0501223_004016 3300049663 Bacteria 3169
656 Ga0501223_039106 3300049663 Bacteria 921
657 Ga0501224_000754 3300049664 Bacteria 4084
658 Ga0501224_044230 3300049664 Bacteria 676
659 Ga0501227_028030 3300049665 Bacteria 1336
660 Ga0501233_012436 3300049668 Bacteria 1708
661 Ga0501235_001097 3300049669 Bacteria 5663
662 Ga0501236_053975 3300049670 Bacteria 697
663 Ga0501249_000213 3300049679 Bacteria 17777
664 Ga0501249_102848 3300049679 Bacteria 685
665 Ga0501257_000049 3300049686 Bacteria 33138
666 Ga0501257_013441 3300049686 Bacteria 1877
667 Ga0501259_001391 3300049688 Bacteria 4043
668 Ga0501261_000021 3300049690 Bacteria 37511
669 Ga0501221_003846 3300049704 Bacteria 2478
670 Ga0501221_259218 3300049704 Bacteria 502
671 Ga0501225_0006973 3300049705 Bacteria 3291
672 Ga0501225_0041953 3300049705 Bacteria 1263
673 Ga0501225_0043405 3300049705 Bacteria 1242
674 Ga0501225_0071549 3300049705 Bacteria 986
675 Ga0501234_045246 3300049707 Bacteria 726
676 Ga0501234_068536 3300049707 Bacteria 610
677 Ga0501245_001378 3300049708 Bacteria 3134
678 Ga0501241_024823 3300049758 Bacteria 1114
679 Ga0501263_029453 3300049760 Bacteria 770
680 Ga0501264_008163 3300049761 Bacteria 985
681 Ga0501268_063199 3300049765 Bacteria 737
682 Ga0501276_013553 3300049773 Bacteria 716
683 Ga0501279_000010 3300049775 Bacteria 103375
684 Ga0501280_000064 3300049776 Bacteria 31054
685 Ga0501280_001057 3300049776 Bacteria 5596
686 Ga0501281_00086 3300049777 Bacteria 10989
687 Ga0501282_000404 3300049778 Bacteria 5157
688 Ga0501283_001453 3300049779 Bacteria 3071
689 Ga0501035_0244287 3300049822 Bacteria 1526
690 Ga0501044_0001187 3300049823 Bacteria 30876
691 Ga0501044_0074300 3300049823 Bacteria 3454
692 Ga0501204_000430 3300049850 Bacteria 3639
693 Ga0501284_02268 3300050005 Bacteria 1056
694 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
695 nmdc:mga03n38_8067_c1 3300050490 Bacteria 3758
696 nmdc:mga00v17_133305_c1 3300050491 Bacteria 1589
697 nmdc:mga0k408_423833_c1 3300050493 Bacteria 791
698 nmdc:mga0k408_7432_c1 3300050493 Bacteria 5849
699 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
700 nmdc:mga04h51_34676_c1 3300050495 Bacteria 1613
701 nmdc:mga07m45_20_c1 3300050496 Bacteria 126269
702 nmdc:mga0n895_267626_c1 3300050512 Bacteria 1734
703 nmdc:mga0sz30_647_c1 3300050516 Bacteria 12891
704 Ga0500643_000135 3300053087 Bacteria 74911
705 Ga0500643_000195 3300053087 Bacteria 57960
706 Ga0500647_0137576 3300053091 Bacteria 1148
707 Ga0500651_0086862 3300053093 Bacteria 1931
708 Ga0500566_0004538 3300053094 Bacteria 8291
709 Ga0500641_0011475 3300053096 Bacteria 3217
710 Ga0500562_040866 3300053108 Bacteria 1233
711 Ga0500592_000031 3300053116 Bacteria 47686
712 Ga0500592_001156 3300053116 Bacteria 4293
713 Ga0500592_008468 3300053116 Bacteria 1631
714 Ga0500618_014810 3300053125 Bacteria 1983
715 Ga0500626_092170 3300053128 Bacteria 1329
716 Ga0500642_0014296 3300053130 Bacteria 2948
717 Ga0500652_278543 3300053131 Bacteria 654
718 Ga0500652_371382 3300053131 Bacteria 536
719 Ga0500655_000251 3300053133 Bacteria 12576
720 Ga0500590_000131 3300053148 Bacteria 20923
721 Ga0500604_0036484 3300053151 Bacteria 1466
722 Ga0500604_0039631 3300053151 Bacteria 1417
723 Ga0500604_0060477 3300053151 Bacteria 1189
724 Ga0500604_0071415 3300053151 Bacteria 1107
725 Ga0500604_0194406 3300053151 Bacteria 697
726 Ga0500616_0008241 3300053153 Bacteria 6496
727 Ga0500622_0025695 3300053156 Bacteria 3111
728 Ga0500622_0091256 3300053156 Bacteria 1511
729 Ga0500624_000062 3300053157 Bacteria 66317
730 Ga0500627_0000003 3300053158 Bacteria 178186
731 Ga0500627_0000570 3300053158 Bacteria 9930
732 Ga0500627_0001223 3300053158 Bacteria 7068
733 Ga0500627_0027041 3300053158 Bacteria 2372
734 Ga0500639_139272 3300053163 Bacteria 1137
735 Ga0500636_0058873 3300053177 Bacteria 2245
736 Ga0500636_0230432 3300053177 Bacteria 959
737 Ga0500637_0000112 3300053178 Bacteria 29320
738 Ga0500570_004079 3300053724 Bacteria 7637
739 Ga0587094_030537 3300059513 Bacteria 833
740 Ga0587098_059728 3300059604 Bacteria 596
741 Ga0466962_0016437 3300061719 Bacteria 3569

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100471441 Ga0307408_1004714412 102
2 3300031731 Ga0307405_10408947 Ga0307405_104089471 102
3 3300031824 Ga0307413_10236039 Ga0307413_102360392 102
4 3300031824 Ga0307413_11858545 Ga0307413_118585451 102
5 3300031852 Ga0307410_10192558 Ga0307410_101925584 102
6 3300031852 Ga0307410_10584196 Ga0307410_105841961 102
7 3300031901 Ga0307406_10069949 Ga0307406_100699491 102
8 3300031903 Ga0307407_10202036 Ga0307407_102020362 102
9 3300031903 Ga0307407_11185019 Ga0307407_111850191 102
10 3300031995 Ga0307409_100074131 Ga0307409_1000741311 102
11 3300032002 Ga0307416_100206250 Ga0307416_1002062502 102
12 3300032004 Ga0307414_10139371 Ga0307414_101393712 102
13 3300032004 Ga0307414_10154867 Ga0307414_101548672 102
14 3300032126 Ga0307415_100134218 Ga0307415_1001342182 102
15 3300005353 Ga0070669_100123994 Ga0070669_1001239941 103
16 3300005335 Ga0070666_11126734 Ga0070666_111267342 104
17 3300005347 Ga0070668_100518306 Ga0070668_1005183063 104
18 3300005355 Ga0070671_100035948 Ga0070671_1000359483 104
19 3300005434 Ga0070709_10012137 Ga0070709_100121374 104
20 3300005435 Ga0070714_100061476 Ga0070714_1000614763 104
21 3300005436 Ga0070713_100002710 Ga0070713_1000027106 104
22 3300005436 Ga0070713_100065476 Ga0070713_1000654764 104
23 3300005456 Ga0070678_102081094 Ga0070678_1020810941 104
24 3300006175 Ga0070712_100064336 Ga0070712_1000643362 104
25 3300006175 Ga0070712_101976943 Ga0070712_1019769432 104
26 3300006358 Ga0068871_100100936 Ga0068871_1001009364 104
27 3300009177 Ga0105248_10006373 Ga0105248_1000637310 104
28 3300025906 Ga0207699_10020459 Ga0207699_100204592 104
29 3300025915 Ga0207693_10032011 Ga0207693_100320113 104
30 3300025928 Ga0207700_10133944 Ga0207700_101339441 104
31 3300025928 Ga0207700_10911749 Ga0207700_109117491 104
32 3300025931 Ga0207644_10112905 Ga0207644_101129054 104
33 3300025939 Ga0207665_10021665 Ga0207665_100216654 104
34 3300025940 Ga0207691_10044352 Ga0207691_100443524 104
35 3300025941 Ga0207711_10153268 Ga0207711_101532683 104
36 3300026035 Ga0207703_12031310 Ga0207703_120313102 104
37 3300026078 Ga0207702_11265379 Ga0207702_112653792 104
38 3300026095 Ga0207676_11532792 Ga0207676_115327921 104
39 3300031824 Ga0307413_10229023 Ga0307413_102290231 104
40 3300031911 Ga0307412_10257505 Ga0307412_102575051 104
41 3300031995 Ga0307409_100549682 Ga0307409_1005496824 104
42 3300032002 Ga0307416_100476826 Ga0307416_1004768262 104
43 3300034820 Ga0373959_0167015 Ga0373959_0167015_89_403 104
44 3300035692 Ga0373935_0012992 Ga0373935_0012992_2496_2822 104
45 3300037312 Ga0395899_0077621 Ga0395899_0077621_2024_2338 104
46 3300037418 Ga0395900_0028261 Ga0395900_0028261_4125_4439 104
47 3300037466 Ga0395898_0038273 Ga0395898_0038273_2763_3077 104
48 3300037471 Ga0395905_0008374 Ga0395905_0008374_4098_4412 104
49 3300038443 Ga0395901_0014440 Ga0395901_0014440_2712_3026 104
50 3300044656 Ga0466969_0268548 Ga0466969_0268548_16_330 104
51 3300044658 Ga0466972_0046260 Ga0466972_0046260_452_766 104
52 3300044683 Ga0466965_0017759 Ga0466965_0017759_2197_2511 104
53 3300044684 Ga0466966_0052557 Ga0466966_0052557_1439_1753 104
54 3300044684 Ga0466966_0167157 Ga0466966_0167157_21_335 104
55 3300044693 Ga0466961_0029638 Ga0466961_0029638_1443_1757 104
56 3300044694 Ga0466963_0499988 Ga0466963_0499988_377_691 104
57 3300044706 Ga0466964_0002736 Ga0466964_0002736_1685_1999 104
58 3300044719 Ga0466971_0012785 Ga0466971_0012785_2703_3017 104
59 3300044735 Ga0466968_0002823 Ga0466968_0002823_5537_5851 104
60 3300044765 Ga0466970_0069617 Ga0466970_0069617_798_1112 104
61 3300044842 Ga0466957_0066943 Ga0466957_0066943_982_1296 104
62 3300045049 Ga0466959_0145104 Ga0466959_0145104_1183_1497 104
63 3300045049 Ga0466959_0181311 Ga0466959_0181311_1020_1334 104
64 3300045049 Ga0466959_0349939 Ga0466959_0349939_570_884 104
65 3300045836 Ga0466958_0007699 Ga0466958_0007699_4778_5092 104
66 3300045836 Ga0466958_0025958 Ga0466958_0025958_952_1266 104
67 3300045836 Ga0466958_0383841 Ga0466958_0383841_565_879 104
68 3300045976 Ga0466967_0089604 Ga0466967_0089604_2221_2535 104
69 3300048903 Ga0496100_0027383 Ga0496100_0027383_1776_2090 104
70 3300048904 Ga0496101_0016587 Ga0496101_0016587_1754_2068 104
71 3300048909 Ga0496106_0042063 Ga0496106_0042063_1487_1801 104
72 3300048910 Ga0496107_0044142 Ga0496107_0044142_1788_2102 104
73 3300048917 Ga0496114_0059906 Ga0496114_0059906_530_844 104
74 3300048918 Ga0496115_0074035 Ga0496115_0074035_34_348 104
75 3300049651 Ga0501201_046218 Ga0501201_046218_57_383 104
76 3300049663 Ga0501223_039106 Ga0501223_039106_132_458 104
77 3300049664 Ga0501224_044230 Ga0501224_044230_116_442 104
78 3300049679 Ga0501249_102848 Ga0501249_102848_301_627 104
79 3300049705 Ga0501225_0041953 Ga0501225_0041953_747_1073 104
80 3300049707 Ga0501234_045246 Ga0501234_045246_80_406 104
81 3300049765 Ga0501268_063199 Ga0501268_063199_193_519 104
82 3300061719 Ga0466962_0016437 Ga0466962_0016437_1531_1845 104
83 3300005293 Ga0065715_10344649 Ga0065715_103446493 105
84 3300005327 Ga0070658_10603273 Ga0070658_106032731 105
85 3300005339 Ga0070660_101735441 Ga0070660_1017354411 105
86 3300005345 Ga0070692_10001265 Ga0070692_100012657 105
87 3300005345 Ga0070692_10002712 Ga0070692_100027123 105
88 3300005455 Ga0070663_100075753 Ga0070663_1000757533 105
89 3300005530 Ga0070679_100082753 Ga0070679_1000827532 105
90 3300005535 Ga0070684_100168126 Ga0070684_1001681264 105
91 3300005563 Ga0068855_100135463 Ga0068855_1001354633 105
92 3300009551 Ga0105238_10972391 Ga0105238_109723912 105
93 3300013100 Ga0157373_10374068 Ga0157373_103740683 105
94 3300013307 Ga0157372_10679552 Ga0157372_106795523 105
95 3300025904 Ga0207647_10650728 Ga0207647_106507282 105
96 3300025909 Ga0207705_10016944 Ga0207705_100169445 105
97 3300026067 Ga0207678_10034203 Ga0207678_100342033 105
98 3300027876 Ga0209974_10023499 Ga0209974_100234994 105
99 3300027876 Ga0209974_10465763 Ga0209974_104657632 105
100 3300030731 Ga0316177_1082224 Ga0316177_10822244 105
101 3300031901 Ga0307406_11068797 Ga0307406_110687971 105
102 3300031903 Ga0307407_10069618 Ga0307407_100696182 105
103 3300031911 Ga0307412_10337741 Ga0307412_103377413 105
104 3300032002 Ga0307416_100152722 Ga0307416_1001527222 105
105 3300032004 Ga0307414_10392121 Ga0307414_103921214 105
106 3300032005 Ga0307411_11176066 Ga0307411_111760662 105
107 3300037312 Ga0395899_0021279 Ga0395899_0021279_1980_2297 105
108 3300037418 Ga0395900_0063619 Ga0395900_0063619_1900_2217 105
109 3300037466 Ga0395898_0121043 Ga0395898_0121043_1416_1733 105
110 3300037466 Ga0395898_1714884 Ga0395898_1714884_208_525 105
111 3300037471 Ga0395905_0013966 Ga0395905_0013966_6541_6858 105
112 3300037471 Ga0395905_1534650 Ga0395905_1534650_53_370 105
113 3300038443 Ga0395901_0014058 Ga0395901_0014058_6256_6573 105
114 3300042000 Ga0439437_027949 Ga0439437_027949_331_654 105
115 3300042016 Ga0439463_166786 Ga0439463_166786_209_532 105
116 3300059513 Ga0587094_030537 Ga0587094_030537_433_750 105
117 iso_pu_bacteria 2582581305 2585262259 105
118 iso_pu_bacteria 2643221541 2643731599 105
119 iso_pu_bacteria 2643221606 2644042073 105
120 iso_pu_bacteria 2643221622 2644126039 105
121 iso_pu_bacteria 2643221671 2644394284 105
122 3300037853 Ga0436364_0878110 Ga0436364_0878110_177_500 106
123 3300002774 JGI25150J39212_1002047 JGI25150J39212_10020475 107
124 3300003215 JGI25153J46596_10000395 JGI25153J46596_1000039515 107
125 3300003781 Ga0055536_1012135 Ga0055536_10121355 107
126 3300003791 Ga0055530_10007314 Ga0055530_100073141 107
127 3300003792 Ga0055540_1002064 Ga0055540_10020647 107
128 3300005262 Ga0065165_1062777 Ga0065165_10627773 107
129 3300005327 Ga0070658_10707327 Ga0070658_107073272 107
130 3300005548 Ga0070665_100736340 Ga0070665_1007363403 107
131 3300005616 Ga0068852_100244943 Ga0068852_1002449431 107
132 3300005840 Ga0068870_10954518 Ga0068870_109545182 107
133 3300006058 Ga0075432_10006371 Ga0075432_100063713 107
134 3300009177 Ga0105248_10103436 Ga0105248_101034361 107
135 3300013102 Ga0157371_11547738 Ga0157371_115477381 107
136 3300025245 Ga0207425_1000041 Ga0207425_100004164 107
137 3300025258 Ga0209129_1002094 Ga0209129_10020943 107
138 3300025263 Ga0209565_1000134 Ga0209565_100013448 107
139 3300025273 Ga0209673_1029162 Ga0209673_10291621 107
140 3300025292 Ga0209676_1026408 Ga0209676_10264084 107
141 3300025294 Ga0209025_1000068 Ga0209025_1000068233 107
142 3300025295 Ga0209564_1013725 Ga0209564_10137251 107
143 3300025295 Ga0209564_1015447 Ga0209564_10154471 107
144 3300025297 Ga0209758_1000004 Ga0209758_1000004132 107
145 3300025298 Ga0209050_1000001 Ga0209050_10000012062 107
146 3300025298 Ga0209050_1014306 Ga0209050_10143065 107
147 3300025303 Ga0209051_1000191 Ga0209051_10001917 107
148 3300025304 Ga0209257_1000876 Ga0209257_100087612 107
149 3300025304 Ga0209257_1002353 Ga0209257_100235311 107
150 3300025315 Ga0207697_10046997 Ga0207697_100469974 107
151 3300025941 Ga0207711_11345137 Ga0207711_113451371 107
152 3300026142 Ga0207698_10353465 Ga0207698_103534653 107
153 3300027907 Ga0207428_10045887 Ga0207428_100458873 107
154 3300028379 Ga0268266_10850351 Ga0268266_108503513 107
155 3300031824 Ga0307413_10121532 Ga0307413_101215325 107
156 3300032004 Ga0307414_10450820 Ga0307414_104508202 107
157 3300032005 Ga0307411_10589128 Ga0307411_105891281 107
158 3300032005 Ga0307411_10830711 Ga0307411_108307112 107
159 3300032126 Ga0307415_100496024 Ga0307415_1004960243 107
160 3300039437 Ga0436365_0600332 Ga0436365_0600332_349_672 107
161 3300046500 Ga0495596_0388920 Ga0495596_0388920_183_515 107
162 3300046530 Ga0495654_0020158 Ga0495654_0020158_1476_1808 107
163 3300048905 Ga0496102_0681373 Ga0496102_0681373_212_535 107
164 3300048906 Ga0496103_0224202 Ga0496103_0224202_53_376 107
165 3300048906 Ga0496103_0233437 Ga0496103_0233437_646_984 107
166 3300048918 Ga0496115_0001129 Ga0496115_0001129_12205_12528 107
167 3300048920 Ga0496117_0251385 Ga0496117_0251385_204_527 107
168 3300048921 Ga0496118_0139050 Ga0496118_0139050_548_871 107
169 3300049760 Ga0501263_029453 Ga0501263_029453_208_546 107
170 3300050005 Ga0501284_02268 Ga0501284_02268_699_1022 107
171 3300053116 Ga0500592_008468 Ga0500592_008468_1002_1334 107
172 3300053151 Ga0500604_0060477 Ga0500604_0060477_741_1073 107
173 3300053157 Ga0500624_000062 Ga0500624_000062_41568_41891 107
174 3300053158 Ga0500627_0000003 Ga0500627_0000003_91821_92153 107
175 3300053178 Ga0500637_0000112 Ga0500637_0000112_18522_18845 107
176 3300000549 LJQas_1037756 LJQas_10377562 108
177 3300001989 JGI24739J22299_10093354 JGI24739J22299_100933541 108
178 3300004798 Ga0058859_11187240 Ga0058859_111872402 108
179 3300005327 Ga0070658_10000172 Ga0070658_1000017228 108
180 3300005333 Ga0070677_10001197 Ga0070677_100011975 108
181 3300005339 Ga0070660_100000399 Ga0070660_10000039918 108
182 3300005344 Ga0070661_100251887 Ga0070661_1002518871 108
183 3300005344 Ga0070661_100988057 Ga0070661_1009880571 108
184 3300005345 Ga0070692_10000103 Ga0070692_1000010311 108
185 3300005354 Ga0070675_100018970 Ga0070675_1000189708 108
186 3300005366 Ga0070659_100013894 Ga0070659_1000138945 108
187 3300005366 Ga0070659_100035203 Ga0070659_1000352032 108
188 3300005444 Ga0070694_101218665 Ga0070694_1012186651 108
189 3300005455 Ga0070663_101747653 Ga0070663_1017476532 108
190 3300005535 Ga0070684_100572744 Ga0070684_1005727441 108
191 3300005539 Ga0068853_100021557 Ga0068853_1000215572 108
192 3300005539 Ga0068853_101121382 Ga0068853_1011213822 108
193 3300005544 Ga0070686_100000352 Ga0070686_10000035218 108
194 3300005547 Ga0070693_101031312 Ga0070693_1010313121 108
195 3300005548 Ga0070665_100000361 Ga0070665_10000036112 108
196 3300005548 Ga0070665_100001120 Ga0070665_10000112033 108
197 3300005563 Ga0068855_100395754 Ga0068855_1003957544 108
198 3300005564 Ga0070664_102058436 Ga0070664_1020584362 108
199 3300005615 Ga0070702_101393985 Ga0070702_1013939851 108
200 3300005616 Ga0068852_101465431 Ga0068852_1014654312 108
201 3300005843 Ga0068860_100048930 Ga0068860_1000489303 108
202 3300005985 Ga0081539_10009010 Ga0081539_100090108 108
203 3300006042 Ga0075368_10163199 Ga0075368_101631993 108
204 3300006048 Ga0075363_100000799 Ga0075363_1000007997 108
205 3300006051 Ga0075364_10033952 Ga0075364_100339527 108
206 3300006177 Ga0075362_10000003 Ga0075362_10000003163 108
207 3300006195 Ga0075366_10000006 Ga0075366_100000069 108
208 3300006195 Ga0075366_10009002 Ga0075366_100090029 108
209 3300006195 Ga0075366_10043167 Ga0075366_100431672 108
210 3300006353 Ga0075370_10000008 Ga0075370_1000000884 108
211 3300006871 Ga0075434_100734299 Ga0075434_1007342992 108
212 3300009148 Ga0105243_11745006 Ga0105243_117450062 108
213 3300009174 Ga0105241_10387501 Ga0105241_103875011 108
214 3300009551 Ga0105238_10125483 Ga0105238_101254833 108
215 3300009553 Ga0105249_11819029 Ga0105249_118190292 108
216 3300013105 Ga0157369_10921210 Ga0157369_109212101 108
217 3300013296 Ga0157374_11882304 Ga0157374_118823041 108
218 3300013307 Ga0157372_11150177 Ga0157372_111501772 108
219 3300014326 Ga0157380_13380793 Ga0157380_133807932 108
220 3300015690 Ga0183363_1004 Ga0183363_1004240 108
221 3300017792 Ga0163161_10867138 Ga0163161_108671381 108
222 3300025893 Ga0207682_10004224 Ga0207682_1000422410 108
223 3300025920 Ga0207649_10848417 Ga0207649_108484171 108
224 3300025920 Ga0207649_10899162 Ga0207649_108991621 108
225 3300025935 Ga0207709_11112615 Ga0207709_111126152 108
226 3300025940 Ga0207691_10788796 Ga0207691_107887961 108
227 3300025945 Ga0207679_10597498 Ga0207679_105974981 108
228 3300025945 Ga0207679_11325829 Ga0207679_113258291 108
229 3300026075 Ga0207708_10468159 Ga0207708_104681593 108
230 3300026121 Ga0207683_11981229 Ga0207683_119812291 108
231 3300026142 Ga0207698_10084139 Ga0207698_100841391 108
232 3300027866 Ga0209813_10029105 Ga0209813_100291051 108
233 3300028379 Ga0268266_10000181 Ga0268266_1000018171 108
234 3300028381 Ga0268264_10030665 Ga0268264_100306653 108
235 3300031456 Ga0307513_10522361 Ga0307513_105223613 108
236 3300031548 Ga0307408_101212836 Ga0307408_1012128361 108
237 3300031731 Ga0307405_10442013 Ga0307405_104420132 108
238 3300031731 Ga0307405_11796864 Ga0307405_117968641 108
239 3300031901 Ga0307406_10132306 Ga0307406_101323064 108
240 3300031995 Ga0307409_101773022 Ga0307409_1017730222 108
241 3300031995 Ga0307409_102542064 Ga0307409_1025420642 108
242 3300032002 Ga0307416_101096960 Ga0307416_1010969601 108
243 3300032004 Ga0307414_10085486 Ga0307414_100854863 108
244 3300032005 Ga0307411_10122243 Ga0307411_101222432 108
245 3300032005 Ga0307411_11715192 Ga0307411_117151921 108
246 3300032005 Ga0307411_12013200 Ga0307411_120132001 108
247 3300032126 Ga0307415_101420031 Ga0307415_1014200311 108
248 3300032126 Ga0307415_101828714 Ga0307415_1018287142 108
249 3300034957 Ga0373938_0176853 Ga0373938_0176853_72_401 108
250 3300035112 Ga0373932_0031572 Ga0373932_0031572_67_396 108
251 3300036401 Ga0373937_0267550 Ga0373937_0267550_445_771 108
252 3300039437 Ga0436365_0922307 Ga0436365_0922307_363_695 108
253 3300039450 Ga0436363_0674844 Ga0436363_0674844_102_428 108
254 3300039450 Ga0436363_1090589 Ga0436363_1090589_582_908 108
255 3300041486 Ga0451807_1087972 Ga0451807_1087972_260_586 108
256 3300045976 Ga0466967_2588529 Ga0466967_2588529_80_409 108
257 3300046528 Ga0495642_0032976 Ga0495642_0032976_673_999 108
258 3300046660 Ga0495625_0598070 Ga0495625_0598070_50_376 108
259 3300049581 Ga0501047_0450251 Ga0501047_0450251_490_819 108
260 3300049823 Ga0501044_0001187 Ga0501044_0001187_21390_21719 108
261 3300050489 nmdc:mga03683_13_c1 nmdc:mga03683_13_c1_49465_49794 108
262 3300050490 nmdc:mga03n38_8067_c1 nmdc:mga03n38_8067_c1_2000_2329 108
263 3300050491 nmdc:mga00v17_133305_c1 nmdc:mga00v17_133305_c1_754_1083 108
264 3300050493 nmdc:mga0k408_423833_c1 nmdc:mga0k408_423833_c1_174_500 108
265 3300050493 nmdc:mga0k408_7432_c1 nmdc:mga0k408_7432_c1_3812_4150 108
266 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_59811_60140 108
267 3300050495 nmdc:mga04h51_34676_c1 nmdc:mga04h51_34676_c1_1105_1434 108
268 3300050496 nmdc:mga07m45_20_c1 nmdc:mga07m45_20_c1_18085_18414 108
269 3300050512 nmdc:mga0n895_267626_c1 nmdc:mga0n895_267626_c1_1180_1506 108
270 3300050516 nmdc:mga0sz30_647_c1 nmdc:mga0sz30_647_c1_431_760 108
271 3300053096 Ga0500641_0011475 Ga0500641_0011475_175_501 108
272 3300001904 JGI24736J21556_1000032 JGI24736J21556_100003226 109
273 3300001976 JGI24752J21851_1000082 JGI24752J21851_10000825 109
274 3300001976 JGI24752J21851_1006793 JGI24752J21851_10067934 109
275 3300001979 JGI24740J21852_10005188 JGI24740J21852_100051887 109
276 3300001989 JGI24739J22299_10000162 JGI24739J22299_1000016220 109
277 3300001989 JGI24739J22299_10025324 JGI24739J22299_100253244 109
278 3300001990 JGI24737J22298_10020755 JGI24737J22298_100207553 109
279 3300002070 JGI24750J21931_1000116 JGI24750J21931_10001164 109
280 3300002074 JGI24748J21848_1000036 JGI24748J21848_100003663 109
281 3300002075 JGI24738J21930_10000231 JGI24738J21930_1000023117 109
282 3300002076 JGI24749J21850_1000049 JGI24749J21850_10000498 109
283 3300002076 JGI24749J21850_1048288 JGI24749J21850_10482881 109
284 3300002239 JGI24034J26672_10000008 JGI24034J26672_1000000834 109
285 3300002239 JGI24034J26672_10000038 JGI24034J26672_1000003863 109
286 3300002239 JGI24034J26672_10003845 JGI24034J26672_100038454 109
287 3300002239 JGI24034J26672_10015831 JGI24034J26672_100158312 109
288 3300002239 JGI24034J26672_10041405 JGI24034J26672_100414052 109
289 3300002244 JGI24742J22300_10005496 JGI24742J22300_100054963 109
290 3300002459 JGI24751J29686_10000216 JGI24751J29686_1000021619 109
291 3300002459 JGI24751J29686_10018164 JGI24751J29686_100181644 109
292 3300005262 Ga0065165_1112184 Ga0065165_11121841 109
293 3300005295 Ga0065707_10000505 Ga0065707_1000050536 109
294 3300005295 Ga0065707_10086198 Ga0065707_100861985 109
295 3300005295 Ga0065707_10098261 Ga0065707_100982615 109
296 3300005295 Ga0065707_10212812 Ga0065707_102128122 109
297 3300005295 Ga0065707_10414622 Ga0065707_104146222 109
298 3300005327 Ga0070658_10040826 Ga0070658_100408265 109
299 3300005329 Ga0070683_101233833 Ga0070683_1012338332 109
300 3300005330 Ga0070690_100000021 Ga0070690_10000002130 109
301 3300005330 Ga0070690_100459866 Ga0070690_1004598662 109
302 3300005331 Ga0070670_100000003 Ga0070670_100000003365 109
303 3300005331 Ga0070670_100002377 Ga0070670_10000237710 109
304 3300005331 Ga0070670_100004170 Ga0070670_10000417015 109
305 3300005331 Ga0070670_100368417 Ga0070670_1003684172 109
306 3300005331 Ga0070670_100426848 Ga0070670_1004268482 109
307 3300005335 Ga0070666_10000004 Ga0070666_10000004253 109
308 3300005335 Ga0070666_10000184 Ga0070666_1000018422 109
309 3300005335 Ga0070666_10033483 Ga0070666_100334833 109
310 3300005335 Ga0070666_11043600 Ga0070666_110436002 109
311 3300005337 Ga0070682_100178661 Ga0070682_1001786611 109
312 3300005340 Ga0070689_100005020 Ga0070689_1000050209 109
313 3300005344 Ga0070661_100246068 Ga0070661_1002460682 109
314 3300005347 Ga0070668_100000026 Ga0070668_10000002627 109
315 3300005347 Ga0070668_100288829 Ga0070668_1002888294 109
316 3300005347 Ga0070668_100428915 Ga0070668_1004289151 109
317 3300005353 Ga0070669_100000008 Ga0070669_10000000845 109
318 3300005353 Ga0070669_100000020 Ga0070669_100000020117 109
319 3300005353 Ga0070669_100000457 Ga0070669_10000045734 109
320 3300005353 Ga0070669_100093939 Ga0070669_1000939393 109
321 3300005353 Ga0070669_101376636 Ga0070669_1013766361 109
322 3300005355 Ga0070671_100000015 Ga0070671_100000015138 109
323 3300005355 Ga0070671_100000470 Ga0070671_10000047021 109
324 3300005355 Ga0070671_100060705 Ga0070671_1000607052 109
325 3300005365 Ga0070688_100003653 Ga0070688_1000036532 109
326 3300005367 Ga0070667_100000019 Ga0070667_100000019215 109
327 3300005367 Ga0070667_100000089 Ga0070667_10000008912 109
328 3300005367 Ga0070667_100006367 Ga0070667_1000063676 109
329 3300005367 Ga0070667_100010059 Ga0070667_1000100596 109
330 3300005367 Ga0070667_100037194 Ga0070667_1000371943 109
331 3300005440 Ga0070705_100054779 Ga0070705_1000547793 109
332 3300005445 Ga0070708_100198374 Ga0070708_1001983742 109
333 3300005455 Ga0070663_100129274 Ga0070663_1001292744 109
334 3300005455 Ga0070663_100588916 Ga0070663_1005889162 109
335 3300005456 Ga0070678_100593866 Ga0070678_1005938661 109
336 3300005457 Ga0070662_100112452 Ga0070662_1001124521 109
337 3300005466 Ga0070685_10000724 Ga0070685_100007244 109
338 3300005467 Ga0070706_100327632 Ga0070706_1003276322 109
339 3300005471 Ga0070698_101498001 Ga0070698_1014980012 109
340 3300005535 Ga0070684_101012712 Ga0070684_1010127121 109
341 3300005539 Ga0068853_100003716 Ga0068853_10000371612 109
342 3300005543 Ga0070672_101519879 Ga0070672_1015198792 109
343 3300005544 Ga0070686_100000012 Ga0070686_100000012151 109
344 3300005547 Ga0070693_101227001 Ga0070693_1012270011 109
345 3300005548 Ga0070665_100000004 Ga0070665_100000004630 109
346 3300005548 Ga0070665_100378831 Ga0070665_1003788311 109
347 3300005548 Ga0070665_101432299 Ga0070665_1014322992 109
348 3300005563 Ga0068855_100577260 Ga0068855_1005772602 109
349 3300005564 Ga0070664_100221374 Ga0070664_1002213742 109
350 3300005564 Ga0070664_100391722 Ga0070664_1003917222 109
351 3300005577 Ga0068857_100089221 Ga0068857_1000892213 109
352 3300005578 Ga0068854_100075543 Ga0068854_1000755434 109
353 3300005578 Ga0068854_100178512 Ga0068854_1001785122 109
354 3300005578 Ga0068854_101175013 Ga0068854_1011750131 109
355 3300005617 Ga0068859_100003505 Ga0068859_1000035056 109
356 3300005617 Ga0068859_100023533 Ga0068859_1000235336 109
357 3300005617 Ga0068859_100028374 Ga0068859_1000283746 109
358 3300005617 Ga0068859_100216629 Ga0068859_1002166292 109
359 3300005618 Ga0068864_100000005 Ga0068864_100000005232 109
360 3300005618 Ga0068864_100005620 Ga0068864_1000056206 109
361 3300005618 Ga0068864_100007081 Ga0068864_1000070815 109
362 3300005618 Ga0068864_100030140 Ga0068864_1000301403 109
363 3300005618 Ga0068864_100466728 Ga0068864_1004667281 109
364 3300005719 Ga0068861_100004980 Ga0068861_1000049804 109
365 3300005719 Ga0068861_100020681 Ga0068861_1000206811 109
366 3300005719 Ga0068861_100154977 Ga0068861_1001549774 109
367 3300005834 Ga0068851_10064379 Ga0068851_100643794 109
368 3300005841 Ga0068863_100000013 Ga0068863_100000013176 109
369 3300005841 Ga0068863_100002259 Ga0068863_10000225915 109
370 3300005841 Ga0068863_100067996 Ga0068863_1000679964 109
371 3300005842 Ga0068858_100010355 Ga0068858_10001035513 109
372 3300005842 Ga0068858_100034454 Ga0068858_1000344545 109
373 3300005842 Ga0068858_100053891 Ga0068858_1000538914 109
374 3300005843 Ga0068860_100000009 Ga0068860_100000009252 109
375 3300005843 Ga0068860_100000036 Ga0068860_100000036229 109
376 3300005843 Ga0068860_100000148 Ga0068860_100000148119 109
377 3300005843 Ga0068860_100001081 Ga0068860_10000108118 109
378 3300005844 Ga0068862_100000001 Ga0068862_100000001221 109
379 3300005844 Ga0068862_100000169 Ga0068862_1000001696 109
380 3300005844 Ga0068862_100000209 Ga0068862_10000020928 109
381 3300005844 Ga0068862_100006085 Ga0068862_10000608510 109
382 3300005937 Ga0081455_10601736 Ga0081455_106017361 109
383 3300006931 Ga0097620_100003505 Ga0097620_1000035056 109
384 3300006931 Ga0097620_100023532 Ga0097620_1000235325 109
385 3300006931 Ga0097620_100028372 Ga0097620_1000283726 109
386 3300006931 Ga0097620_100216626 Ga0097620_1002166262 109
387 3300009011 Ga0105251_10091930 Ga0105251_100919302 109
388 3300009011 Ga0105251_10438344 Ga0105251_104383442 109
389 3300009092 Ga0105250_10040167 Ga0105250_100401674 109
390 3300009093 Ga0105240_10015679 Ga0105240_100156799 109
391 3300009093 Ga0105240_10025126 Ga0105240_1002512610 109
392 3300009101 Ga0105247_10144469 Ga0105247_101444692 109
393 3300009148 Ga0105243_10889364 Ga0105243_108893642 109
394 3300009148 Ga0105243_10942050 Ga0105243_109420501 109
395 3300009174 Ga0105241_10707420 Ga0105241_107074202 109
396 3300009177 Ga0105248_10059949 Ga0105248_100599492 109
397 3300009177 Ga0105248_11064157 Ga0105248_110641573 109
398 3300009545 Ga0105237_10044206 Ga0105237_100442064 109
399 3300009545 Ga0105237_10048537 Ga0105237_100485373 109
400 3300009551 Ga0105238_10102613 Ga0105238_101026135 109
401 3300009553 Ga0105249_10000006 Ga0105249_10000006113 109
402 3300009978 Ga0105148_100540 Ga0105148_1005406 109
403 3300009982 Ga0105147_110624 Ga0105147_1106242 109
404 3300010375 Ga0105239_10000367 Ga0105239_1000036748 109
405 3300010375 Ga0105239_10326543 Ga0105239_103265432 109
406 3300013100 Ga0157373_10087299 Ga0157373_100872995 109
407 3300013104 Ga0157370_10062515 Ga0157370_100625155 109
408 3300013105 Ga0157369_10138988 Ga0157369_101389883 109
409 3300013297 Ga0157378_10501215 Ga0157378_105012152 109
410 3300013306 Ga0163162_10008623 Ga0163162_100086236 109
411 3300013307 Ga0157372_10452741 Ga0157372_104527412 109
412 3300014325 Ga0163163_10071955 Ga0163163_100719555 109
413 3300014325 Ga0163163_11267920 Ga0163163_112679202 109
414 3300014326 Ga0157380_10000029 Ga0157380_1000002963 109
415 3300014326 Ga0157380_10000182 Ga0157380_100001827 109
416 3300014326 Ga0157380_10001161 Ga0157380_1000116111 109
417 3300014326 Ga0157380_10058444 Ga0157380_100584442 109
418 3300014326 Ga0157380_10340692 Ga0157380_103406923 109
419 3300014968 Ga0157379_10049804 Ga0157379_100498042 109
420 3300014969 Ga0157376_12284786 Ga0157376_122847861 109
421 3300017792 Ga0163161_10000101 Ga0163161_1000010153 109
422 3300017792 Ga0163161_10901068 Ga0163161_109010682 109
423 3300020069 Ga0197907_10257285 Ga0197907_102572852 109
424 3300021388 Ga0213875_10009905 Ga0213875_100099056 109
425 3300025223 Ga0207672_1000641 Ga0207672_10006414 109
426 3300025245 Ga0207425_1015629 Ga0207425_10156294 109
427 3300025263 Ga0209565_1000008 Ga0209565_1000008632 109
428 3300025273 Ga0209673_1002352 Ga0209673_100235211 109
429 3300025291 Ga0209675_1009250 Ga0209675_10092506 109
430 3300025297 Ga0209758_1012697 Ga0209758_10126978 109
431 3300025298 Ga0209050_1000581 Ga0209050_100058117 109
432 3300025298 Ga0209050_1007158 Ga0209050_100715810 109
433 3300025299 Ga0209256_1000009 Ga0209256_1000009237 109
434 3300025299 Ga0209256_1000010 Ga0209256_1000010161 109
435 3300025303 Ga0209051_1102885 Ga0209051_11028852 109
436 3300025304 Ga0209257_1002898 Ga0209257_10028985 109
437 3300025304 Ga0209257_1003401 Ga0209257_10034015 109
438 3300025304 Ga0209257_1090367 Ga0209257_10903671 109
439 3300025315 Ga0207697_10006525 Ga0207697_100065256 109
440 3300025321 Ga0207656_10012218 Ga0207656_100122184 109
441 3300025900 Ga0207710_10007240 Ga0207710_100072404 109
442 3300025903 Ga0207680_10000010 Ga0207680_10000010155 109
443 3300025903 Ga0207680_10000186 Ga0207680_1000018615 109
444 3300025904 Ga0207647_10000038 Ga0207647_1000003819 109
445 3300025909 Ga0207705_10135124 Ga0207705_101351245 109
446 3300025910 Ga0207684_10707388 Ga0207684_107073881 109
447 3300025911 Ga0207654_10000375 Ga0207654_1000037526 109
448 3300025913 Ga0207695_10001183 Ga0207695_1000118320 109
449 3300025913 Ga0207695_10016421 Ga0207695_100164219 109
450 3300025913 Ga0207695_10021724 Ga0207695_100217243 109
451 3300025914 Ga0207671_10001192 Ga0207671_1000119215 109
452 3300025914 Ga0207671_10027639 Ga0207671_100276394 109
453 3300025919 Ga0207657_10387615 Ga0207657_103876152 109
454 3300025920 Ga0207649_10150506 Ga0207649_101505064 109
455 3300025923 Ga0207681_10000002 Ga0207681_10000002137 109
456 3300025923 Ga0207681_10000005 Ga0207681_10000005356 109
457 3300025923 Ga0207681_10000183 Ga0207681_1000018346 109
458 3300025923 Ga0207681_10716631 Ga0207681_107166312 109
459 3300025924 Ga0207694_10002087 Ga0207694_1000208715 109
460 3300025925 Ga0207650_10000004 Ga0207650_10000004362 109
461 3300025925 Ga0207650_10002904 Ga0207650_1000290410 109
462 3300025925 Ga0207650_10006404 Ga0207650_100064046 109
463 3300025931 Ga0207644_10000002 Ga0207644_10000002136 109
464 3300025931 Ga0207644_10000067 Ga0207644_1000006749 109
465 3300025931 Ga0207644_10001857 Ga0207644_100018572 109
466 3300025933 Ga0207706_10015340 Ga0207706_100153405 109
467 3300025933 Ga0207706_10138164 Ga0207706_101381642 109
468 3300025936 Ga0207670_10083992 Ga0207670_100839923 109
469 3300025940 Ga0207691_11030603 Ga0207691_110306031 109
470 3300025940 Ga0207691_11267125 Ga0207691_112671251 109
471 3300025941 Ga0207711_10000075 Ga0207711_1000007522 109
472 3300025941 Ga0207711_10006118 Ga0207711_100061189 109
473 3300025941 Ga0207711_10024088 Ga0207711_100240885 109
474 3300025941 Ga0207711_10663848 Ga0207711_106638481 109
475 3300025944 Ga0207661_10482382 Ga0207661_104823823 109
476 3300025945 Ga0207679_10123611 Ga0207679_101236112 109
477 3300025949 Ga0207667_10011748 Ga0207667_1001174810 109
478 3300025949 Ga0207667_10498960 Ga0207667_104989602 109
479 3300025961 Ga0207712_10000014 Ga0207712_10000014252 109
480 3300025961 Ga0207712_10018137 Ga0207712_100181376 109
481 3300025972 Ga0207668_10000081 Ga0207668_1000008159 109
482 3300025972 Ga0207668_10005340 Ga0207668_100053408 109
483 3300025972 Ga0207668_10085277 Ga0207668_100852771 109
484 3300025981 Ga0207640_10031448 Ga0207640_100314485 109
485 3300025981 Ga0207640_10062003 Ga0207640_100620032 109
486 3300025981 Ga0207640_11683279 Ga0207640_116832791 109
487 3300025986 Ga0207658_10000002 Ga0207658_10000002241 109
488 3300025986 Ga0207658_10000069 Ga0207658_10000069116 109
489 3300025986 Ga0207658_10004095 Ga0207658_100040956 109
490 3300025986 Ga0207658_10008782 Ga0207658_100087823 109
491 3300025986 Ga0207658_10018656 Ga0207658_100186563 109
492 3300026035 Ga0207703_10005351 Ga0207703_1000535110 109
493 3300026035 Ga0207703_10008030 Ga0207703_100080304 109
494 3300026035 Ga0207703_10009134 Ga0207703_100091347 109
495 3300026041 Ga0207639_10187001 Ga0207639_101870012 109
496 3300026041 Ga0207639_10312608 Ga0207639_103126082 109
497 3300026041 Ga0207639_10602963 Ga0207639_106029631 109
498 3300026041 Ga0207639_11412677 Ga0207639_114126772 109
499 3300026067 Ga0207678_10088208 Ga0207678_100882082 109
500 3300026067 Ga0207678_10889898 Ga0207678_108898983 109
501 3300026067 Ga0207678_11627230 Ga0207678_116272301 109
502 3300026078 Ga0207702_10000887 Ga0207702_1000088715 109
503 3300026088 Ga0207641_10000099 Ga0207641_1000009972 109
504 3300026088 Ga0207641_10003319 Ga0207641_100033197 109
505 3300026088 Ga0207641_10004490 Ga0207641_100044904 109
506 3300026088 Ga0207641_10004505 Ga0207641_100045058 109
507 3300026088 Ga0207641_10013693 Ga0207641_100136934 109
508 3300026088 Ga0207641_10014410 Ga0207641_1001441010 109
509 3300026095 Ga0207676_10000006 Ga0207676_10000006350 109
510 3300026095 Ga0207676_10000770 Ga0207676_100007704 109
511 3300026095 Ga0207676_10022559 Ga0207676_100225596 109
512 3300026095 Ga0207676_10041840 Ga0207676_100418404 109
513 3300026116 Ga0207674_10016903 Ga0207674_1001690310 109
514 3300026116 Ga0207674_10202281 Ga0207674_102022813 109
515 3300026116 Ga0207674_12258894 Ga0207674_122588941 109
516 3300026118 Ga0207675_100000358 Ga0207675_1000003585 109
517 3300026118 Ga0207675_100001138 Ga0207675_10000113820 109
518 3300026118 Ga0207675_100001918 Ga0207675_10000191824 109
519 3300026118 Ga0207675_100230090 Ga0207675_1002300905 109
520 3300026142 Ga0207698_10130218 Ga0207698_101302185 109
521 3300028379 Ga0268266_10000009 Ga0268266_10000009171 109
522 3300028379 Ga0268266_10211526 Ga0268266_102115265 109
523 3300028379 Ga0268266_10315170 Ga0268266_103151704 109
524 3300028379 Ga0268266_11019591 Ga0268266_110195912 109
525 3300028379 Ga0268266_11068863 Ga0268266_110688631 109
526 3300028379 Ga0268266_11514040 Ga0268266_115140401 109
527 3300028380 Ga0268265_10000001 Ga0268265_10000001811 109
528 3300028380 Ga0268265_10000047 Ga0268265_1000004777 109
529 3300028380 Ga0268265_10000285 Ga0268265_1000028539 109
530 3300028380 Ga0268265_10004726 Ga0268265_100047266 109
531 3300028381 Ga0268264_10000001 Ga0268264_10000001566 109
532 3300028381 Ga0268264_10000010 Ga0268264_10000010354 109
533 3300028381 Ga0268264_10000023 Ga0268264_10000023113 109
534 3300028381 Ga0268264_10000217 Ga0268264_10000217116 109
535 3300028786 Ga0307517_10024293 Ga0307517_1002429311 109
536 3300030733 Ga0314311_1203820 Ga0314311_12038203 109
537 3300031548 Ga0307408_100388134 Ga0307408_1003881344 109
538 3300031548 Ga0307408_100545382 Ga0307408_1005453823 109
539 3300031731 Ga0307405_10165710 Ga0307405_101657103 109
540 3300031731 Ga0307405_10530365 Ga0307405_105303653 109
541 3300031731 Ga0307405_11134964 Ga0307405_111349642 109
542 3300031731 Ga0307405_11173503 Ga0307405_111735031 109
543 3300031731 Ga0307405_11848273 Ga0307405_118482731 109
544 3300031824 Ga0307413_11727913 Ga0307413_117279132 109
545 3300031901 Ga0307406_10071868 Ga0307406_100718682 109
546 3300031901 Ga0307406_10683111 Ga0307406_106831112 109
547 3300031911 Ga0307412_10075035 Ga0307412_100750352 109
548 3300031911 Ga0307412_11563801 Ga0307412_115638012 109
549 3300032002 Ga0307416_101827298 Ga0307416_1018272982 109
550 3300032126 Ga0307415_100438347 Ga0307415_1004383472 109
551 3300032126 Ga0307415_101294198 Ga0307415_1012941982 109
552 3300037853 Ga0436364_0741438 Ga0436364_0741438_409_741 109
553 3300041404 Ga0439436_0045695 Ga0439436_0045695_302_634 109
554 3300041406 Ga0439439_0001779 Ga0439439_0001779_2929_3261 109
555 3300041406 Ga0439439_0134264 Ga0439439_0134264_282_614 109
556 3300041410 Ga0439461_0000498 Ga0439461_0000498_4439_4771 109
557 3300041410 Ga0439461_0080904 Ga0439461_0080904_312_644 109
558 3300041413 Ga0439465_0004274 Ga0439465_0004274_2725_3057 109
559 3300041452 Ga0451793_1471615 Ga0451793_1471615_310_639 109
560 3300041997 Ga0439431_0000140 Ga0439431_0000140_12095_12427 109
561 3300041997 Ga0439431_0010888 Ga0439431_0010888_1629_1961 109
562 3300042002 Ga0439442_013335 Ga0439442_013335_137_469 109
563 3300042004 Ga0439445_0033115 Ga0439445_0033115_385_717 109
564 3300042004 Ga0439445_0142362 Ga0439445_0142362_171_503 109
565 3300042006 Ga0439432_000640 Ga0439432_000640_10983_11315 109
566 3300042010 Ga0439452_018803 Ga0439452_018803_1126_1458 109
567 3300042015 Ga0439462_0002776 Ga0439462_0002776_1149_1481 109
568 3300042435 Ga0439434_0006562 Ga0439434_0006562_1732_2064 109
569 3300044735 Ga0466968_0038917 Ga0466968_0038917_1352_1687 109
570 3300046513 Ga0495616_0001456 Ga0495616_0001456_5067_5399 109
571 3300046519 Ga0495632_0253925 Ga0495632_0253925_148_483 109
572 3300046519 Ga0495632_0317276 Ga0495632_0317276_324_656 109
573 3300046522 Ga0495643_0460184 Ga0495643_0460184_174_506 109
574 3300046524 Ga0495648_0042423 Ga0495648_0042423_1086_1415 109
575 3300046525 Ga0495663_0044618 Ga0495663_0044618_803_1135 109
576 3300046530 Ga0495654_0001073 Ga0495654_0001073_15606_15938 109
577 3300046530 Ga0495654_0116202 Ga0495654_0116202_768_1103 109
578 3300046542 Ga0495597_0031259 Ga0495597_0031259_976_1305 109
579 3300046616 Ga0495668_0002221 Ga0495668_0002221_15041_15373 109
580 3300046616 Ga0495668_0011998 Ga0495668_0011998_2318_2650 109
581 3300046794 Ga0495589_0067756 Ga0495589_0067756_422_754 109
582 3300047472 Ga0495686_0001246 Ga0495686_0001246_25879_26214 109
583 3300048904 Ga0496101_0346342 Ga0496101_0346342_529_861 109
584 3300048905 Ga0496102_0000069 Ga0496102_0000069_59827_60156 109
585 3300048905 Ga0496102_0172254 Ga0496102_0172254_1313_1645 109
586 3300048906 Ga0496103_0000173 Ga0496103_0000173_18419_18748 109
587 3300048906 Ga0496103_0033025 Ga0496103_0033025_2491_2823 109
588 3300048907 Ga0496104_0059792 Ga0496104_0059792_1015_1347 109
589 3300048908 Ga0496105_1191995 Ga0496105_1191995_59_388 109
590 3300048909 Ga0496106_0076352 Ga0496106_0076352_825_1157 109
591 3300048910 Ga0496107_0252341 Ga0496107_0252341_433_765 109
592 3300048910 Ga0496107_1217068 Ga0496107_1217068_67_408 109
593 3300048916 Ga0496113_0519615 Ga0496113_0519615_506_841 109
594 3300048919 Ga0496116_0000566 Ga0496116_0000566_9649_9978 109
595 3300048919 Ga0496116_0032138 Ga0496116_0032138_2062_2394 109
596 3300048920 Ga0496117_0000485 Ga0496117_0000485_47862_48191 109
597 3300048920 Ga0496117_0089533 Ga0496117_0089533_369_704 109
598 3300048920 Ga0496117_0231937 Ga0496117_0231937_559_891 109
599 3300048921 Ga0496118_0000190 Ga0496118_0000190_47862_48191 109
600 3300048921 Ga0496118_0015970 Ga0496118_0015970_977_1312 109
601 3300048921 Ga0496118_0079363 Ga0496118_0079363_683_1015 109
602 3300048922 Ga0496119_0038129 Ga0496119_0038129_717_1052 109
603 3300048922 Ga0496119_0072971 Ga0496119_0072971_663_995 109
604 3300048923 Ga0496120_0110614 Ga0496120_0110614_1013_1342 109
605 3300048923 Ga0496120_0178484 Ga0496120_0178484_53_385 109
606 3300048924 Ga0496121_0010499 Ga0496121_0010499_7704_8039 109
607 3300048924 Ga0496121_0058069 Ga0496121_0058069_306_638 109
608 3300048927 Ga0496124_0000546 Ga0496124_0000546_15434_15763 109
609 3300048927 Ga0496124_0081473 Ga0496124_0081473_892_1224 109
610 3300048928 Ga0496125_0286884 Ga0496125_0286884_158_493 109
611 3300048929 Ga0496126_0016996 Ga0496126_0016996_2164_2499 109
612 3300048929 Ga0496126_0150910 Ga0496126_0150910_700_1032 109
613 3300049127 Ga0501306_009105 Ga0501306_009105_416_745 109
614 3300049161 Ga0501305_021695 Ga0501305_021695_305_634 109
615 3300049162 Ga0501307_005380 Ga0501307_005380_383_712 109
616 3300049513 Ga0501290_000237 Ga0501290_000237_4696_5031 109
617 3300049515 Ga0501292_000042 Ga0501292_000042_28170_28505 109
618 3300049516 Ga0501293_018406 Ga0501293_018406_64_393 109
619 3300049520 Ga0501297_009582 Ga0501297_009582_628_963 109
620 3300049521 Ga0501298_063023 Ga0501298_063023_88_417 109
621 3300049527 Ga0501311_027272 Ga0501311_027272_385_714 109
622 3300049528 Ga0501312_025302 Ga0501312_025302_170_499 109
623 3300049529 Ga0501313_020213 Ga0501313_020213_175_504 109
624 3300049531 Ga0501315_000962 Ga0501315_000962_751_1086 109
625 3300049531 Ga0501315_046231 Ga0501315_046231_318_650 109
626 3300049533 Ga0501317_002915 Ga0501317_002915_770_1105 109
627 3300049536 Ga0501320_006506 Ga0501320_006506_538_867 109
628 3300049551 Ga0501335_013930 Ga0501335_013930_340_672 109
629 3300049569 Ga0501032_0113352 Ga0501032_0113352_96_425 109
630 3300049575 Ga0501039_1595636 Ga0501039_1595636_110_445 109
631 3300049578 Ga0501042_0260954 Ga0501042_0260954_626_955 109
632 3300049579 Ga0501043_0049166 Ga0501043_0049166_1983_2318 109
633 3300049579 Ga0501043_0113159 Ga0501043_0113159_1354_1683 109
634 3300049580 Ga0501046_0030454 Ga0501046_0030454_2308_2637 109
635 3300049581 Ga0501047_0000731 Ga0501047_0000731_8945_9274 109
636 3300049581 Ga0501047_0885518 Ga0501047_0885518_63_392 109
637 3300049653 Ga0501206_008325 Ga0501206_008325_116_451 109
638 3300049662 Ga0501222_001746 Ga0501222_001746_1282_1617 109
639 3300049663 Ga0501223_004016 Ga0501223_004016_1882_2217 109
640 3300049664 Ga0501224_000754 Ga0501224_000754_2739_3074 109
641 3300049665 Ga0501227_028030 Ga0501227_028030_297_632 109
642 3300049669 Ga0501235_001097 Ga0501235_001097_575_910 109
643 3300049679 Ga0501249_000213 Ga0501249_000213_16367_16696 109
644 3300049686 Ga0501257_000049 Ga0501257_000049_24640_24969 109
645 3300049686 Ga0501257_013441 Ga0501257_013441_245_580 109
646 3300049688 Ga0501259_001391 Ga0501259_001391_1017_1352 109
647 3300049690 Ga0501261_000021 Ga0501261_000021_24455_24790 109
648 3300049704 Ga0501221_259218 Ga0501221_259218_114_446 109
649 3300049705 Ga0501225_0006973 Ga0501225_0006973_2638_2970 109
650 3300049705 Ga0501225_0071549 Ga0501225_0071549_304_636 109
651 3300049707 Ga0501234_068536 Ga0501234_068536_89_424 109
652 3300049758 Ga0501241_024823 Ga0501241_024823_465_797 109
653 3300049775 Ga0501279_000010 Ga0501279_000010_9706_10041 109
654 3300049776 Ga0501280_000064 Ga0501280_000064_12340_12675 109
655 3300049776 Ga0501280_001057 Ga0501280_001057_628_957 109
656 3300049778 Ga0501282_000404 Ga0501282_000404_673_1008 109
657 3300049779 Ga0501283_001453 Ga0501283_001453_487_822 109
658 3300049822 Ga0501035_0244287 Ga0501035_0244287_241_570 109
659 3300049823 Ga0501044_0074300 Ga0501044_0074300_2100_2435 109
660 3300049850 Ga0501204_000430 Ga0501204_000430_824_1153 109
661 3300053087 Ga0500643_000135 Ga0500643_000135_50354_50686 109
662 3300053087 Ga0500643_000195 Ga0500643_000195_54427_54762 109
663 3300053091 Ga0500647_0137576 Ga0500647_0137576_572_904 109
664 3300053093 Ga0500651_0086862 Ga0500651_0086862_690_1019 109
665 3300053094 Ga0500566_0004538 Ga0500566_0004538_7188_7520 109
666 3300053108 Ga0500562_040866 Ga0500562_040866_135_467 109
667 3300053116 Ga0500592_000031 Ga0500592_000031_4783_5118 109
668 3300053125 Ga0500618_014810 Ga0500618_014810_730_1059 109
669 3300053128 Ga0500626_092170 Ga0500626_092170_108_440 109
670 3300053130 Ga0500642_0014296 Ga0500642_0014296_1876_2205 109
671 3300053131 Ga0500652_278543 Ga0500652_278543_43_372 109
672 3300053131 Ga0500652_371382 Ga0500652_371382_15_347 109
673 3300053133 Ga0500655_000251 Ga0500655_000251_8400_8729 109
674 3300053148 Ga0500590_000131 Ga0500590_000131_7658_7987 109
675 3300053151 Ga0500604_0036484 Ga0500604_0036484_1084_1416 109
676 3300053151 Ga0500604_0039631 Ga0500604_0039631_575_907 109
677 3300053151 Ga0500604_0071415 Ga0500604_0071415_82_417 109
678 3300053151 Ga0500604_0194406 Ga0500604_0194406_175_507 109
679 3300053153 Ga0500616_0008241 Ga0500616_0008241_2430_2765 109
680 3300053156 Ga0500622_0025695 Ga0500622_0025695_48_377 109
681 3300053156 Ga0500622_0091256 Ga0500622_0091256_415_750 109
682 3300053158 Ga0500627_0000570 Ga0500627_0000570_6969_7301 109
683 3300053158 Ga0500627_0001223 Ga0500627_0001223_5749_6084 109
684 3300053158 Ga0500627_0027041 Ga0500627_0027041_638_970 109
685 3300053163 Ga0500639_139272 Ga0500639_139272_25_354 109
686 3300053177 Ga0500636_0058873 Ga0500636_0058873_1684_2016 109
687 3300053177 Ga0500636_0230432 Ga0500636_0230432_477_806 109
688 3300053724 Ga0500570_004079 Ga0500570_004079_2738_3067 109
689 3300059604 Ga0587098_059728 Ga0587098_059728_33_365 109
690 2162886007 SwRhRL2b_contig_944437 SwRhRL2b_0442.00002650 110
691 3300001976 JGI24752J21851_1000644 JGI24752J21851_10006446 110
692 3300005289 Ga0065704_10124492 Ga0065704_101244921 110
693 3300005331 Ga0070670_100000021 Ga0070670_100000021196 110
694 3300005367 Ga0070667_100000642 Ga0070667_10000064227 110
695 3300005577 Ga0068857_100021366 Ga0068857_1000213665 110
696 3300005617 Ga0068859_100042554 Ga0068859_1000425545 110
697 3300005618 Ga0068864_100000004 Ga0068864_100000004159 110
698 3300005841 Ga0068863_100000002 Ga0068863_100000002160 110
699 3300005844 Ga0068862_100000002 Ga0068862_100000002342 110
700 3300006931 Ga0097620_100042555 Ga0097620_1000425555 110
701 3300009011 Ga0105251_10001284 Ga0105251_1000128421 110
702 3300009092 Ga0105250_10487276 Ga0105250_104872761 110
703 3300009177 Ga0105248_10000010 Ga0105248_10000010185 110
704 3300009177 Ga0105248_10001558 Ga0105248_1000155814 110
705 3300009177 Ga0105248_10008696 Ga0105248_100086969 110
706 3300009553 Ga0105249_10000041 Ga0105249_10000041127 110
707 3300009553 Ga0105249_10019753 Ga0105249_100197536 110
708 3300013100 Ga0157373_10428844 Ga0157373_104288442 110
709 3300013306 Ga0163162_10019579 Ga0163162_100195798 110
710 3300014325 Ga0163163_10030114 Ga0163163_100301145 110
711 3300014326 Ga0157380_10808594 Ga0157380_108085942 110
712 3300014968 Ga0157379_10051644 Ga0157379_100516441 110
713 3300014968 Ga0157379_10128162 Ga0157379_101281623 110
714 3300025735 Ga0207713_1001586 Ga0207713_100158619 110
715 3300025925 Ga0207650_10000083 Ga0207650_1000008333 110
716 3300025941 Ga0207711_10000035 Ga0207711_1000003522 110
717 3300025961 Ga0207712_10000620 Ga0207712_1000062015 110
718 3300025986 Ga0207658_10000388 Ga0207658_1000038837 110
719 3300026088 Ga0207641_10000002 Ga0207641_10000002640 110
720 3300026095 Ga0207676_10000005 Ga0207676_10000005167 110
721 3300026116 Ga0207674_10131652 Ga0207674_101316522 110
722 3300028380 Ga0268265_10000003 Ga0268265_10000003349 110
723 3300031901 Ga0307406_10114532 Ga0307406_101145322 110
724 3300044765 Ga0466970_0632016 Ga0466970_0632016_117_458 110
725 3300048903 Ga0496100_0652598 Ga0496100_0652598_395_742 110
726 3300048906 Ga0496103_0030066 Ga0496103_0030066_1803_2135 110
727 3300048910 Ga0496107_0173558 Ga0496107_0173558_444_791 110
728 3300048920 Ga0496117_0018342 Ga0496117_0018342_3290_3622 110
729 3300048921 Ga0496118_0000463 Ga0496118_0000463_65072_65404 110
730 3300048924 Ga0496121_0016723 Ga0496121_0016723_4841_5179 110
731 3300048924 Ga0496121_0295366 Ga0496121_0295366_455_787 110
732 3300049516 Ga0501293_008149 Ga0501293_008149_247_585 110
733 3300049517 Ga0501294_000032 Ga0501294_000032_2304_2642 110
734 3300049523 Ga0501300_000392 Ga0501300_000392_5911_6249 110
735 3300049551 Ga0501335_029598 Ga0501335_029598_171_509 110
736 3300049652 Ga0501202_063125 Ga0501202_063125_253_591 110
737 3300049654 Ga0501207_021740 Ga0501207_021740_615_953 110
738 3300049668 Ga0501233_012436 Ga0501233_012436_918_1256 110
739 3300049670 Ga0501236_053975 Ga0501236_053975_67_405 110
740 3300049704 Ga0501221_003846 Ga0501221_003846_380_718 110
741 3300049705 Ga0501225_0043405 Ga0501225_0043405_450_788 110
742 3300049708 Ga0501245_001378 Ga0501245_001378_2557_2895 110
743 3300049761 Ga0501264_008163 Ga0501264_008163_598_936 110
744 3300049773 Ga0501276_013553 Ga0501276_013553_81_419 110
745 3300049777 Ga0501281_00086 Ga0501281_00086_966_1304 110
746 3300053116 Ga0500592_001156 Ga0500592_001156_2527_2862 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

37

101

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9678 5 100
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9603 1 105
2yan-assembly2.cif.gz_B crystal structure of the second glutaredoxin domain of human txnl2 0.9532 5 104
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9524 7 110
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9502 4 110
ID Description Score Start End Superfamily
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9948 9 100 3.40.30.10
af_A0A1D6ETY4_422_499_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.986 9 85 3.40.30.10
af_Q4CNA8_28_125_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9844 10 105 3.40.30.10
af_Q8IBZ7_179_272_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.984 12 100 3.40.30.10
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9826 10 100 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A258I2M9-F1-model_v4 Glutaredoxin 1.003 6 110 GO:0015036
GO:0046872
GO:0051537
AF-A0A3B9AYU0-F1-model_v4 deleted 1.003 5 98
AF-A7IMR7-F1-model_v4 Glutaredoxin 1.002 6 108 GO:0015036
GO:0046872
GO:0051537
AF-A0A7S3K0F1-F1-model_v4 Glutaredoxin domain-containing protein 1.002 4 88 GO:0005759
GO:0046872
GO:0051537
AF-A0A7R9W3H0-F1-model_v4 Glutaredoxin domain-containing protein 0.9997 1 100 GO:0005759
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
96.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map