F478848
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 368 | 741 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100021366|Ga0068857_1000213665 |
| Length | 128 |
| Sequence | MSDRRMLPIRLDTALEEPTMTDDTQARIATAVASADVLLFMKGTPLFPQCGFSSRAIAILDHLGVEYATVDVLQDPEIRAGIKEFSDWPTIPQLYVGGEFVGGSDIMMEMYEAGELLQLLDAKGIAHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 6 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 7 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 8 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 106 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 191 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 220 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 226 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 284 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 285 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 287 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 288 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 289 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 290 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 304 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 306 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 307 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 308 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 319 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 322 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 323 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 324 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 325 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 327 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 329 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 330 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 331 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 335 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 346 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 347 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 350 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 351 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 356 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 363 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 365 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 366 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 2.14 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.66 |
| Nodule | 0 |
| Rhizoplane | 3.49 |
| Rhizosphere | 79.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_944437 | 2162886007 | Bacteria | 1095 |
| 2 | LJQas_1037756 | 3300000549 | Bacteria | 570 |
| 3 | JGI24736J21556_1000032 | 3300001904 | Bacteria | 24066 |
| 4 | JGI24752J21851_1000082 | 3300001976 | Bacteria | 12689 |
| 5 | JGI24752J21851_1000644 | 3300001976 | Bacteria | 4647 |
| 6 | JGI24752J21851_1006793 | 3300001976 | Bacteria | 1495 |
| 7 | JGI24740J21852_10005188 | 3300001979 | Bacteria | 5530 |
| 8 | JGI24739J22299_10000162 | 3300001989 | Bacteria | 21912 |
| 9 | JGI24739J22299_10025324 | 3300001989 | Bacteria | 2087 |
| 10 | JGI24739J22299_10093354 | 3300001989 | Bacteria | 914 |
| 11 | JGI24737J22298_10020755 | 3300001990 | Bacteria | 2096 |
| 12 | JGI24750J21931_1000116 | 3300002070 | Bacteria | 12611 |
| 13 | JGI24748J21848_1000036 | 3300002074 | Bacteria | 72512 |
| 14 | JGI24738J21930_10000231 | 3300002075 | Bacteria | 15154 |
| 15 | JGI24749J21850_1000049 | 3300002076 | Bacteria | 22639 |
| 16 | JGI24749J21850_1048288 | 3300002076 | Bacteria | 632 |
| 17 | JGI24034J26672_10000008 | 3300002239 | Bacteria | 200986 |
| 18 | JGI24034J26672_10000038 | 3300002239 | Bacteria | 75372 |
| 19 | JGI24034J26672_10003845 | 3300002239 | Bacteria | 2109 |
| 20 | JGI24034J26672_10015831 | 3300002239 | Bacteria | 1157 |
| 21 | JGI24034J26672_10041405 | 3300002239 | Bacteria | 774 |
| 22 | JGI24742J22300_10005496 | 3300002244 | Bacteria | 2085 |
| 23 | JGI24751J29686_10000216 | 3300002459 | Bacteria | 24503 |
| 24 | JGI24751J29686_10018164 | 3300002459 | Bacteria | 1454 |
| 25 | JGI25150J39212_1002047 | 3300002774 | Bacteria | 5243 |
| 26 | JGI25153J46596_10000395 | 3300003215 | Bacteria | 29365 |
| 27 | Ga0055536_1012135 | 3300003781 | Bacteria | 3225 |
| 28 | Ga0055530_10007314 | 3300003791 | Bacteria | 4682 |
| 29 | Ga0055540_1002064 | 3300003792 | Bacteria | 11085 |
| 30 | Ga0058859_11187240 | 3300004798 | Bacteria | 615 |
| 31 | Ga0065165_1062777 | 3300005262 | Bacteria | 1012 |
| 32 | Ga0065165_1112184 | 3300005262 | Bacteria | 670 |
| 33 | Ga0065704_10124492 | 3300005289 | Bacteria | 1717 |
| 34 | Ga0065715_10344649 | 3300005293 | Bacteria | 924 |
| 35 | Ga0065707_10000505 | 3300005295 | Bacteria | 50569 |
| 36 | Ga0065707_10086198 | 3300005295 | Bacteria | 5602 |
| 37 | Ga0065707_10098261 | 3300005295 | Bacteria | 3099 |
| 38 | Ga0065707_10212812 | 3300005295 | Bacteria | 1258 |
| 39 | Ga0065707_10414622 | 3300005295 | Bacteria | 837 |
| 40 | Ga0070658_10000172 | 3300005327 | Bacteria | 56478 |
| 41 | Ga0070658_10040826 | 3300005327 | Bacteria | 3744 |
| 42 | Ga0070658_10603273 | 3300005327 | Bacteria | 951 |
| 43 | Ga0070658_10707327 | 3300005327 | Bacteria | 875 |
| 44 | Ga0070683_101233833 | 3300005329 | Bacteria | 718 |
| 45 | Ga0070690_100000021 | 3300005330 | Bacteria | 74350 |
| 46 | Ga0070690_100459866 | 3300005330 | Bacteria | 945 |
| 47 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 48 | Ga0070670_100000021 | 3300005331 | Bacteria | 202776 |
| 49 | Ga0070670_100002377 | 3300005331 | Bacteria | 15504 |
| 50 | Ga0070670_100004170 | 3300005331 | Bacteria | 12090 |
| 51 | Ga0070670_100368417 | 3300005331 | Bacteria | 1264 |
| 52 | Ga0070670_100426848 | 3300005331 | Bacteria | 1172 |
| 53 | Ga0070677_10001197 | 3300005333 | Bacteria | 8311 |
| 54 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 55 | Ga0070666_10000184 | 3300005335 | Bacteria | 42807 |
| 56 | Ga0070666_10033483 | 3300005335 | Bacteria | 3400 |
| 57 | Ga0070666_11043600 | 3300005335 | Bacteria | 607 |
| 58 | Ga0070666_11126734 | 3300005335 | Bacteria | 584 |
| 59 | Ga0070682_100178661 | 3300005337 | Bacteria | 1481 |
| 60 | Ga0070660_100000399 | 3300005339 | Bacteria | 28896 |
| 61 | Ga0070660_101735441 | 3300005339 | Bacteria | 532 |
| 62 | Ga0070689_100005020 | 3300005340 | Bacteria | 8993 |
| 63 | Ga0070661_100246068 | 3300005344 | Bacteria | 1378 |
| 64 | Ga0070661_100251887 | 3300005344 | Bacteria | 1363 |
| 65 | Ga0070661_100988057 | 3300005344 | Bacteria | 698 |
| 66 | Ga0070692_10000103 | 3300005345 | Bacteria | 19068 |
| 67 | Ga0070692_10001265 | 3300005345 | Bacteria | 9029 |
| 68 | Ga0070692_10002712 | 3300005345 | Bacteria | 6946 |
| 69 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 70 | Ga0070668_100288829 | 3300005347 | Bacteria | 1372 |
| 71 | Ga0070668_100428915 | 3300005347 | Bacteria | 1133 |
| 72 | Ga0070668_100518306 | 3300005347 | Bacteria | 1034 |
| 73 | Ga0070669_100000008 | 3300005353 | Bacteria | 226764 |
| 74 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 75 | Ga0070669_100000457 | 3300005353 | Bacteria | 31025 |
| 76 | Ga0070669_100093939 | 3300005353 | Bacteria | 2253 |
| 77 | Ga0070669_100123994 | 3300005353 | Bacteria | 1975 |
| 78 | Ga0070669_101376636 | 3300005353 | Bacteria | 612 |
| 79 | Ga0070675_100018970 | 3300005354 | Bacteria | 5479 |
| 80 | Ga0070671_100000015 | 3300005355 | Bacteria | 166132 |
| 81 | Ga0070671_100000470 | 3300005355 | Bacteria | 28105 |
| 82 | Ga0070671_100035948 | 3300005355 | Bacteria | 4105 |
| 83 | Ga0070671_100060705 | 3300005355 | Bacteria | 3148 |
| 84 | Ga0070688_100003653 | 3300005365 | Bacteria | 7942 |
| 85 | Ga0070659_100013894 | 3300005366 | Bacteria | 6008 |
| 86 | Ga0070659_100035203 | 3300005366 | Bacteria | 3899 |
| 87 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 88 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 89 | Ga0070667_100000642 | 3300005367 | Bacteria | 33958 |
| 90 | Ga0070667_100006367 | 3300005367 | Bacteria | 9810 |
| 91 | Ga0070667_100010059 | 3300005367 | Bacteria | 7835 |
| 92 | Ga0070667_100037194 | 3300005367 | Bacteria | 4081 |
| 93 | Ga0070709_10012137 | 3300005434 | Bacteria | 4816 |
| 94 | Ga0070714_100061476 | 3300005435 | Bacteria | 3226 |
| 95 | Ga0070713_100002710 | 3300005436 | Bacteria | 11555 |
| 96 | Ga0070713_100065476 | 3300005436 | Bacteria | 3053 |
| 97 | Ga0070705_100054779 | 3300005440 | Bacteria | 2341 |
| 98 | Ga0070694_101218665 | 3300005444 | Bacteria | 631 |
| 99 | Ga0070708_100198374 | 3300005445 | Bacteria | 1878 |
| 100 | Ga0070663_100075753 | 3300005455 | Bacteria | 2459 |
| 101 | Ga0070663_100129274 | 3300005455 | Bacteria | 1916 |
| 102 | Ga0070663_100588916 | 3300005455 | Bacteria | 934 |
| 103 | Ga0070663_101747653 | 3300005455 | Bacteria | 557 |
| 104 | Ga0070678_100593866 | 3300005456 | Bacteria | 988 |
| 105 | Ga0070678_102081094 | 3300005456 | Bacteria | 537 |
| 106 | Ga0070662_100112452 | 3300005457 | Bacteria | 2076 |
| 107 | Ga0070685_10000724 | 3300005466 | Bacteria | 17961 |
| 108 | Ga0070706_100327632 | 3300005467 | Bacteria | 1428 |
| 109 | Ga0070698_101498001 | 3300005471 | Bacteria | 626 |
| 110 | Ga0070679_100082753 | 3300005530 | Bacteria | 3199 |
| 111 | Ga0070684_100168126 | 3300005535 | Bacteria | 1991 |
| 112 | Ga0070684_100572744 | 3300005535 | Bacteria | 1049 |
| 113 | Ga0070684_101012712 | 3300005535 | Bacteria | 780 |
| 114 | Ga0068853_100003716 | 3300005539 | Bacteria | 11716 |
| 115 | Ga0068853_100021557 | 3300005539 | Bacteria | 5374 |
| 116 | Ga0068853_101121382 | 3300005539 | Bacteria | 759 |
| 117 | Ga0070672_101519879 | 3300005543 | Bacteria | 600 |
| 118 | Ga0070686_100000012 | 3300005544 | Bacteria | 176038 |
| 119 | Ga0070686_100000352 | 3300005544 | Bacteria | 29658 |
| 120 | Ga0070693_101031312 | 3300005547 | Bacteria | 624 |
| 121 | Ga0070693_101227001 | 3300005547 | Bacteria | 577 |
| 122 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 123 | Ga0070665_100000361 | 3300005548 | Bacteria | 67731 |
| 124 | Ga0070665_100001120 | 3300005548 | Bacteria | 32952 |
| 125 | Ga0070665_100378831 | 3300005548 | Bacteria | 1422 |
| 126 | Ga0070665_100736340 | 3300005548 | Bacteria | 999 |
| 127 | Ga0070665_101432299 | 3300005548 | Bacteria | 700 |
| 128 | Ga0068855_100135463 | 3300005563 | Bacteria | 2810 |
| 129 | Ga0068855_100395754 | 3300005563 | Bacteria | 1515 |
| 130 | Ga0068855_100577260 | 3300005563 | Bacteria | 1215 |
| 131 | Ga0070664_100221374 | 3300005564 | Bacteria | 1693 |
| 132 | Ga0070664_100391722 | 3300005564 | Bacteria | 1269 |
| 133 | Ga0070664_102058436 | 3300005564 | Bacteria | 542 |
| 134 | Ga0068857_100021366 | 3300005577 | Bacteria | 5697 |
| 135 | Ga0068857_100089221 | 3300005577 | Bacteria | 2758 |
| 136 | Ga0068854_100075543 | 3300005578 | Bacteria | 2474 |
| 137 | Ga0068854_100178512 | 3300005578 | Bacteria | 1657 |
| 138 | Ga0068854_101175013 | 3300005578 | Bacteria | 686 |
| 139 | Ga0070702_101393985 | 3300005615 | Bacteria | 573 |
| 140 | Ga0068852_100244943 | 3300005616 | Bacteria | 1715 |
| 141 | Ga0068852_101465431 | 3300005616 | Bacteria | 705 |
| 142 | Ga0068859_100003505 | 3300005617 | Bacteria | 15985 |
| 143 | Ga0068859_100023533 | 3300005617 | Bacteria | 6181 |
| 144 | Ga0068859_100028374 | 3300005617 | Bacteria | 5611 |
| 145 | Ga0068859_100042554 | 3300005617 | Bacteria | 4563 |
| 146 | Ga0068859_100216629 | 3300005617 | Bacteria | 2002 |
| 147 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 148 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 149 | Ga0068864_100005620 | 3300005618 | Bacteria | 10277 |
| 150 | Ga0068864_100007081 | 3300005618 | Bacteria | 9208 |
| 151 | Ga0068864_100030140 | 3300005618 | Bacteria | 4598 |
| 152 | Ga0068864_100466728 | 3300005618 | Bacteria | 1210 |
| 153 | Ga0068861_100004980 | 3300005719 | Bacteria | 8951 |
| 154 | Ga0068861_100020681 | 3300005719 | Bacteria | 4718 |
| 155 | Ga0068861_100154977 | 3300005719 | Bacteria | 1883 |
| 156 | Ga0068851_10064379 | 3300005834 | Bacteria | 1884 |
| 157 | Ga0068870_10954518 | 3300005840 | Bacteria | 609 |
| 158 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 159 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 160 | Ga0068863_100002259 | 3300005841 | Bacteria | 19135 |
| 161 | Ga0068863_100067996 | 3300005841 | Bacteria | 3370 |
| 162 | Ga0068858_100010355 | 3300005842 | Bacteria | 8831 |
| 163 | Ga0068858_100034454 | 3300005842 | Bacteria | 4697 |
| 164 | Ga0068858_100053891 | 3300005842 | Bacteria | 3719 |
| 165 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 166 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 167 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 168 | Ga0068860_100001081 | 3300005843 | Bacteria | 30047 |
| 169 | Ga0068860_100048930 | 3300005843 | Bacteria | 4029 |
| 170 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 171 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 172 | Ga0068862_100000169 | 3300005844 | Bacteria | 72633 |
| 173 | Ga0068862_100000209 | 3300005844 | Bacteria | 65440 |
| 174 | Ga0068862_100006085 | 3300005844 | Bacteria | 10046 |
| 175 | Ga0081455_10601736 | 3300005937 | Bacteria | 716 |
| 176 | Ga0081539_10009010 | 3300005985 | Bacteria | 8478 |
| 177 | Ga0075368_10163199 | 3300006042 | Bacteria | 934 |
| 178 | Ga0075363_100000799 | 3300006048 | Bacteria | 10875 |
| 179 | Ga0075364_10033952 | 3300006051 | Bacteria | 3288 |
| 180 | Ga0075432_10006371 | 3300006058 | Bacteria | 4014 |
| 181 | Ga0070712_100064336 | 3300006175 | Bacteria | 2601 |
| 182 | Ga0070712_101976943 | 3300006175 | Bacteria | 511 |
| 183 | Ga0075362_10000003 | 3300006177 | Bacteria | 171099 |
| 184 | Ga0075366_10000006 | 3300006195 | Bacteria | 106522 |
| 185 | Ga0075366_10009002 | 3300006195 | Bacteria | 5569 |
| 186 | Ga0075366_10043167 | 3300006195 | Bacteria | 2671 |
| 187 | Ga0075370_10000008 | 3300006353 | Bacteria | 97966 |
| 188 | Ga0068871_100100936 | 3300006358 | Bacteria | 2418 |
| 189 | Ga0075434_100734299 | 3300006871 | Bacteria | 1004 |
| 190 | Ga0097620_100003505 | 3300006931 | Bacteria | 15985 |
| 191 | Ga0097620_100023532 | 3300006931 | Bacteria | 6181 |
| 192 | Ga0097620_100028372 | 3300006931 | Bacteria | 5611 |
| 193 | Ga0097620_100042555 | 3300006931 | Bacteria | 4563 |
| 194 | Ga0097620_100216626 | 3300006931 | Bacteria | 2002 |
| 195 | Ga0105251_10001284 | 3300009011 | Bacteria | 21706 |
| 196 | Ga0105251_10091930 | 3300009011 | Bacteria | 1393 |
| 197 | Ga0105251_10438344 | 3300009011 | Bacteria | 604 |
| 198 | Ga0105250_10040167 | 3300009092 | Bacteria | 1876 |
| 199 | Ga0105250_10487276 | 3300009092 | Bacteria | 558 |
| 200 | Ga0105240_10015679 | 3300009093 | Bacteria | 10290 |
| 201 | Ga0105240_10025126 | 3300009093 | Bacteria | 7835 |
| 202 | Ga0105247_10144469 | 3300009101 | Bacteria | 1562 |
| 203 | Ga0105243_10889364 | 3300009148 | Bacteria | 885 |
| 204 | Ga0105243_10942050 | 3300009148 | Bacteria | 862 |
| 205 | Ga0105243_11745006 | 3300009148 | Bacteria | 652 |
| 206 | Ga0105241_10387501 | 3300009174 | Bacteria | 1223 |
| 207 | Ga0105241_10707420 | 3300009174 | Bacteria | 920 |
| 208 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 209 | Ga0105248_10001558 | 3300009177 | Bacteria | 25511 |
| 210 | Ga0105248_10006373 | 3300009177 | Bacteria | 12948 |
| 211 | Ga0105248_10008696 | 3300009177 | Bacteria | 11156 |
| 212 | Ga0105248_10059949 | 3300009177 | Bacteria | 4274 |
| 213 | Ga0105248_10103436 | 3300009177 | Bacteria | 3210 |
| 214 | Ga0105248_11064157 | 3300009177 | Bacteria | 914 |
| 215 | Ga0105237_10044206 | 3300009545 | Bacteria | 4485 |
| 216 | Ga0105237_10048537 | 3300009545 | Bacteria | 4268 |
| 217 | Ga0105238_10102613 | 3300009551 | Bacteria | 2842 |
| 218 | Ga0105238_10125483 | 3300009551 | Bacteria | 2546 |
| 219 | Ga0105238_10972391 | 3300009551 | Bacteria | 869 |
| 220 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 221 | Ga0105249_10000041 | 3300009553 | Bacteria | 195999 |
| 222 | Ga0105249_10019753 | 3300009553 | Bacteria | 6016 |
| 223 | Ga0105249_11819029 | 3300009553 | Bacteria | 682 |
| 224 | Ga0105148_100540 | 3300009978 | Bacteria | 3258 |
| 225 | Ga0105147_110624 | 3300009982 | Bacteria | 781 |
| 226 | Ga0105239_10000367 | 3300010375 | Bacteria | 66191 |
| 227 | Ga0105239_10326543 | 3300010375 | Bacteria | 1730 |
| 228 | Ga0157373_10087299 | 3300013100 | Bacteria | 2198 |
| 229 | Ga0157373_10374068 | 3300013100 | Bacteria | 1018 |
| 230 | Ga0157373_10428844 | 3300013100 | Bacteria | 950 |
| 231 | Ga0157371_11547738 | 3300013102 | Bacteria | 518 |
| 232 | Ga0157370_10062515 | 3300013104 | Bacteria | 3530 |
| 233 | Ga0157369_10138988 | 3300013105 | Bacteria | 2571 |
| 234 | Ga0157369_10921210 | 3300013105 | Bacteria | 896 |
| 235 | Ga0157374_11882304 | 3300013296 | Bacteria | 624 |
| 236 | Ga0157378_10501215 | 3300013297 | Bacteria | 1213 |
| 237 | Ga0163162_10008623 | 3300013306 | Bacteria | 9934 |
| 238 | Ga0163162_10019579 | 3300013306 | Bacteria | 6643 |
| 239 | Ga0157372_10452741 | 3300013307 | Bacteria | 1496 |
| 240 | Ga0157372_10679552 | 3300013307 | Bacteria | 1198 |
| 241 | Ga0157372_11150177 | 3300013307 | Bacteria | 897 |
| 242 | Ga0163163_10030114 | 3300014325 | Bacteria | 5225 |
| 243 | Ga0163163_10071955 | 3300014325 | Bacteria | 3446 |
| 244 | Ga0163163_11267920 | 3300014325 | Bacteria | 799 |
| 245 | Ga0157380_10000029 | 3300014326 | Bacteria | 98248 |
| 246 | Ga0157380_10000182 | 3300014326 | Bacteria | 36263 |
| 247 | Ga0157380_10001161 | 3300014326 | Bacteria | 17056 |
| 248 | Ga0157380_10058444 | 3300014326 | Bacteria | 3074 |
| 249 | Ga0157380_10340692 | 3300014326 | Bacteria | 1398 |
| 250 | Ga0157380_10808594 | 3300014326 | Bacteria | 955 |
| 251 | Ga0157380_13380793 | 3300014326 | Bacteria | 510 |
| 252 | Ga0157379_10049804 | 3300014968 | Bacteria | 3740 |
| 253 | Ga0157379_10051644 | 3300014968 | Bacteria | 3672 |
| 254 | Ga0157379_10128162 | 3300014968 | Bacteria | 2283 |
| 255 | Ga0157376_12284786 | 3300014969 | Bacteria | 580 |
| 256 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 257 | Ga0163161_10000101 | 3300017792 | Bacteria | 81604 |
| 258 | Ga0163161_10867138 | 3300017792 | Bacteria | 763 |
| 259 | Ga0163161_10901068 | 3300017792 | Bacteria | 749 |
| 260 | Ga0197907_10257285 | 3300020069 | Bacteria | 567 |
| 261 | Ga0213875_10009905 | 3300021388 | Bacteria | 4804 |
| 262 | Ga0207672_1000641 | 3300025223 | Bacteria | 4088 |
| 263 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 264 | Ga0207425_1015629 | 3300025245 | Bacteria | 1699 |
| 265 | Ga0209129_1002094 | 3300025258 | Bacteria | 10228 |
| 266 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 267 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 268 | Ga0209673_1002352 | 3300025273 | Bacteria | 13340 |
| 269 | Ga0209673_1029162 | 3300025273 | Bacteria | 1761 |
| 270 | Ga0209675_1009250 | 3300025291 | Bacteria | 3499 |
| 271 | Ga0209676_1026408 | 3300025292 | Bacteria | 1844 |
| 272 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 273 | Ga0209564_1013725 | 3300025295 | Bacteria | 3416 |
| 274 | Ga0209564_1015447 | 3300025295 | Bacteria | 3103 |
| 275 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 276 | Ga0209758_1012697 | 3300025297 | Bacteria | 4679 |
| 277 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 278 | Ga0209050_1000581 | 3300025298 | Bacteria | 59224 |
| 279 | Ga0209050_1007158 | 3300025298 | Bacteria | 6354 |
| 280 | Ga0209050_1014306 | 3300025298 | Bacteria | 3430 |
| 281 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 282 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 283 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 284 | Ga0209051_1102885 | 3300025303 | Bacteria | 764 |
| 285 | Ga0209257_1000876 | 3300025304 | Bacteria | 42634 |
| 286 | Ga0209257_1002353 | 3300025304 | Bacteria | 19010 |
| 287 | Ga0209257_1002898 | 3300025304 | Bacteria | 15899 |
| 288 | Ga0209257_1003401 | 3300025304 | Bacteria | 13704 |
| 289 | Ga0209257_1090367 | 3300025304 | Bacteria | 766 |
| 290 | Ga0207697_10006525 | 3300025315 | Bacteria | 5267 |
| 291 | Ga0207697_10046997 | 3300025315 | Bacteria | 1779 |
| 292 | Ga0207656_10012218 | 3300025321 | Bacteria | 3260 |
| 293 | Ga0207713_1001586 | 3300025735 | Bacteria | 17804 |
| 294 | Ga0207682_10004224 | 3300025893 | Bacteria | 6067 |
| 295 | Ga0207710_10007240 | 3300025900 | Bacteria | 4701 |
| 296 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 297 | Ga0207680_10000186 | 3300025903 | Bacteria | 30147 |
| 298 | Ga0207647_10000038 | 3300025904 | Bacteria | 94897 |
| 299 | Ga0207647_10650728 | 3300025904 | Bacteria | 578 |
| 300 | Ga0207699_10020459 | 3300025906 | Bacteria | 3548 |
| 301 | Ga0207705_10016944 | 3300025909 | Bacteria | 5219 |
| 302 | Ga0207705_10135124 | 3300025909 | Bacteria | 1838 |
| 303 | Ga0207684_10707388 | 3300025910 | Bacteria | 856 |
| 304 | Ga0207654_10000375 | 3300025911 | Bacteria | 25999 |
| 305 | Ga0207695_10001183 | 3300025913 | Bacteria | 45024 |
| 306 | Ga0207695_10016421 | 3300025913 | Bacteria | 8662 |
| 307 | Ga0207695_10021724 | 3300025913 | Bacteria | 7315 |
| 308 | Ga0207671_10001192 | 3300025914 | Bacteria | 30866 |
| 309 | Ga0207671_10027639 | 3300025914 | Bacteria | 4241 |
| 310 | Ga0207693_10032011 | 3300025915 | Bacteria | 4154 |
| 311 | Ga0207657_10387615 | 3300025919 | Bacteria | 1100 |
| 312 | Ga0207649_10150506 | 3300025920 | Bacteria | 1602 |
| 313 | Ga0207649_10848417 | 3300025920 | Bacteria | 715 |
| 314 | Ga0207649_10899162 | 3300025920 | Bacteria | 694 |
| 315 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 316 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 317 | Ga0207681_10000183 | 3300025923 | Bacteria | 51105 |
| 318 | Ga0207681_10716631 | 3300025923 | Bacteria | 832 |
| 319 | Ga0207694_10002087 | 3300025924 | Bacteria | 16502 |
| 320 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 321 | Ga0207650_10000083 | 3300025925 | Bacteria | 127270 |
| 322 | Ga0207650_10002904 | 3300025925 | Bacteria | 11832 |
| 323 | Ga0207650_10006404 | 3300025925 | Bacteria | 8018 |
| 324 | Ga0207700_10133944 | 3300025928 | Bacteria | 2027 |
| 325 | Ga0207700_10911749 | 3300025928 | Bacteria | 786 |
| 326 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 327 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 328 | Ga0207644_10001857 | 3300025931 | Bacteria | 13746 |
| 329 | Ga0207644_10112905 | 3300025931 | Bacteria | 2057 |
| 330 | Ga0207706_10015340 | 3300025933 | Bacteria | 6923 |
| 331 | Ga0207706_10138164 | 3300025933 | Bacteria | 2144 |
| 332 | Ga0207709_11112615 | 3300025935 | Bacteria | 649 |
| 333 | Ga0207670_10083992 | 3300025936 | Bacteria | 2235 |
| 334 | Ga0207665_10021665 | 3300025939 | Bacteria | 4227 |
| 335 | Ga0207691_10044352 | 3300025940 | Bacteria | 4094 |
| 336 | Ga0207691_10788796 | 3300025940 | Bacteria | 799 |
| 337 | Ga0207691_11030603 | 3300025940 | Bacteria | 686 |
| 338 | Ga0207691_11267125 | 3300025940 | Bacteria | 610 |
| 339 | Ga0207711_10000035 | 3300025941 | Bacteria | 177223 |
| 340 | Ga0207711_10000075 | 3300025941 | Bacteria | 106870 |
| 341 | Ga0207711_10006118 | 3300025941 | Bacteria | 10166 |
| 342 | Ga0207711_10024088 | 3300025941 | Bacteria | 5096 |
| 343 | Ga0207711_10153268 | 3300025941 | Bacteria | 2081 |
| 344 | Ga0207711_10663848 | 3300025941 | Bacteria | 973 |
| 345 | Ga0207711_11345137 | 3300025941 | Bacteria | 657 |
| 346 | Ga0207661_10482382 | 3300025944 | Bacteria | 1132 |
| 347 | Ga0207679_10123611 | 3300025945 | Bacteria | 2064 |
| 348 | Ga0207679_10597498 | 3300025945 | Bacteria | 994 |
| 349 | Ga0207679_11325829 | 3300025945 | Bacteria | 660 |
| 350 | Ga0207667_10011748 | 3300025949 | Bacteria | 10154 |
| 351 | Ga0207667_10498960 | 3300025949 | Bacteria | 1235 |
| 352 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 353 | Ga0207712_10000620 | 3300025961 | Bacteria | 28034 |
| 354 | Ga0207712_10018137 | 3300025961 | Bacteria | 4580 |
| 355 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 356 | Ga0207668_10005340 | 3300025972 | Bacteria | 7558 |
| 357 | Ga0207668_10085277 | 3300025972 | Bacteria | 2304 |
| 358 | Ga0207640_10031448 | 3300025981 | Bacteria | 3280 |
| 359 | Ga0207640_10062003 | 3300025981 | Bacteria | 2479 |
| 360 | Ga0207640_11683279 | 3300025981 | Bacteria | 572 |
| 361 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 362 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 363 | Ga0207658_10000388 | 3300025986 | Bacteria | 42759 |
| 364 | Ga0207658_10004095 | 3300025986 | Bacteria | 10169 |
| 365 | Ga0207658_10008782 | 3300025986 | Bacteria | 6860 |
| 366 | Ga0207658_10018656 | 3300025986 | Bacteria | 4795 |
| 367 | Ga0207703_10005351 | 3300026035 | Bacteria | 10337 |
| 368 | Ga0207703_10008030 | 3300026035 | Bacteria | 8339 |
| 369 | Ga0207703_10009134 | 3300026035 | Bacteria | 7806 |
| 370 | Ga0207703_12031310 | 3300026035 | Bacteria | 551 |
| 371 | Ga0207639_10187001 | 3300026041 | Bacteria | 1766 |
| 372 | Ga0207639_10312608 | 3300026041 | Bacteria | 1392 |
| 373 | Ga0207639_10602963 | 3300026041 | Bacteria | 1013 |
| 374 | Ga0207639_11412677 | 3300026041 | Bacteria | 653 |
| 375 | Ga0207678_10034203 | 3300026067 | Bacteria | 4426 |
| 376 | Ga0207678_10088208 | 3300026067 | Bacteria | 2651 |
| 377 | Ga0207678_10889898 | 3300026067 | Bacteria | 787 |
| 378 | Ga0207678_11627230 | 3300026067 | Bacteria | 568 |
| 379 | Ga0207708_10468159 | 3300026075 | Bacteria | 1052 |
| 380 | Ga0207702_10000887 | 3300026078 | Bacteria | 31141 |
| 381 | Ga0207702_11265379 | 3300026078 | Bacteria | 732 |
| 382 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 383 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 384 | Ga0207641_10003319 | 3300026088 | Bacteria | 14317 |
| 385 | Ga0207641_10004490 | 3300026088 | Bacteria | 12070 |
| 386 | Ga0207641_10004505 | 3300026088 | Bacteria | 12048 |
| 387 | Ga0207641_10013693 | 3300026088 | Bacteria | 6656 |
| 388 | Ga0207641_10014410 | 3300026088 | Bacteria | 6478 |
| 389 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 390 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 391 | Ga0207676_10000770 | 3300026095 | Bacteria | 25065 |
| 392 | Ga0207676_10022559 | 3300026095 | Bacteria | 4630 |
| 393 | Ga0207676_10041840 | 3300026095 | Bacteria | 3520 |
| 394 | Ga0207676_11532792 | 3300026095 | Bacteria | 664 |
| 395 | Ga0207674_10016903 | 3300026116 | Bacteria | 7971 |
| 396 | Ga0207674_10131652 | 3300026116 | Bacteria | 2464 |
| 397 | Ga0207674_10202281 | 3300026116 | Bacteria | 1935 |
| 398 | Ga0207674_12258894 | 3300026116 | Bacteria | 506 |
| 399 | Ga0207675_100000358 | 3300026118 | Bacteria | 43765 |
| 400 | Ga0207675_100001138 | 3300026118 | Bacteria | 26336 |
| 401 | Ga0207675_100001918 | 3300026118 | Bacteria | 20742 |
| 402 | Ga0207675_100230090 | 3300026118 | Bacteria | 1788 |
| 403 | Ga0207683_11981229 | 3300026121 | Bacteria | 531 |
| 404 | Ga0207698_10084139 | 3300026142 | Bacteria | 2578 |
| 405 | Ga0207698_10130218 | 3300026142 | Bacteria | 2148 |
| 406 | Ga0207698_10353465 | 3300026142 | Bacteria | 1389 |
| 407 | Ga0209813_10029105 | 3300027866 | Bacteria | 1615 |
| 408 | Ga0209974_10023499 | 3300027876 | Bacteria | 2040 |
| 409 | Ga0209974_10465763 | 3300027876 | Bacteria | 503 |
| 410 | Ga0207428_10045887 | 3300027907 | Bacteria | 3516 |
| 411 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 412 | Ga0268266_10000181 | 3300028379 | Bacteria | 112266 |
| 413 | Ga0268266_10211526 | 3300028379 | Bacteria | 1779 |
| 414 | Ga0268266_10315170 | 3300028379 | Bacteria | 1462 |
| 415 | Ga0268266_10850351 | 3300028379 | Bacteria | 882 |
| 416 | Ga0268266_11019591 | 3300028379 | Bacteria | 801 |
| 417 | Ga0268266_11068863 | 3300028379 | Bacteria | 781 |
| 418 | Ga0268266_11514040 | 3300028379 | Bacteria | 646 |
| 419 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 420 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 421 | Ga0268265_10000047 | 3300028380 | Bacteria | 179354 |
| 422 | Ga0268265_10000285 | 3300028380 | Bacteria | 57084 |
| 423 | Ga0268265_10004726 | 3300028380 | Bacteria | 9397 |
| 424 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 425 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 426 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 427 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 428 | Ga0268264_10030665 | 3300028381 | Bacteria | 4408 |
| 429 | Ga0307517_10024293 | 3300028786 | Bacteria | 7480 |
| 430 | Ga0316177_1082224 | 3300030731 | Bacteria | 1786 |
| 431 | Ga0314311_1203820 | 3300030733 | Bacteria | 1025 |
| 432 | Ga0307513_10522361 | 3300031456 | Bacteria | 902 |
| 433 | Ga0307408_100388134 | 3300031548 | Bacteria | 1195 |
| 434 | Ga0307408_100471441 | 3300031548 | Bacteria | 1093 |
| 435 | Ga0307408_100545382 | 3300031548 | Bacteria | 1022 |
| 436 | Ga0307408_101212836 | 3300031548 | Bacteria | 704 |
| 437 | Ga0307405_10165710 | 3300031731 | Bacteria | 1570 |
| 438 | Ga0307405_10408947 | 3300031731 | Bacteria | 1064 |
| 439 | Ga0307405_10442013 | 3300031731 | Bacteria | 1029 |
| 440 | Ga0307405_10530365 | 3300031731 | Bacteria | 949 |
| 441 | Ga0307405_11134964 | 3300031731 | Bacteria | 673 |
| 442 | Ga0307405_11173503 | 3300031731 | Bacteria | 663 |
| 443 | Ga0307405_11796864 | 3300031731 | Bacteria | 545 |
| 444 | Ga0307405_11848273 | 3300031731 | Bacteria | 538 |
| 445 | Ga0307413_10121532 | 3300031824 | Bacteria | 1770 |
| 446 | Ga0307413_10229023 | 3300031824 | Bacteria | 1363 |
| 447 | Ga0307413_10236039 | 3300031824 | Bacteria | 1346 |
| 448 | Ga0307413_11727913 | 3300031824 | Bacteria | 558 |
| 449 | Ga0307413_11858545 | 3300031824 | Bacteria | 540 |
| 450 | Ga0307410_10192558 | 3300031852 | Bacteria | 1551 |
| 451 | Ga0307410_10584196 | 3300031852 | Bacteria | 930 |
| 452 | Ga0307406_10069949 | 3300031901 | Bacteria | 2296 |
| 453 | Ga0307406_10071868 | 3300031901 | Bacteria | 2269 |
| 454 | Ga0307406_10114532 | 3300031901 | Bacteria | 1862 |
| 455 | Ga0307406_10132306 | 3300031901 | Bacteria | 1753 |
| 456 | Ga0307406_10683111 | 3300031901 | Bacteria | 855 |
| 457 | Ga0307406_11068797 | 3300031901 | Bacteria | 695 |
| 458 | Ga0307407_10069618 | 3300031903 | Bacteria | 2089 |
| 459 | Ga0307407_10202036 | 3300031903 | Bacteria | 1332 |
| 460 | Ga0307407_11185019 | 3300031903 | Bacteria | 596 |
| 461 | Ga0307412_10075035 | 3300031911 | Bacteria | 2318 |
| 462 | Ga0307412_10257505 | 3300031911 | Bacteria | 1358 |
| 463 | Ga0307412_10337741 | 3300031911 | Bacteria | 1204 |
| 464 | Ga0307412_11563801 | 3300031911 | Bacteria | 601 |
| 465 | Ga0307409_100074131 | 3300031995 | Bacteria | 2718 |
| 466 | Ga0307409_100549682 | 3300031995 | Bacteria | 1133 |
| 467 | Ga0307409_101773022 | 3300031995 | Bacteria | 646 |
| 468 | Ga0307409_102542064 | 3300031995 | Bacteria | 541 |
| 469 | Ga0307416_100152722 | 3300032002 | Bacteria | 2120 |
| 470 | Ga0307416_100206250 | 3300032002 | Bacteria | 1870 |
| 471 | Ga0307416_100476826 | 3300032002 | Bacteria | 1307 |
| 472 | Ga0307416_101096960 | 3300032002 | Bacteria | 900 |
| 473 | Ga0307416_101827298 | 3300032002 | Bacteria | 711 |
| 474 | Ga0307414_10085486 | 3300032004 | Bacteria | 2324 |
| 475 | Ga0307414_10139371 | 3300032004 | Bacteria | 1896 |
| 476 | Ga0307414_10154867 | 3300032004 | Bacteria | 1812 |
| 477 | Ga0307414_10392121 | 3300032004 | Bacteria | 1203 |
| 478 | Ga0307414_10450820 | 3300032004 | Bacteria | 1128 |
| 479 | Ga0307411_10122243 | 3300032005 | Bacteria | 1886 |
| 480 | Ga0307411_10589128 | 3300032005 | Bacteria | 954 |
| 481 | Ga0307411_10830711 | 3300032005 | Bacteria | 816 |
| 482 | Ga0307411_11176066 | 3300032005 | Bacteria | 694 |
| 483 | Ga0307411_11715192 | 3300032005 | Bacteria | 582 |
| 484 | Ga0307411_12013200 | 3300032005 | Bacteria | 539 |
| 485 | Ga0307415_100134218 | 3300032126 | Bacteria | 1879 |
| 486 | Ga0307415_100438347 | 3300032126 | Bacteria | 1126 |
| 487 | Ga0307415_100496024 | 3300032126 | Bacteria | 1066 |
| 488 | Ga0307415_101294198 | 3300032126 | Bacteria | 690 |
| 489 | Ga0307415_101420031 | 3300032126 | Bacteria | 661 |
| 490 | Ga0307415_101828714 | 3300032126 | Bacteria | 588 |
| 491 | Ga0373959_0167015 | 3300034820 | Bacteria | 565 |
| 492 | Ga0373938_0176853 | 3300034957 | Bacteria | 581 |
| 493 | Ga0373932_0031572 | 3300035112 | Bacteria | 1477 |
| 494 | Ga0373935_0012992 | 3300035692 | Bacteria | 5019 |
| 495 | Ga0373937_0267550 | 3300036401 | Bacteria | 1613 |
| 496 | Ga0395899_0021279 | 3300037312 | Bacteria | 4920 |
| 497 | Ga0395899_0077621 | 3300037312 | Bacteria | 2422 |
| 498 | Ga0395900_0028261 | 3300037418 | Bacteria | 5745 |
| 499 | Ga0395900_0063619 | 3300037418 | Bacteria | 3792 |
| 500 | Ga0395898_0038273 | 3300037466 | Bacteria | 4755 |
| 501 | Ga0395898_0121043 | 3300037466 | Bacteria | 2507 |
| 502 | Ga0395898_1714884 | 3300037466 | Bacteria | 551 |
| 503 | Ga0395905_0008374 | 3300037471 | Bacteria | 10198 |
| 504 | Ga0395905_0013966 | 3300037471 | Bacteria | 7681 |
| 505 | Ga0395905_1534650 | 3300037471 | Bacteria | 571 |
| 506 | Ga0436364_0741438 | 3300037853 | Bacteria | 779 |
| 507 | Ga0436364_0878110 | 3300037853 | Bacteria | 2836 |
| 508 | Ga0395901_0014058 | 3300038443 | Bacteria | 8148 |
| 509 | Ga0395901_0014440 | 3300038443 | Bacteria | 8037 |
| 510 | Ga0436365_0600332 | 3300039437 | Bacteria | 1176 |
| 511 | Ga0436365_0922307 | 3300039437 | Bacteria | 725 |
| 512 | Ga0436363_0674844 | 3300039450 | Bacteria | 1010 |
| 513 | Ga0436363_1090589 | 3300039450 | Bacteria | 1112 |
| 514 | Ga0439436_0045695 | 3300041404 | Bacteria | 1245 |
| 515 | Ga0439439_0001779 | 3300041406 | Bacteria | 4402 |
| 516 | Ga0439439_0134264 | 3300041406 | Bacteria | 696 |
| 517 | Ga0439461_0000498 | 3300041410 | Bacteria | 5666 |
| 518 | Ga0439461_0080904 | 3300041410 | Bacteria | 766 |
| 519 | Ga0439465_0004274 | 3300041413 | Bacteria | 4644 |
| 520 | Ga0451793_1471615 | 3300041452 | Bacteria | 821 |
| 521 | Ga0451807_1087972 | 3300041486 | Bacteria | 668 |
| 522 | Ga0439431_0000140 | 3300041997 | Bacteria | 13006 |
| 523 | Ga0439431_0010888 | 3300041997 | Bacteria | 2071 |
| 524 | Ga0439437_027949 | 3300042000 | Bacteria | 701 |
| 525 | Ga0439442_013335 | 3300042002 | Bacteria | 1685 |
| 526 | Ga0439445_0033115 | 3300042004 | Bacteria | 1349 |
| 527 | Ga0439445_0142362 | 3300042004 | Bacteria | 695 |
| 528 | Ga0439432_000640 | 3300042006 | Bacteria | 13098 |
| 529 | Ga0439452_018803 | 3300042010 | Bacteria | 1835 |
| 530 | Ga0439462_0002776 | 3300042015 | Bacteria | 4116 |
| 531 | Ga0439463_166786 | 3300042016 | Bacteria | 571 |
| 532 | Ga0439434_0006562 | 3300042435 | Bacteria | 3398 |
| 533 | Ga0466969_0268548 | 3300044656 | Bacteria | 773 |
| 534 | Ga0466972_0046260 | 3300044658 | Bacteria | 2107 |
| 535 | Ga0466965_0017759 | 3300044683 | Bacteria | 3403 |
| 536 | Ga0466966_0052557 | 3300044684 | Bacteria | 2587 |
| 537 | Ga0466966_0167157 | 3300044684 | Bacteria | 1337 |
| 538 | Ga0466961_0029638 | 3300044693 | Bacteria | 3516 |
| 539 | Ga0466963_0499988 | 3300044694 | Bacteria | 858 |
| 540 | Ga0466964_0002736 | 3300044706 | Bacteria | 6330 |
| 541 | Ga0466971_0012785 | 3300044719 | Bacteria | 3680 |
| 542 | Ga0466968_0002823 | 3300044735 | Bacteria | 6421 |
| 543 | Ga0466968_0038917 | 3300044735 | Bacteria | 1999 |
| 544 | Ga0466970_0069617 | 3300044765 | Bacteria | 1891 |
| 545 | Ga0466970_0632016 | 3300044765 | Bacteria | 622 |
| 546 | Ga0466957_0066943 | 3300044842 | Bacteria | 2215 |
| 547 | Ga0466959_0145104 | 3300045049 | Bacteria | 1675 |
| 548 | Ga0466959_0181311 | 3300045049 | Bacteria | 1472 |
| 549 | Ga0466959_0349939 | 3300045049 | Bacteria | 1007 |
| 550 | Ga0466958_0007699 | 3300045836 | Bacteria | 5940 |
| 551 | Ga0466958_0025958 | 3300045836 | Bacteria | 3458 |
| 552 | Ga0466958_0383841 | 3300045836 | Bacteria | 906 |
| 553 | Ga0466967_0089604 | 3300045976 | Bacteria | 2793 |
| 554 | Ga0466967_2588529 | 3300045976 | Bacteria | 502 |
| 555 | Ga0495596_0388920 | 3300046500 | Bacteria | 543 |
| 556 | Ga0495616_0001456 | 3300046513 | Bacteria | 16481 |
| 557 | Ga0495632_0253925 | 3300046519 | Bacteria | 788 |
| 558 | Ga0495632_0317276 | 3300046519 | Bacteria | 689 |
| 559 | Ga0495643_0460184 | 3300046522 | Bacteria | 552 |
| 560 | Ga0495648_0042423 | 3300046524 | Bacteria | 2862 |
| 561 | Ga0495663_0044618 | 3300046525 | Bacteria | 1357 |
| 562 | Ga0495642_0032976 | 3300046528 | Bacteria | 2081 |
| 563 | Ga0495654_0001073 | 3300046530 | Bacteria | 19918 |
| 564 | Ga0495654_0020158 | 3300046530 | Bacteria | 3478 |
| 565 | Ga0495654_0116202 | 3300046530 | Bacteria | 1215 |
| 566 | Ga0495597_0031259 | 3300046542 | Bacteria | 2424 |
| 567 | Ga0495668_0002221 | 3300046616 | Bacteria | 16492 |
| 568 | Ga0495668_0011998 | 3300046616 | Bacteria | 5159 |
| 569 | Ga0495625_0598070 | 3300046660 | Bacteria | 662 |
| 570 | Ga0495589_0067756 | 3300046794 | Bacteria | 1747 |
| 571 | Ga0495686_0001246 | 3300047472 | Bacteria | 29040 |
| 572 | Ga0496100_0027383 | 3300048903 | Bacteria | 3505 |
| 573 | Ga0496100_0652598 | 3300048903 | Bacteria | 819 |
| 574 | Ga0496101_0016587 | 3300048904 | Bacteria | 4980 |
| 575 | Ga0496101_0346342 | 3300048904 | Bacteria | 1167 |
| 576 | Ga0496102_0000069 | 3300048905 | Bacteria | 156067 |
| 577 | Ga0496102_0172254 | 3300048905 | Bacteria | 2037 |
| 578 | Ga0496102_0681373 | 3300048905 | Bacteria | 951 |
| 579 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 580 | Ga0496103_0030066 | 3300048906 | Bacteria | 3304 |
| 581 | Ga0496103_0033025 | 3300048906 | Bacteria | 3160 |
| 582 | Ga0496103_0224202 | 3300048906 | Bacteria | 1209 |
| 583 | Ga0496103_0233437 | 3300048906 | Bacteria | 1183 |
| 584 | Ga0496104_0059792 | 3300048907 | Bacteria | 3608 |
| 585 | Ga0496105_1191995 | 3300048908 | Bacteria | 561 |
| 586 | Ga0496106_0042063 | 3300048909 | Bacteria | 3426 |
| 587 | Ga0496106_0076352 | 3300048909 | Bacteria | 2568 |
| 588 | Ga0496107_0044142 | 3300048910 | Bacteria | 3204 |
| 589 | Ga0496107_0173558 | 3300048910 | Bacteria | 1600 |
| 590 | Ga0496107_0252341 | 3300048910 | Bacteria | 1312 |
| 591 | Ga0496107_1217068 | 3300048910 | Bacteria | 541 |
| 592 | Ga0496113_0519615 | 3300048916 | Bacteria | 956 |
| 593 | Ga0496114_0059906 | 3300048917 | Bacteria | 3181 |
| 594 | Ga0496115_0001129 | 3300048918 | Bacteria | 19266 |
| 595 | Ga0496115_0074035 | 3300048918 | Bacteria | 2765 |
| 596 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 597 | Ga0496116_0032138 | 3300048919 | Bacteria | 3745 |
| 598 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 599 | Ga0496117_0018342 | 3300048920 | Bacteria | 5800 |
| 600 | Ga0496117_0089533 | 3300048920 | Bacteria | 1987 |
| 601 | Ga0496117_0231937 | 3300048920 | Bacteria | 1019 |
| 602 | Ga0496117_0251385 | 3300048920 | Bacteria | 964 |
| 603 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 604 | Ga0496118_0000463 | 3300048921 | Bacteria | 67382 |
| 605 | Ga0496118_0015970 | 3300048921 | Bacteria | 6916 |
| 606 | Ga0496118_0079363 | 3300048921 | Bacteria | 2316 |
| 607 | Ga0496118_0139050 | 3300048921 | Bacteria | 1544 |
| 608 | Ga0496119_0038129 | 3300048922 | Bacteria | 3111 |
| 609 | Ga0496119_0072971 | 3300048922 | Bacteria | 2003 |
| 610 | Ga0496120_0110614 | 3300048923 | Bacteria | 1436 |
| 611 | Ga0496120_0178484 | 3300048923 | Bacteria | 1045 |
| 612 | Ga0496121_0010499 | 3300048924 | Bacteria | 10435 |
| 613 | Ga0496121_0016723 | 3300048924 | Bacteria | 7548 |
| 614 | Ga0496121_0058069 | 3300048924 | Bacteria | 3202 |
| 615 | Ga0496121_0295366 | 3300048924 | Bacteria | 1102 |
| 616 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 617 | Ga0496124_0081473 | 3300048927 | Bacteria | 2660 |
| 618 | Ga0496125_0286884 | 3300048928 | Bacteria | 1016 |
| 619 | Ga0496126_0016996 | 3300048929 | Bacteria | 7259 |
| 620 | Ga0496126_0150910 | 3300048929 | Bacteria | 1992 |
| 621 | Ga0501306_009105 | 3300049127 | Bacteria | 1225 |
| 622 | Ga0501305_021695 | 3300049161 | Bacteria | 951 |
| 623 | Ga0501307_005380 | 3300049162 | Bacteria | 1348 |
| 624 | Ga0501290_000237 | 3300049513 | Bacteria | 9135 |
| 625 | Ga0501292_000042 | 3300049515 | Bacteria | 29474 |
| 626 | Ga0501293_008149 | 3300049516 | Bacteria | 877 |
| 627 | Ga0501293_018406 | 3300049516 | Bacteria | 666 |
| 628 | Ga0501294_000032 | 3300049517 | Bacteria | 13769 |
| 629 | Ga0501297_009582 | 3300049520 | Bacteria | 1085 |
| 630 | Ga0501298_063023 | 3300049521 | Bacteria | 789 |
| 631 | Ga0501300_000392 | 3300049523 | Bacteria | 6689 |
| 632 | Ga0501311_027272 | 3300049527 | Bacteria | 810 |
| 633 | Ga0501312_025302 | 3300049528 | Bacteria | 904 |
| 634 | Ga0501313_020213 | 3300049529 | Bacteria | 819 |
| 635 | Ga0501315_000962 | 3300049531 | Bacteria | 2273 |
| 636 | Ga0501315_046231 | 3300049531 | Bacteria | 672 |
| 637 | Ga0501317_002915 | 3300049533 | Bacteria | 1662 |
| 638 | Ga0501320_006506 | 3300049536 | Bacteria | 1097 |
| 639 | Ga0501335_013930 | 3300049551 | Bacteria | 808 |
| 640 | Ga0501335_029598 | 3300049551 | Bacteria | 615 |
| 641 | Ga0501032_0113352 | 3300049569 | Bacteria | 1793 |
| 642 | Ga0501039_1595636 | 3300049575 | Bacteria | 501 |
| 643 | Ga0501042_0260954 | 3300049578 | Bacteria | 1251 |
| 644 | Ga0501043_0049166 | 3300049579 | Bacteria | 3315 |
| 645 | Ga0501043_0113159 | 3300049579 | Bacteria | 2131 |
| 646 | Ga0501046_0030454 | 3300049580 | Bacteria | 4380 |
| 647 | Ga0501047_0000731 | 3300049581 | Bacteria | 34159 |
| 648 | Ga0501047_0450251 | 3300049581 | Bacteria | 1117 |
| 649 | Ga0501047_0885518 | 3300049581 | Bacteria | 706 |
| 650 | Ga0501201_046218 | 3300049651 | Bacteria | 534 |
| 651 | Ga0501202_063125 | 3300049652 | Bacteria | 841 |
| 652 | Ga0501206_008325 | 3300049653 | Bacteria | 1369 |
| 653 | Ga0501207_021740 | 3300049654 | Bacteria | 1032 |
| 654 | Ga0501222_001746 | 3300049662 | Bacteria | 3014 |
| 655 | Ga0501223_004016 | 3300049663 | Bacteria | 3169 |
| 656 | Ga0501223_039106 | 3300049663 | Bacteria | 921 |
| 657 | Ga0501224_000754 | 3300049664 | Bacteria | 4084 |
| 658 | Ga0501224_044230 | 3300049664 | Bacteria | 676 |
| 659 | Ga0501227_028030 | 3300049665 | Bacteria | 1336 |
| 660 | Ga0501233_012436 | 3300049668 | Bacteria | 1708 |
| 661 | Ga0501235_001097 | 3300049669 | Bacteria | 5663 |
| 662 | Ga0501236_053975 | 3300049670 | Bacteria | 697 |
| 663 | Ga0501249_000213 | 3300049679 | Bacteria | 17777 |
| 664 | Ga0501249_102848 | 3300049679 | Bacteria | 685 |
| 665 | Ga0501257_000049 | 3300049686 | Bacteria | 33138 |
| 666 | Ga0501257_013441 | 3300049686 | Bacteria | 1877 |
| 667 | Ga0501259_001391 | 3300049688 | Bacteria | 4043 |
| 668 | Ga0501261_000021 | 3300049690 | Bacteria | 37511 |
| 669 | Ga0501221_003846 | 3300049704 | Bacteria | 2478 |
| 670 | Ga0501221_259218 | 3300049704 | Bacteria | 502 |
| 671 | Ga0501225_0006973 | 3300049705 | Bacteria | 3291 |
| 672 | Ga0501225_0041953 | 3300049705 | Bacteria | 1263 |
| 673 | Ga0501225_0043405 | 3300049705 | Bacteria | 1242 |
| 674 | Ga0501225_0071549 | 3300049705 | Bacteria | 986 |
| 675 | Ga0501234_045246 | 3300049707 | Bacteria | 726 |
| 676 | Ga0501234_068536 | 3300049707 | Bacteria | 610 |
| 677 | Ga0501245_001378 | 3300049708 | Bacteria | 3134 |
| 678 | Ga0501241_024823 | 3300049758 | Bacteria | 1114 |
| 679 | Ga0501263_029453 | 3300049760 | Bacteria | 770 |
| 680 | Ga0501264_008163 | 3300049761 | Bacteria | 985 |
| 681 | Ga0501268_063199 | 3300049765 | Bacteria | 737 |
| 682 | Ga0501276_013553 | 3300049773 | Bacteria | 716 |
| 683 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 684 | Ga0501280_000064 | 3300049776 | Bacteria | 31054 |
| 685 | Ga0501280_001057 | 3300049776 | Bacteria | 5596 |
| 686 | Ga0501281_00086 | 3300049777 | Bacteria | 10989 |
| 687 | Ga0501282_000404 | 3300049778 | Bacteria | 5157 |
| 688 | Ga0501283_001453 | 3300049779 | Bacteria | 3071 |
| 689 | Ga0501035_0244287 | 3300049822 | Bacteria | 1526 |
| 690 | Ga0501044_0001187 | 3300049823 | Bacteria | 30876 |
| 691 | Ga0501044_0074300 | 3300049823 | Bacteria | 3454 |
| 692 | Ga0501204_000430 | 3300049850 | Bacteria | 3639 |
| 693 | Ga0501284_02268 | 3300050005 | Bacteria | 1056 |
| 694 | nmdc:mga03683_13_c1 | 3300050489 | Bacteria | 110533 |
| 695 | nmdc:mga03n38_8067_c1 | 3300050490 | Bacteria | 3758 |
| 696 | nmdc:mga00v17_133305_c1 | 3300050491 | Bacteria | 1589 |
| 697 | nmdc:mga0k408_423833_c1 | 3300050493 | Bacteria | 791 |
| 698 | nmdc:mga0k408_7432_c1 | 3300050493 | Bacteria | 5849 |
| 699 | nmdc:mga0k408_8_c1 | 3300050493 | Bacteria | 161211 |
| 700 | nmdc:mga04h51_34676_c1 | 3300050495 | Bacteria | 1613 |
| 701 | nmdc:mga07m45_20_c1 | 3300050496 | Bacteria | 126269 |
| 702 | nmdc:mga0n895_267626_c1 | 3300050512 | Bacteria | 1734 |
| 703 | nmdc:mga0sz30_647_c1 | 3300050516 | Bacteria | 12891 |
| 704 | Ga0500643_000135 | 3300053087 | Bacteria | 74911 |
| 705 | Ga0500643_000195 | 3300053087 | Bacteria | 57960 |
| 706 | Ga0500647_0137576 | 3300053091 | Bacteria | 1148 |
| 707 | Ga0500651_0086862 | 3300053093 | Bacteria | 1931 |
| 708 | Ga0500566_0004538 | 3300053094 | Bacteria | 8291 |
| 709 | Ga0500641_0011475 | 3300053096 | Bacteria | 3217 |
| 710 | Ga0500562_040866 | 3300053108 | Bacteria | 1233 |
| 711 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 712 | Ga0500592_001156 | 3300053116 | Bacteria | 4293 |
| 713 | Ga0500592_008468 | 3300053116 | Bacteria | 1631 |
| 714 | Ga0500618_014810 | 3300053125 | Bacteria | 1983 |
| 715 | Ga0500626_092170 | 3300053128 | Bacteria | 1329 |
| 716 | Ga0500642_0014296 | 3300053130 | Bacteria | 2948 |
| 717 | Ga0500652_278543 | 3300053131 | Bacteria | 654 |
| 718 | Ga0500652_371382 | 3300053131 | Bacteria | 536 |
| 719 | Ga0500655_000251 | 3300053133 | Bacteria | 12576 |
| 720 | Ga0500590_000131 | 3300053148 | Bacteria | 20923 |
| 721 | Ga0500604_0036484 | 3300053151 | Bacteria | 1466 |
| 722 | Ga0500604_0039631 | 3300053151 | Bacteria | 1417 |
| 723 | Ga0500604_0060477 | 3300053151 | Bacteria | 1189 |
| 724 | Ga0500604_0071415 | 3300053151 | Bacteria | 1107 |
| 725 | Ga0500604_0194406 | 3300053151 | Bacteria | 697 |
| 726 | Ga0500616_0008241 | 3300053153 | Bacteria | 6496 |
| 727 | Ga0500622_0025695 | 3300053156 | Bacteria | 3111 |
| 728 | Ga0500622_0091256 | 3300053156 | Bacteria | 1511 |
| 729 | Ga0500624_000062 | 3300053157 | Bacteria | 66317 |
| 730 | Ga0500627_0000003 | 3300053158 | Bacteria | 178186 |
| 731 | Ga0500627_0000570 | 3300053158 | Bacteria | 9930 |
| 732 | Ga0500627_0001223 | 3300053158 | Bacteria | 7068 |
| 733 | Ga0500627_0027041 | 3300053158 | Bacteria | 2372 |
| 734 | Ga0500639_139272 | 3300053163 | Bacteria | 1137 |
| 735 | Ga0500636_0058873 | 3300053177 | Bacteria | 2245 |
| 736 | Ga0500636_0230432 | 3300053177 | Bacteria | 959 |
| 737 | Ga0500637_0000112 | 3300053178 | Bacteria | 29320 |
| 738 | Ga0500570_004079 | 3300053724 | Bacteria | 7637 |
| 739 | Ga0587094_030537 | 3300059513 | Bacteria | 833 |
| 740 | Ga0587098_059728 | 3300059604 | Bacteria | 596 |
| 741 | Ga0466962_0016437 | 3300061719 | Bacteria | 3569 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100471441 | Ga0307408_1004714412 | 102 |
| 2 | 3300031731 | Ga0307405_10408947 | Ga0307405_104089471 | 102 |
| 3 | 3300031824 | Ga0307413_10236039 | Ga0307413_102360392 | 102 |
| 4 | 3300031824 | Ga0307413_11858545 | Ga0307413_118585451 | 102 |
| 5 | 3300031852 | Ga0307410_10192558 | Ga0307410_101925584 | 102 |
| 6 | 3300031852 | Ga0307410_10584196 | Ga0307410_105841961 | 102 |
| 7 | 3300031901 | Ga0307406_10069949 | Ga0307406_100699491 | 102 |
| 8 | 3300031903 | Ga0307407_10202036 | Ga0307407_102020362 | 102 |
| 9 | 3300031903 | Ga0307407_11185019 | Ga0307407_111850191 | 102 |
| 10 | 3300031995 | Ga0307409_100074131 | Ga0307409_1000741311 | 102 |
| 11 | 3300032002 | Ga0307416_100206250 | Ga0307416_1002062502 | 102 |
| 12 | 3300032004 | Ga0307414_10139371 | Ga0307414_101393712 | 102 |
| 13 | 3300032004 | Ga0307414_10154867 | Ga0307414_101548672 | 102 |
| 14 | 3300032126 | Ga0307415_100134218 | Ga0307415_1001342182 | 102 |
| 15 | 3300005353 | Ga0070669_100123994 | Ga0070669_1001239941 | 103 |
| 16 | 3300005335 | Ga0070666_11126734 | Ga0070666_111267342 | 104 |
| 17 | 3300005347 | Ga0070668_100518306 | Ga0070668_1005183063 | 104 |
| 18 | 3300005355 | Ga0070671_100035948 | Ga0070671_1000359483 | 104 |
| 19 | 3300005434 | Ga0070709_10012137 | Ga0070709_100121374 | 104 |
| 20 | 3300005435 | Ga0070714_100061476 | Ga0070714_1000614763 | 104 |
| 21 | 3300005436 | Ga0070713_100002710 | Ga0070713_1000027106 | 104 |
| 22 | 3300005436 | Ga0070713_100065476 | Ga0070713_1000654764 | 104 |
| 23 | 3300005456 | Ga0070678_102081094 | Ga0070678_1020810941 | 104 |
| 24 | 3300006175 | Ga0070712_100064336 | Ga0070712_1000643362 | 104 |
| 25 | 3300006175 | Ga0070712_101976943 | Ga0070712_1019769432 | 104 |
| 26 | 3300006358 | Ga0068871_100100936 | Ga0068871_1001009364 | 104 |
| 27 | 3300009177 | Ga0105248_10006373 | Ga0105248_1000637310 | 104 |
| 28 | 3300025906 | Ga0207699_10020459 | Ga0207699_100204592 | 104 |
| 29 | 3300025915 | Ga0207693_10032011 | Ga0207693_100320113 | 104 |
| 30 | 3300025928 | Ga0207700_10133944 | Ga0207700_101339441 | 104 |
| 31 | 3300025928 | Ga0207700_10911749 | Ga0207700_109117491 | 104 |
| 32 | 3300025931 | Ga0207644_10112905 | Ga0207644_101129054 | 104 |
| 33 | 3300025939 | Ga0207665_10021665 | Ga0207665_100216654 | 104 |
| 34 | 3300025940 | Ga0207691_10044352 | Ga0207691_100443524 | 104 |
| 35 | 3300025941 | Ga0207711_10153268 | Ga0207711_101532683 | 104 |
| 36 | 3300026035 | Ga0207703_12031310 | Ga0207703_120313102 | 104 |
| 37 | 3300026078 | Ga0207702_11265379 | Ga0207702_112653792 | 104 |
| 38 | 3300026095 | Ga0207676_11532792 | Ga0207676_115327921 | 104 |
| 39 | 3300031824 | Ga0307413_10229023 | Ga0307413_102290231 | 104 |
| 40 | 3300031911 | Ga0307412_10257505 | Ga0307412_102575051 | 104 |
| 41 | 3300031995 | Ga0307409_100549682 | Ga0307409_1005496824 | 104 |
| 42 | 3300032002 | Ga0307416_100476826 | Ga0307416_1004768262 | 104 |
| 43 | 3300034820 | Ga0373959_0167015 | Ga0373959_0167015_89_403 | 104 |
| 44 | 3300035692 | Ga0373935_0012992 | Ga0373935_0012992_2496_2822 | 104 |
| 45 | 3300037312 | Ga0395899_0077621 | Ga0395899_0077621_2024_2338 | 104 |
| 46 | 3300037418 | Ga0395900_0028261 | Ga0395900_0028261_4125_4439 | 104 |
| 47 | 3300037466 | Ga0395898_0038273 | Ga0395898_0038273_2763_3077 | 104 |
| 48 | 3300037471 | Ga0395905_0008374 | Ga0395905_0008374_4098_4412 | 104 |
| 49 | 3300038443 | Ga0395901_0014440 | Ga0395901_0014440_2712_3026 | 104 |
| 50 | 3300044656 | Ga0466969_0268548 | Ga0466969_0268548_16_330 | 104 |
| 51 | 3300044658 | Ga0466972_0046260 | Ga0466972_0046260_452_766 | 104 |
| 52 | 3300044683 | Ga0466965_0017759 | Ga0466965_0017759_2197_2511 | 104 |
| 53 | 3300044684 | Ga0466966_0052557 | Ga0466966_0052557_1439_1753 | 104 |
| 54 | 3300044684 | Ga0466966_0167157 | Ga0466966_0167157_21_335 | 104 |
| 55 | 3300044693 | Ga0466961_0029638 | Ga0466961_0029638_1443_1757 | 104 |
| 56 | 3300044694 | Ga0466963_0499988 | Ga0466963_0499988_377_691 | 104 |
| 57 | 3300044706 | Ga0466964_0002736 | Ga0466964_0002736_1685_1999 | 104 |
| 58 | 3300044719 | Ga0466971_0012785 | Ga0466971_0012785_2703_3017 | 104 |
| 59 | 3300044735 | Ga0466968_0002823 | Ga0466968_0002823_5537_5851 | 104 |
| 60 | 3300044765 | Ga0466970_0069617 | Ga0466970_0069617_798_1112 | 104 |
| 61 | 3300044842 | Ga0466957_0066943 | Ga0466957_0066943_982_1296 | 104 |
| 62 | 3300045049 | Ga0466959_0145104 | Ga0466959_0145104_1183_1497 | 104 |
| 63 | 3300045049 | Ga0466959_0181311 | Ga0466959_0181311_1020_1334 | 104 |
| 64 | 3300045049 | Ga0466959_0349939 | Ga0466959_0349939_570_884 | 104 |
| 65 | 3300045836 | Ga0466958_0007699 | Ga0466958_0007699_4778_5092 | 104 |
| 66 | 3300045836 | Ga0466958_0025958 | Ga0466958_0025958_952_1266 | 104 |
| 67 | 3300045836 | Ga0466958_0383841 | Ga0466958_0383841_565_879 | 104 |
| 68 | 3300045976 | Ga0466967_0089604 | Ga0466967_0089604_2221_2535 | 104 |
| 69 | 3300048903 | Ga0496100_0027383 | Ga0496100_0027383_1776_2090 | 104 |
| 70 | 3300048904 | Ga0496101_0016587 | Ga0496101_0016587_1754_2068 | 104 |
| 71 | 3300048909 | Ga0496106_0042063 | Ga0496106_0042063_1487_1801 | 104 |
| 72 | 3300048910 | Ga0496107_0044142 | Ga0496107_0044142_1788_2102 | 104 |
| 73 | 3300048917 | Ga0496114_0059906 | Ga0496114_0059906_530_844 | 104 |
| 74 | 3300048918 | Ga0496115_0074035 | Ga0496115_0074035_34_348 | 104 |
| 75 | 3300049651 | Ga0501201_046218 | Ga0501201_046218_57_383 | 104 |
| 76 | 3300049663 | Ga0501223_039106 | Ga0501223_039106_132_458 | 104 |
| 77 | 3300049664 | Ga0501224_044230 | Ga0501224_044230_116_442 | 104 |
| 78 | 3300049679 | Ga0501249_102848 | Ga0501249_102848_301_627 | 104 |
| 79 | 3300049705 | Ga0501225_0041953 | Ga0501225_0041953_747_1073 | 104 |
| 80 | 3300049707 | Ga0501234_045246 | Ga0501234_045246_80_406 | 104 |
| 81 | 3300049765 | Ga0501268_063199 | Ga0501268_063199_193_519 | 104 |
| 82 | 3300061719 | Ga0466962_0016437 | Ga0466962_0016437_1531_1845 | 104 |
| 83 | 3300005293 | Ga0065715_10344649 | Ga0065715_103446493 | 105 |
| 84 | 3300005327 | Ga0070658_10603273 | Ga0070658_106032731 | 105 |
| 85 | 3300005339 | Ga0070660_101735441 | Ga0070660_1017354411 | 105 |
| 86 | 3300005345 | Ga0070692_10001265 | Ga0070692_100012657 | 105 |
| 87 | 3300005345 | Ga0070692_10002712 | Ga0070692_100027123 | 105 |
| 88 | 3300005455 | Ga0070663_100075753 | Ga0070663_1000757533 | 105 |
| 89 | 3300005530 | Ga0070679_100082753 | Ga0070679_1000827532 | 105 |
| 90 | 3300005535 | Ga0070684_100168126 | Ga0070684_1001681264 | 105 |
| 91 | 3300005563 | Ga0068855_100135463 | Ga0068855_1001354633 | 105 |
| 92 | 3300009551 | Ga0105238_10972391 | Ga0105238_109723912 | 105 |
| 93 | 3300013100 | Ga0157373_10374068 | Ga0157373_103740683 | 105 |
| 94 | 3300013307 | Ga0157372_10679552 | Ga0157372_106795523 | 105 |
| 95 | 3300025904 | Ga0207647_10650728 | Ga0207647_106507282 | 105 |
| 96 | 3300025909 | Ga0207705_10016944 | Ga0207705_100169445 | 105 |
| 97 | 3300026067 | Ga0207678_10034203 | Ga0207678_100342033 | 105 |
| 98 | 3300027876 | Ga0209974_10023499 | Ga0209974_100234994 | 105 |
| 99 | 3300027876 | Ga0209974_10465763 | Ga0209974_104657632 | 105 |
| 100 | 3300030731 | Ga0316177_1082224 | Ga0316177_10822244 | 105 |
| 101 | 3300031901 | Ga0307406_11068797 | Ga0307406_110687971 | 105 |
| 102 | 3300031903 | Ga0307407_10069618 | Ga0307407_100696182 | 105 |
| 103 | 3300031911 | Ga0307412_10337741 | Ga0307412_103377413 | 105 |
| 104 | 3300032002 | Ga0307416_100152722 | Ga0307416_1001527222 | 105 |
| 105 | 3300032004 | Ga0307414_10392121 | Ga0307414_103921214 | 105 |
| 106 | 3300032005 | Ga0307411_11176066 | Ga0307411_111760662 | 105 |
| 107 | 3300037312 | Ga0395899_0021279 | Ga0395899_0021279_1980_2297 | 105 |
| 108 | 3300037418 | Ga0395900_0063619 | Ga0395900_0063619_1900_2217 | 105 |
| 109 | 3300037466 | Ga0395898_0121043 | Ga0395898_0121043_1416_1733 | 105 |
| 110 | 3300037466 | Ga0395898_1714884 | Ga0395898_1714884_208_525 | 105 |
| 111 | 3300037471 | Ga0395905_0013966 | Ga0395905_0013966_6541_6858 | 105 |
| 112 | 3300037471 | Ga0395905_1534650 | Ga0395905_1534650_53_370 | 105 |
| 113 | 3300038443 | Ga0395901_0014058 | Ga0395901_0014058_6256_6573 | 105 |
| 114 | 3300042000 | Ga0439437_027949 | Ga0439437_027949_331_654 | 105 |
| 115 | 3300042016 | Ga0439463_166786 | Ga0439463_166786_209_532 | 105 |
| 116 | 3300059513 | Ga0587094_030537 | Ga0587094_030537_433_750 | 105 |
| 117 | iso_pu_bacteria | 2582581305 | 2585262259 | 105 |
| 118 | iso_pu_bacteria | 2643221541 | 2643731599 | 105 |
| 119 | iso_pu_bacteria | 2643221606 | 2644042073 | 105 |
| 120 | iso_pu_bacteria | 2643221622 | 2644126039 | 105 |
| 121 | iso_pu_bacteria | 2643221671 | 2644394284 | 105 |
| 122 | 3300037853 | Ga0436364_0878110 | Ga0436364_0878110_177_500 | 106 |
| 123 | 3300002774 | JGI25150J39212_1002047 | JGI25150J39212_10020475 | 107 |
| 124 | 3300003215 | JGI25153J46596_10000395 | JGI25153J46596_1000039515 | 107 |
| 125 | 3300003781 | Ga0055536_1012135 | Ga0055536_10121355 | 107 |
| 126 | 3300003791 | Ga0055530_10007314 | Ga0055530_100073141 | 107 |
| 127 | 3300003792 | Ga0055540_1002064 | Ga0055540_10020647 | 107 |
| 128 | 3300005262 | Ga0065165_1062777 | Ga0065165_10627773 | 107 |
| 129 | 3300005327 | Ga0070658_10707327 | Ga0070658_107073272 | 107 |
| 130 | 3300005548 | Ga0070665_100736340 | Ga0070665_1007363403 | 107 |
| 131 | 3300005616 | Ga0068852_100244943 | Ga0068852_1002449431 | 107 |
| 132 | 3300005840 | Ga0068870_10954518 | Ga0068870_109545182 | 107 |
| 133 | 3300006058 | Ga0075432_10006371 | Ga0075432_100063713 | 107 |
| 134 | 3300009177 | Ga0105248_10103436 | Ga0105248_101034361 | 107 |
| 135 | 3300013102 | Ga0157371_11547738 | Ga0157371_115477381 | 107 |
| 136 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004164 | 107 |
| 137 | 3300025258 | Ga0209129_1002094 | Ga0209129_10020943 | 107 |
| 138 | 3300025263 | Ga0209565_1000134 | Ga0209565_100013448 | 107 |
| 139 | 3300025273 | Ga0209673_1029162 | Ga0209673_10291621 | 107 |
| 140 | 3300025292 | Ga0209676_1026408 | Ga0209676_10264084 | 107 |
| 141 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068233 | 107 |
| 142 | 3300025295 | Ga0209564_1013725 | Ga0209564_10137251 | 107 |
| 143 | 3300025295 | Ga0209564_1015447 | Ga0209564_10154471 | 107 |
| 144 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004132 | 107 |
| 145 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012062 | 107 |
| 146 | 3300025298 | Ga0209050_1014306 | Ga0209050_10143065 | 107 |
| 147 | 3300025303 | Ga0209051_1000191 | Ga0209051_10001917 | 107 |
| 148 | 3300025304 | Ga0209257_1000876 | Ga0209257_100087612 | 107 |
| 149 | 3300025304 | Ga0209257_1002353 | Ga0209257_100235311 | 107 |
| 150 | 3300025315 | Ga0207697_10046997 | Ga0207697_100469974 | 107 |
| 151 | 3300025941 | Ga0207711_11345137 | Ga0207711_113451371 | 107 |
| 152 | 3300026142 | Ga0207698_10353465 | Ga0207698_103534653 | 107 |
| 153 | 3300027907 | Ga0207428_10045887 | Ga0207428_100458873 | 107 |
| 154 | 3300028379 | Ga0268266_10850351 | Ga0268266_108503513 | 107 |
| 155 | 3300031824 | Ga0307413_10121532 | Ga0307413_101215325 | 107 |
| 156 | 3300032004 | Ga0307414_10450820 | Ga0307414_104508202 | 107 |
| 157 | 3300032005 | Ga0307411_10589128 | Ga0307411_105891281 | 107 |
| 158 | 3300032005 | Ga0307411_10830711 | Ga0307411_108307112 | 107 |
| 159 | 3300032126 | Ga0307415_100496024 | Ga0307415_1004960243 | 107 |
| 160 | 3300039437 | Ga0436365_0600332 | Ga0436365_0600332_349_672 | 107 |
| 161 | 3300046500 | Ga0495596_0388920 | Ga0495596_0388920_183_515 | 107 |
| 162 | 3300046530 | Ga0495654_0020158 | Ga0495654_0020158_1476_1808 | 107 |
| 163 | 3300048905 | Ga0496102_0681373 | Ga0496102_0681373_212_535 | 107 |
| 164 | 3300048906 | Ga0496103_0224202 | Ga0496103_0224202_53_376 | 107 |
| 165 | 3300048906 | Ga0496103_0233437 | Ga0496103_0233437_646_984 | 107 |
| 166 | 3300048918 | Ga0496115_0001129 | Ga0496115_0001129_12205_12528 | 107 |
| 167 | 3300048920 | Ga0496117_0251385 | Ga0496117_0251385_204_527 | 107 |
| 168 | 3300048921 | Ga0496118_0139050 | Ga0496118_0139050_548_871 | 107 |
| 169 | 3300049760 | Ga0501263_029453 | Ga0501263_029453_208_546 | 107 |
| 170 | 3300050005 | Ga0501284_02268 | Ga0501284_02268_699_1022 | 107 |
| 171 | 3300053116 | Ga0500592_008468 | Ga0500592_008468_1002_1334 | 107 |
| 172 | 3300053151 | Ga0500604_0060477 | Ga0500604_0060477_741_1073 | 107 |
| 173 | 3300053157 | Ga0500624_000062 | Ga0500624_000062_41568_41891 | 107 |
| 174 | 3300053158 | Ga0500627_0000003 | Ga0500627_0000003_91821_92153 | 107 |
| 175 | 3300053178 | Ga0500637_0000112 | Ga0500637_0000112_18522_18845 | 107 |
| 176 | 3300000549 | LJQas_1037756 | LJQas_10377562 | 108 |
| 177 | 3300001989 | JGI24739J22299_10093354 | JGI24739J22299_100933541 | 108 |
| 178 | 3300004798 | Ga0058859_11187240 | Ga0058859_111872402 | 108 |
| 179 | 3300005327 | Ga0070658_10000172 | Ga0070658_1000017228 | 108 |
| 180 | 3300005333 | Ga0070677_10001197 | Ga0070677_100011975 | 108 |
| 181 | 3300005339 | Ga0070660_100000399 | Ga0070660_10000039918 | 108 |
| 182 | 3300005344 | Ga0070661_100251887 | Ga0070661_1002518871 | 108 |
| 183 | 3300005344 | Ga0070661_100988057 | Ga0070661_1009880571 | 108 |
| 184 | 3300005345 | Ga0070692_10000103 | Ga0070692_1000010311 | 108 |
| 185 | 3300005354 | Ga0070675_100018970 | Ga0070675_1000189708 | 108 |
| 186 | 3300005366 | Ga0070659_100013894 | Ga0070659_1000138945 | 108 |
| 187 | 3300005366 | Ga0070659_100035203 | Ga0070659_1000352032 | 108 |
| 188 | 3300005444 | Ga0070694_101218665 | Ga0070694_1012186651 | 108 |
| 189 | 3300005455 | Ga0070663_101747653 | Ga0070663_1017476532 | 108 |
| 190 | 3300005535 | Ga0070684_100572744 | Ga0070684_1005727441 | 108 |
| 191 | 3300005539 | Ga0068853_100021557 | Ga0068853_1000215572 | 108 |
| 192 | 3300005539 | Ga0068853_101121382 | Ga0068853_1011213822 | 108 |
| 193 | 3300005544 | Ga0070686_100000352 | Ga0070686_10000035218 | 108 |
| 194 | 3300005547 | Ga0070693_101031312 | Ga0070693_1010313121 | 108 |
| 195 | 3300005548 | Ga0070665_100000361 | Ga0070665_10000036112 | 108 |
| 196 | 3300005548 | Ga0070665_100001120 | Ga0070665_10000112033 | 108 |
| 197 | 3300005563 | Ga0068855_100395754 | Ga0068855_1003957544 | 108 |
| 198 | 3300005564 | Ga0070664_102058436 | Ga0070664_1020584362 | 108 |
| 199 | 3300005615 | Ga0070702_101393985 | Ga0070702_1013939851 | 108 |
| 200 | 3300005616 | Ga0068852_101465431 | Ga0068852_1014654312 | 108 |
| 201 | 3300005843 | Ga0068860_100048930 | Ga0068860_1000489303 | 108 |
| 202 | 3300005985 | Ga0081539_10009010 | Ga0081539_100090108 | 108 |
| 203 | 3300006042 | Ga0075368_10163199 | Ga0075368_101631993 | 108 |
| 204 | 3300006048 | Ga0075363_100000799 | Ga0075363_1000007997 | 108 |
| 205 | 3300006051 | Ga0075364_10033952 | Ga0075364_100339527 | 108 |
| 206 | 3300006177 | Ga0075362_10000003 | Ga0075362_10000003163 | 108 |
| 207 | 3300006195 | Ga0075366_10000006 | Ga0075366_100000069 | 108 |
| 208 | 3300006195 | Ga0075366_10009002 | Ga0075366_100090029 | 108 |
| 209 | 3300006195 | Ga0075366_10043167 | Ga0075366_100431672 | 108 |
| 210 | 3300006353 | Ga0075370_10000008 | Ga0075370_1000000884 | 108 |
| 211 | 3300006871 | Ga0075434_100734299 | Ga0075434_1007342992 | 108 |
| 212 | 3300009148 | Ga0105243_11745006 | Ga0105243_117450062 | 108 |
| 213 | 3300009174 | Ga0105241_10387501 | Ga0105241_103875011 | 108 |
| 214 | 3300009551 | Ga0105238_10125483 | Ga0105238_101254833 | 108 |
| 215 | 3300009553 | Ga0105249_11819029 | Ga0105249_118190292 | 108 |
| 216 | 3300013105 | Ga0157369_10921210 | Ga0157369_109212101 | 108 |
| 217 | 3300013296 | Ga0157374_11882304 | Ga0157374_118823041 | 108 |
| 218 | 3300013307 | Ga0157372_11150177 | Ga0157372_111501772 | 108 |
| 219 | 3300014326 | Ga0157380_13380793 | Ga0157380_133807932 | 108 |
| 220 | 3300015690 | Ga0183363_1004 | Ga0183363_1004240 | 108 |
| 221 | 3300017792 | Ga0163161_10867138 | Ga0163161_108671381 | 108 |
| 222 | 3300025893 | Ga0207682_10004224 | Ga0207682_1000422410 | 108 |
| 223 | 3300025920 | Ga0207649_10848417 | Ga0207649_108484171 | 108 |
| 224 | 3300025920 | Ga0207649_10899162 | Ga0207649_108991621 | 108 |
| 225 | 3300025935 | Ga0207709_11112615 | Ga0207709_111126152 | 108 |
| 226 | 3300025940 | Ga0207691_10788796 | Ga0207691_107887961 | 108 |
| 227 | 3300025945 | Ga0207679_10597498 | Ga0207679_105974981 | 108 |
| 228 | 3300025945 | Ga0207679_11325829 | Ga0207679_113258291 | 108 |
| 229 | 3300026075 | Ga0207708_10468159 | Ga0207708_104681593 | 108 |
| 230 | 3300026121 | Ga0207683_11981229 | Ga0207683_119812291 | 108 |
| 231 | 3300026142 | Ga0207698_10084139 | Ga0207698_100841391 | 108 |
| 232 | 3300027866 | Ga0209813_10029105 | Ga0209813_100291051 | 108 |
| 233 | 3300028379 | Ga0268266_10000181 | Ga0268266_1000018171 | 108 |
| 234 | 3300028381 | Ga0268264_10030665 | Ga0268264_100306653 | 108 |
| 235 | 3300031456 | Ga0307513_10522361 | Ga0307513_105223613 | 108 |
| 236 | 3300031548 | Ga0307408_101212836 | Ga0307408_1012128361 | 108 |
| 237 | 3300031731 | Ga0307405_10442013 | Ga0307405_104420132 | 108 |
| 238 | 3300031731 | Ga0307405_11796864 | Ga0307405_117968641 | 108 |
| 239 | 3300031901 | Ga0307406_10132306 | Ga0307406_101323064 | 108 |
| 240 | 3300031995 | Ga0307409_101773022 | Ga0307409_1017730222 | 108 |
| 241 | 3300031995 | Ga0307409_102542064 | Ga0307409_1025420642 | 108 |
| 242 | 3300032002 | Ga0307416_101096960 | Ga0307416_1010969601 | 108 |
| 243 | 3300032004 | Ga0307414_10085486 | Ga0307414_100854863 | 108 |
| 244 | 3300032005 | Ga0307411_10122243 | Ga0307411_101222432 | 108 |
| 245 | 3300032005 | Ga0307411_11715192 | Ga0307411_117151921 | 108 |
| 246 | 3300032005 | Ga0307411_12013200 | Ga0307411_120132001 | 108 |
| 247 | 3300032126 | Ga0307415_101420031 | Ga0307415_1014200311 | 108 |
| 248 | 3300032126 | Ga0307415_101828714 | Ga0307415_1018287142 | 108 |
| 249 | 3300034957 | Ga0373938_0176853 | Ga0373938_0176853_72_401 | 108 |
| 250 | 3300035112 | Ga0373932_0031572 | Ga0373932_0031572_67_396 | 108 |
| 251 | 3300036401 | Ga0373937_0267550 | Ga0373937_0267550_445_771 | 108 |
| 252 | 3300039437 | Ga0436365_0922307 | Ga0436365_0922307_363_695 | 108 |
| 253 | 3300039450 | Ga0436363_0674844 | Ga0436363_0674844_102_428 | 108 |
| 254 | 3300039450 | Ga0436363_1090589 | Ga0436363_1090589_582_908 | 108 |
| 255 | 3300041486 | Ga0451807_1087972 | Ga0451807_1087972_260_586 | 108 |
| 256 | 3300045976 | Ga0466967_2588529 | Ga0466967_2588529_80_409 | 108 |
| 257 | 3300046528 | Ga0495642_0032976 | Ga0495642_0032976_673_999 | 108 |
| 258 | 3300046660 | Ga0495625_0598070 | Ga0495625_0598070_50_376 | 108 |
| 259 | 3300049581 | Ga0501047_0450251 | Ga0501047_0450251_490_819 | 108 |
| 260 | 3300049823 | Ga0501044_0001187 | Ga0501044_0001187_21390_21719 | 108 |
| 261 | 3300050489 | nmdc:mga03683_13_c1 | nmdc:mga03683_13_c1_49465_49794 | 108 |
| 262 | 3300050490 | nmdc:mga03n38_8067_c1 | nmdc:mga03n38_8067_c1_2000_2329 | 108 |
| 263 | 3300050491 | nmdc:mga00v17_133305_c1 | nmdc:mga00v17_133305_c1_754_1083 | 108 |
| 264 | 3300050493 | nmdc:mga0k408_423833_c1 | nmdc:mga0k408_423833_c1_174_500 | 108 |
| 265 | 3300050493 | nmdc:mga0k408_7432_c1 | nmdc:mga0k408_7432_c1_3812_4150 | 108 |
| 266 | 3300050493 | nmdc:mga0k408_8_c1 | nmdc:mga0k408_8_c1_59811_60140 | 108 |
| 267 | 3300050495 | nmdc:mga04h51_34676_c1 | nmdc:mga04h51_34676_c1_1105_1434 | 108 |
| 268 | 3300050496 | nmdc:mga07m45_20_c1 | nmdc:mga07m45_20_c1_18085_18414 | 108 |
| 269 | 3300050512 | nmdc:mga0n895_267626_c1 | nmdc:mga0n895_267626_c1_1180_1506 | 108 |
| 270 | 3300050516 | nmdc:mga0sz30_647_c1 | nmdc:mga0sz30_647_c1_431_760 | 108 |
| 271 | 3300053096 | Ga0500641_0011475 | Ga0500641_0011475_175_501 | 108 |
| 272 | 3300001904 | JGI24736J21556_1000032 | JGI24736J21556_100003226 | 109 |
| 273 | 3300001976 | JGI24752J21851_1000082 | JGI24752J21851_10000825 | 109 |
| 274 | 3300001976 | JGI24752J21851_1006793 | JGI24752J21851_10067934 | 109 |
| 275 | 3300001979 | JGI24740J21852_10005188 | JGI24740J21852_100051887 | 109 |
| 276 | 3300001989 | JGI24739J22299_10000162 | JGI24739J22299_1000016220 | 109 |
| 277 | 3300001989 | JGI24739J22299_10025324 | JGI24739J22299_100253244 | 109 |
| 278 | 3300001990 | JGI24737J22298_10020755 | JGI24737J22298_100207553 | 109 |
| 279 | 3300002070 | JGI24750J21931_1000116 | JGI24750J21931_10001164 | 109 |
| 280 | 3300002074 | JGI24748J21848_1000036 | JGI24748J21848_100003663 | 109 |
| 281 | 3300002075 | JGI24738J21930_10000231 | JGI24738J21930_1000023117 | 109 |
| 282 | 3300002076 | JGI24749J21850_1000049 | JGI24749J21850_10000498 | 109 |
| 283 | 3300002076 | JGI24749J21850_1048288 | JGI24749J21850_10482881 | 109 |
| 284 | 3300002239 | JGI24034J26672_10000008 | JGI24034J26672_1000000834 | 109 |
| 285 | 3300002239 | JGI24034J26672_10000038 | JGI24034J26672_1000003863 | 109 |
| 286 | 3300002239 | JGI24034J26672_10003845 | JGI24034J26672_100038454 | 109 |
| 287 | 3300002239 | JGI24034J26672_10015831 | JGI24034J26672_100158312 | 109 |
| 288 | 3300002239 | JGI24034J26672_10041405 | JGI24034J26672_100414052 | 109 |
| 289 | 3300002244 | JGI24742J22300_10005496 | JGI24742J22300_100054963 | 109 |
| 290 | 3300002459 | JGI24751J29686_10000216 | JGI24751J29686_1000021619 | 109 |
| 291 | 3300002459 | JGI24751J29686_10018164 | JGI24751J29686_100181644 | 109 |
| 292 | 3300005262 | Ga0065165_1112184 | Ga0065165_11121841 | 109 |
| 293 | 3300005295 | Ga0065707_10000505 | Ga0065707_1000050536 | 109 |
| 294 | 3300005295 | Ga0065707_10086198 | Ga0065707_100861985 | 109 |
| 295 | 3300005295 | Ga0065707_10098261 | Ga0065707_100982615 | 109 |
| 296 | 3300005295 | Ga0065707_10212812 | Ga0065707_102128122 | 109 |
| 297 | 3300005295 | Ga0065707_10414622 | Ga0065707_104146222 | 109 |
| 298 | 3300005327 | Ga0070658_10040826 | Ga0070658_100408265 | 109 |
| 299 | 3300005329 | Ga0070683_101233833 | Ga0070683_1012338332 | 109 |
| 300 | 3300005330 | Ga0070690_100000021 | Ga0070690_10000002130 | 109 |
| 301 | 3300005330 | Ga0070690_100459866 | Ga0070690_1004598662 | 109 |
| 302 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003365 | 109 |
| 303 | 3300005331 | Ga0070670_100002377 | Ga0070670_10000237710 | 109 |
| 304 | 3300005331 | Ga0070670_100004170 | Ga0070670_10000417015 | 109 |
| 305 | 3300005331 | Ga0070670_100368417 | Ga0070670_1003684172 | 109 |
| 306 | 3300005331 | Ga0070670_100426848 | Ga0070670_1004268482 | 109 |
| 307 | 3300005335 | Ga0070666_10000004 | Ga0070666_10000004253 | 109 |
| 308 | 3300005335 | Ga0070666_10000184 | Ga0070666_1000018422 | 109 |
| 309 | 3300005335 | Ga0070666_10033483 | Ga0070666_100334833 | 109 |
| 310 | 3300005335 | Ga0070666_11043600 | Ga0070666_110436002 | 109 |
| 311 | 3300005337 | Ga0070682_100178661 | Ga0070682_1001786611 | 109 |
| 312 | 3300005340 | Ga0070689_100005020 | Ga0070689_1000050209 | 109 |
| 313 | 3300005344 | Ga0070661_100246068 | Ga0070661_1002460682 | 109 |
| 314 | 3300005347 | Ga0070668_100000026 | Ga0070668_10000002627 | 109 |
| 315 | 3300005347 | Ga0070668_100288829 | Ga0070668_1002888294 | 109 |
| 316 | 3300005347 | Ga0070668_100428915 | Ga0070668_1004289151 | 109 |
| 317 | 3300005353 | Ga0070669_100000008 | Ga0070669_10000000845 | 109 |
| 318 | 3300005353 | Ga0070669_100000020 | Ga0070669_100000020117 | 109 |
| 319 | 3300005353 | Ga0070669_100000457 | Ga0070669_10000045734 | 109 |
| 320 | 3300005353 | Ga0070669_100093939 | Ga0070669_1000939393 | 109 |
| 321 | 3300005353 | Ga0070669_101376636 | Ga0070669_1013766361 | 109 |
| 322 | 3300005355 | Ga0070671_100000015 | Ga0070671_100000015138 | 109 |
| 323 | 3300005355 | Ga0070671_100000470 | Ga0070671_10000047021 | 109 |
| 324 | 3300005355 | Ga0070671_100060705 | Ga0070671_1000607052 | 109 |
| 325 | 3300005365 | Ga0070688_100003653 | Ga0070688_1000036532 | 109 |
| 326 | 3300005367 | Ga0070667_100000019 | Ga0070667_100000019215 | 109 |
| 327 | 3300005367 | Ga0070667_100000089 | Ga0070667_10000008912 | 109 |
| 328 | 3300005367 | Ga0070667_100006367 | Ga0070667_1000063676 | 109 |
| 329 | 3300005367 | Ga0070667_100010059 | Ga0070667_1000100596 | 109 |
| 330 | 3300005367 | Ga0070667_100037194 | Ga0070667_1000371943 | 109 |
| 331 | 3300005440 | Ga0070705_100054779 | Ga0070705_1000547793 | 109 |
| 332 | 3300005445 | Ga0070708_100198374 | Ga0070708_1001983742 | 109 |
| 333 | 3300005455 | Ga0070663_100129274 | Ga0070663_1001292744 | 109 |
| 334 | 3300005455 | Ga0070663_100588916 | Ga0070663_1005889162 | 109 |
| 335 | 3300005456 | Ga0070678_100593866 | Ga0070678_1005938661 | 109 |
| 336 | 3300005457 | Ga0070662_100112452 | Ga0070662_1001124521 | 109 |
| 337 | 3300005466 | Ga0070685_10000724 | Ga0070685_100007244 | 109 |
| 338 | 3300005467 | Ga0070706_100327632 | Ga0070706_1003276322 | 109 |
| 339 | 3300005471 | Ga0070698_101498001 | Ga0070698_1014980012 | 109 |
| 340 | 3300005535 | Ga0070684_101012712 | Ga0070684_1010127121 | 109 |
| 341 | 3300005539 | Ga0068853_100003716 | Ga0068853_10000371612 | 109 |
| 342 | 3300005543 | Ga0070672_101519879 | Ga0070672_1015198792 | 109 |
| 343 | 3300005544 | Ga0070686_100000012 | Ga0070686_100000012151 | 109 |
| 344 | 3300005547 | Ga0070693_101227001 | Ga0070693_1012270011 | 109 |
| 345 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004630 | 109 |
| 346 | 3300005548 | Ga0070665_100378831 | Ga0070665_1003788311 | 109 |
| 347 | 3300005548 | Ga0070665_101432299 | Ga0070665_1014322992 | 109 |
| 348 | 3300005563 | Ga0068855_100577260 | Ga0068855_1005772602 | 109 |
| 349 | 3300005564 | Ga0070664_100221374 | Ga0070664_1002213742 | 109 |
| 350 | 3300005564 | Ga0070664_100391722 | Ga0070664_1003917222 | 109 |
| 351 | 3300005577 | Ga0068857_100089221 | Ga0068857_1000892213 | 109 |
| 352 | 3300005578 | Ga0068854_100075543 | Ga0068854_1000755434 | 109 |
| 353 | 3300005578 | Ga0068854_100178512 | Ga0068854_1001785122 | 109 |
| 354 | 3300005578 | Ga0068854_101175013 | Ga0068854_1011750131 | 109 |
| 355 | 3300005617 | Ga0068859_100003505 | Ga0068859_1000035056 | 109 |
| 356 | 3300005617 | Ga0068859_100023533 | Ga0068859_1000235336 | 109 |
| 357 | 3300005617 | Ga0068859_100028374 | Ga0068859_1000283746 | 109 |
| 358 | 3300005617 | Ga0068859_100216629 | Ga0068859_1002166292 | 109 |
| 359 | 3300005618 | Ga0068864_100000005 | Ga0068864_100000005232 | 109 |
| 360 | 3300005618 | Ga0068864_100005620 | Ga0068864_1000056206 | 109 |
| 361 | 3300005618 | Ga0068864_100007081 | Ga0068864_1000070815 | 109 |
| 362 | 3300005618 | Ga0068864_100030140 | Ga0068864_1000301403 | 109 |
| 363 | 3300005618 | Ga0068864_100466728 | Ga0068864_1004667281 | 109 |
| 364 | 3300005719 | Ga0068861_100004980 | Ga0068861_1000049804 | 109 |
| 365 | 3300005719 | Ga0068861_100020681 | Ga0068861_1000206811 | 109 |
| 366 | 3300005719 | Ga0068861_100154977 | Ga0068861_1001549774 | 109 |
| 367 | 3300005834 | Ga0068851_10064379 | Ga0068851_100643794 | 109 |
| 368 | 3300005841 | Ga0068863_100000013 | Ga0068863_100000013176 | 109 |
| 369 | 3300005841 | Ga0068863_100002259 | Ga0068863_10000225915 | 109 |
| 370 | 3300005841 | Ga0068863_100067996 | Ga0068863_1000679964 | 109 |
| 371 | 3300005842 | Ga0068858_100010355 | Ga0068858_10001035513 | 109 |
| 372 | 3300005842 | Ga0068858_100034454 | Ga0068858_1000344545 | 109 |
| 373 | 3300005842 | Ga0068858_100053891 | Ga0068858_1000538914 | 109 |
| 374 | 3300005843 | Ga0068860_100000009 | Ga0068860_100000009252 | 109 |
| 375 | 3300005843 | Ga0068860_100000036 | Ga0068860_100000036229 | 109 |
| 376 | 3300005843 | Ga0068860_100000148 | Ga0068860_100000148119 | 109 |
| 377 | 3300005843 | Ga0068860_100001081 | Ga0068860_10000108118 | 109 |
| 378 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001221 | 109 |
| 379 | 3300005844 | Ga0068862_100000169 | Ga0068862_1000001696 | 109 |
| 380 | 3300005844 | Ga0068862_100000209 | Ga0068862_10000020928 | 109 |
| 381 | 3300005844 | Ga0068862_100006085 | Ga0068862_10000608510 | 109 |
| 382 | 3300005937 | Ga0081455_10601736 | Ga0081455_106017361 | 109 |
| 383 | 3300006931 | Ga0097620_100003505 | Ga0097620_1000035056 | 109 |
| 384 | 3300006931 | Ga0097620_100023532 | Ga0097620_1000235325 | 109 |
| 385 | 3300006931 | Ga0097620_100028372 | Ga0097620_1000283726 | 109 |
| 386 | 3300006931 | Ga0097620_100216626 | Ga0097620_1002166262 | 109 |
| 387 | 3300009011 | Ga0105251_10091930 | Ga0105251_100919302 | 109 |
| 388 | 3300009011 | Ga0105251_10438344 | Ga0105251_104383442 | 109 |
| 389 | 3300009092 | Ga0105250_10040167 | Ga0105250_100401674 | 109 |
| 390 | 3300009093 | Ga0105240_10015679 | Ga0105240_100156799 | 109 |
| 391 | 3300009093 | Ga0105240_10025126 | Ga0105240_1002512610 | 109 |
| 392 | 3300009101 | Ga0105247_10144469 | Ga0105247_101444692 | 109 |
| 393 | 3300009148 | Ga0105243_10889364 | Ga0105243_108893642 | 109 |
| 394 | 3300009148 | Ga0105243_10942050 | Ga0105243_109420501 | 109 |
| 395 | 3300009174 | Ga0105241_10707420 | Ga0105241_107074202 | 109 |
| 396 | 3300009177 | Ga0105248_10059949 | Ga0105248_100599492 | 109 |
| 397 | 3300009177 | Ga0105248_11064157 | Ga0105248_110641573 | 109 |
| 398 | 3300009545 | Ga0105237_10044206 | Ga0105237_100442064 | 109 |
| 399 | 3300009545 | Ga0105237_10048537 | Ga0105237_100485373 | 109 |
| 400 | 3300009551 | Ga0105238_10102613 | Ga0105238_101026135 | 109 |
| 401 | 3300009553 | Ga0105249_10000006 | Ga0105249_10000006113 | 109 |
| 402 | 3300009978 | Ga0105148_100540 | Ga0105148_1005406 | 109 |
| 403 | 3300009982 | Ga0105147_110624 | Ga0105147_1106242 | 109 |
| 404 | 3300010375 | Ga0105239_10000367 | Ga0105239_1000036748 | 109 |
| 405 | 3300010375 | Ga0105239_10326543 | Ga0105239_103265432 | 109 |
| 406 | 3300013100 | Ga0157373_10087299 | Ga0157373_100872995 | 109 |
| 407 | 3300013104 | Ga0157370_10062515 | Ga0157370_100625155 | 109 |
| 408 | 3300013105 | Ga0157369_10138988 | Ga0157369_101389883 | 109 |
| 409 | 3300013297 | Ga0157378_10501215 | Ga0157378_105012152 | 109 |
| 410 | 3300013306 | Ga0163162_10008623 | Ga0163162_100086236 | 109 |
| 411 | 3300013307 | Ga0157372_10452741 | Ga0157372_104527412 | 109 |
| 412 | 3300014325 | Ga0163163_10071955 | Ga0163163_100719555 | 109 |
| 413 | 3300014325 | Ga0163163_11267920 | Ga0163163_112679202 | 109 |
| 414 | 3300014326 | Ga0157380_10000029 | Ga0157380_1000002963 | 109 |
| 415 | 3300014326 | Ga0157380_10000182 | Ga0157380_100001827 | 109 |
| 416 | 3300014326 | Ga0157380_10001161 | Ga0157380_1000116111 | 109 |
| 417 | 3300014326 | Ga0157380_10058444 | Ga0157380_100584442 | 109 |
| 418 | 3300014326 | Ga0157380_10340692 | Ga0157380_103406923 | 109 |
| 419 | 3300014968 | Ga0157379_10049804 | Ga0157379_100498042 | 109 |
| 420 | 3300014969 | Ga0157376_12284786 | Ga0157376_122847861 | 109 |
| 421 | 3300017792 | Ga0163161_10000101 | Ga0163161_1000010153 | 109 |
| 422 | 3300017792 | Ga0163161_10901068 | Ga0163161_109010682 | 109 |
| 423 | 3300020069 | Ga0197907_10257285 | Ga0197907_102572852 | 109 |
| 424 | 3300021388 | Ga0213875_10009905 | Ga0213875_100099056 | 109 |
| 425 | 3300025223 | Ga0207672_1000641 | Ga0207672_10006414 | 109 |
| 426 | 3300025245 | Ga0207425_1015629 | Ga0207425_10156294 | 109 |
| 427 | 3300025263 | Ga0209565_1000008 | Ga0209565_1000008632 | 109 |
| 428 | 3300025273 | Ga0209673_1002352 | Ga0209673_100235211 | 109 |
| 429 | 3300025291 | Ga0209675_1009250 | Ga0209675_10092506 | 109 |
| 430 | 3300025297 | Ga0209758_1012697 | Ga0209758_10126978 | 109 |
| 431 | 3300025298 | Ga0209050_1000581 | Ga0209050_100058117 | 109 |
| 432 | 3300025298 | Ga0209050_1007158 | Ga0209050_100715810 | 109 |
| 433 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009237 | 109 |
| 434 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010161 | 109 |
| 435 | 3300025303 | Ga0209051_1102885 | Ga0209051_11028852 | 109 |
| 436 | 3300025304 | Ga0209257_1002898 | Ga0209257_10028985 | 109 |
| 437 | 3300025304 | Ga0209257_1003401 | Ga0209257_10034015 | 109 |
| 438 | 3300025304 | Ga0209257_1090367 | Ga0209257_10903671 | 109 |
| 439 | 3300025315 | Ga0207697_10006525 | Ga0207697_100065256 | 109 |
| 440 | 3300025321 | Ga0207656_10012218 | Ga0207656_100122184 | 109 |
| 441 | 3300025900 | Ga0207710_10007240 | Ga0207710_100072404 | 109 |
| 442 | 3300025903 | Ga0207680_10000010 | Ga0207680_10000010155 | 109 |
| 443 | 3300025903 | Ga0207680_10000186 | Ga0207680_1000018615 | 109 |
| 444 | 3300025904 | Ga0207647_10000038 | Ga0207647_1000003819 | 109 |
| 445 | 3300025909 | Ga0207705_10135124 | Ga0207705_101351245 | 109 |
| 446 | 3300025910 | Ga0207684_10707388 | Ga0207684_107073881 | 109 |
| 447 | 3300025911 | Ga0207654_10000375 | Ga0207654_1000037526 | 109 |
| 448 | 3300025913 | Ga0207695_10001183 | Ga0207695_1000118320 | 109 |
| 449 | 3300025913 | Ga0207695_10016421 | Ga0207695_100164219 | 109 |
| 450 | 3300025913 | Ga0207695_10021724 | Ga0207695_100217243 | 109 |
| 451 | 3300025914 | Ga0207671_10001192 | Ga0207671_1000119215 | 109 |
| 452 | 3300025914 | Ga0207671_10027639 | Ga0207671_100276394 | 109 |
| 453 | 3300025919 | Ga0207657_10387615 | Ga0207657_103876152 | 109 |
| 454 | 3300025920 | Ga0207649_10150506 | Ga0207649_101505064 | 109 |
| 455 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002137 | 109 |
| 456 | 3300025923 | Ga0207681_10000005 | Ga0207681_10000005356 | 109 |
| 457 | 3300025923 | Ga0207681_10000183 | Ga0207681_1000018346 | 109 |
| 458 | 3300025923 | Ga0207681_10716631 | Ga0207681_107166312 | 109 |
| 459 | 3300025924 | Ga0207694_10002087 | Ga0207694_1000208715 | 109 |
| 460 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004362 | 109 |
| 461 | 3300025925 | Ga0207650_10002904 | Ga0207650_1000290410 | 109 |
| 462 | 3300025925 | Ga0207650_10006404 | Ga0207650_100064046 | 109 |
| 463 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002136 | 109 |
| 464 | 3300025931 | Ga0207644_10000067 | Ga0207644_1000006749 | 109 |
| 465 | 3300025931 | Ga0207644_10001857 | Ga0207644_100018572 | 109 |
| 466 | 3300025933 | Ga0207706_10015340 | Ga0207706_100153405 | 109 |
| 467 | 3300025933 | Ga0207706_10138164 | Ga0207706_101381642 | 109 |
| 468 | 3300025936 | Ga0207670_10083992 | Ga0207670_100839923 | 109 |
| 469 | 3300025940 | Ga0207691_11030603 | Ga0207691_110306031 | 109 |
| 470 | 3300025940 | Ga0207691_11267125 | Ga0207691_112671251 | 109 |
| 471 | 3300025941 | Ga0207711_10000075 | Ga0207711_1000007522 | 109 |
| 472 | 3300025941 | Ga0207711_10006118 | Ga0207711_100061189 | 109 |
| 473 | 3300025941 | Ga0207711_10024088 | Ga0207711_100240885 | 109 |
| 474 | 3300025941 | Ga0207711_10663848 | Ga0207711_106638481 | 109 |
| 475 | 3300025944 | Ga0207661_10482382 | Ga0207661_104823823 | 109 |
| 476 | 3300025945 | Ga0207679_10123611 | Ga0207679_101236112 | 109 |
| 477 | 3300025949 | Ga0207667_10011748 | Ga0207667_1001174810 | 109 |
| 478 | 3300025949 | Ga0207667_10498960 | Ga0207667_104989602 | 109 |
| 479 | 3300025961 | Ga0207712_10000014 | Ga0207712_10000014252 | 109 |
| 480 | 3300025961 | Ga0207712_10018137 | Ga0207712_100181376 | 109 |
| 481 | 3300025972 | Ga0207668_10000081 | Ga0207668_1000008159 | 109 |
| 482 | 3300025972 | Ga0207668_10005340 | Ga0207668_100053408 | 109 |
| 483 | 3300025972 | Ga0207668_10085277 | Ga0207668_100852771 | 109 |
| 484 | 3300025981 | Ga0207640_10031448 | Ga0207640_100314485 | 109 |
| 485 | 3300025981 | Ga0207640_10062003 | Ga0207640_100620032 | 109 |
| 486 | 3300025981 | Ga0207640_11683279 | Ga0207640_116832791 | 109 |
| 487 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002241 | 109 |
| 488 | 3300025986 | Ga0207658_10000069 | Ga0207658_10000069116 | 109 |
| 489 | 3300025986 | Ga0207658_10004095 | Ga0207658_100040956 | 109 |
| 490 | 3300025986 | Ga0207658_10008782 | Ga0207658_100087823 | 109 |
| 491 | 3300025986 | Ga0207658_10018656 | Ga0207658_100186563 | 109 |
| 492 | 3300026035 | Ga0207703_10005351 | Ga0207703_1000535110 | 109 |
| 493 | 3300026035 | Ga0207703_10008030 | Ga0207703_100080304 | 109 |
| 494 | 3300026035 | Ga0207703_10009134 | Ga0207703_100091347 | 109 |
| 495 | 3300026041 | Ga0207639_10187001 | Ga0207639_101870012 | 109 |
| 496 | 3300026041 | Ga0207639_10312608 | Ga0207639_103126082 | 109 |
| 497 | 3300026041 | Ga0207639_10602963 | Ga0207639_106029631 | 109 |
| 498 | 3300026041 | Ga0207639_11412677 | Ga0207639_114126772 | 109 |
| 499 | 3300026067 | Ga0207678_10088208 | Ga0207678_100882082 | 109 |
| 500 | 3300026067 | Ga0207678_10889898 | Ga0207678_108898983 | 109 |
| 501 | 3300026067 | Ga0207678_11627230 | Ga0207678_116272301 | 109 |
| 502 | 3300026078 | Ga0207702_10000887 | Ga0207702_1000088715 | 109 |
| 503 | 3300026088 | Ga0207641_10000099 | Ga0207641_1000009972 | 109 |
| 504 | 3300026088 | Ga0207641_10003319 | Ga0207641_100033197 | 109 |
| 505 | 3300026088 | Ga0207641_10004490 | Ga0207641_100044904 | 109 |
| 506 | 3300026088 | Ga0207641_10004505 | Ga0207641_100045058 | 109 |
| 507 | 3300026088 | Ga0207641_10013693 | Ga0207641_100136934 | 109 |
| 508 | 3300026088 | Ga0207641_10014410 | Ga0207641_1001441010 | 109 |
| 509 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006350 | 109 |
| 510 | 3300026095 | Ga0207676_10000770 | Ga0207676_100007704 | 109 |
| 511 | 3300026095 | Ga0207676_10022559 | Ga0207676_100225596 | 109 |
| 512 | 3300026095 | Ga0207676_10041840 | Ga0207676_100418404 | 109 |
| 513 | 3300026116 | Ga0207674_10016903 | Ga0207674_1001690310 | 109 |
| 514 | 3300026116 | Ga0207674_10202281 | Ga0207674_102022813 | 109 |
| 515 | 3300026116 | Ga0207674_12258894 | Ga0207674_122588941 | 109 |
| 516 | 3300026118 | Ga0207675_100000358 | Ga0207675_1000003585 | 109 |
| 517 | 3300026118 | Ga0207675_100001138 | Ga0207675_10000113820 | 109 |
| 518 | 3300026118 | Ga0207675_100001918 | Ga0207675_10000191824 | 109 |
| 519 | 3300026118 | Ga0207675_100230090 | Ga0207675_1002300905 | 109 |
| 520 | 3300026142 | Ga0207698_10130218 | Ga0207698_101302185 | 109 |
| 521 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009171 | 109 |
| 522 | 3300028379 | Ga0268266_10211526 | Ga0268266_102115265 | 109 |
| 523 | 3300028379 | Ga0268266_10315170 | Ga0268266_103151704 | 109 |
| 524 | 3300028379 | Ga0268266_11019591 | Ga0268266_110195912 | 109 |
| 525 | 3300028379 | Ga0268266_11068863 | Ga0268266_110688631 | 109 |
| 526 | 3300028379 | Ga0268266_11514040 | Ga0268266_115140401 | 109 |
| 527 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001811 | 109 |
| 528 | 3300028380 | Ga0268265_10000047 | Ga0268265_1000004777 | 109 |
| 529 | 3300028380 | Ga0268265_10000285 | Ga0268265_1000028539 | 109 |
| 530 | 3300028380 | Ga0268265_10004726 | Ga0268265_100047266 | 109 |
| 531 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001566 | 109 |
| 532 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010354 | 109 |
| 533 | 3300028381 | Ga0268264_10000023 | Ga0268264_10000023113 | 109 |
| 534 | 3300028381 | Ga0268264_10000217 | Ga0268264_10000217116 | 109 |
| 535 | 3300028786 | Ga0307517_10024293 | Ga0307517_1002429311 | 109 |
| 536 | 3300030733 | Ga0314311_1203820 | Ga0314311_12038203 | 109 |
| 537 | 3300031548 | Ga0307408_100388134 | Ga0307408_1003881344 | 109 |
| 538 | 3300031548 | Ga0307408_100545382 | Ga0307408_1005453823 | 109 |
| 539 | 3300031731 | Ga0307405_10165710 | Ga0307405_101657103 | 109 |
| 540 | 3300031731 | Ga0307405_10530365 | Ga0307405_105303653 | 109 |
| 541 | 3300031731 | Ga0307405_11134964 | Ga0307405_111349642 | 109 |
| 542 | 3300031731 | Ga0307405_11173503 | Ga0307405_111735031 | 109 |
| 543 | 3300031731 | Ga0307405_11848273 | Ga0307405_118482731 | 109 |
| 544 | 3300031824 | Ga0307413_11727913 | Ga0307413_117279132 | 109 |
| 545 | 3300031901 | Ga0307406_10071868 | Ga0307406_100718682 | 109 |
| 546 | 3300031901 | Ga0307406_10683111 | Ga0307406_106831112 | 109 |
| 547 | 3300031911 | Ga0307412_10075035 | Ga0307412_100750352 | 109 |
| 548 | 3300031911 | Ga0307412_11563801 | Ga0307412_115638012 | 109 |
| 549 | 3300032002 | Ga0307416_101827298 | Ga0307416_1018272982 | 109 |
| 550 | 3300032126 | Ga0307415_100438347 | Ga0307415_1004383472 | 109 |
| 551 | 3300032126 | Ga0307415_101294198 | Ga0307415_1012941982 | 109 |
| 552 | 3300037853 | Ga0436364_0741438 | Ga0436364_0741438_409_741 | 109 |
| 553 | 3300041404 | Ga0439436_0045695 | Ga0439436_0045695_302_634 | 109 |
| 554 | 3300041406 | Ga0439439_0001779 | Ga0439439_0001779_2929_3261 | 109 |
| 555 | 3300041406 | Ga0439439_0134264 | Ga0439439_0134264_282_614 | 109 |
| 556 | 3300041410 | Ga0439461_0000498 | Ga0439461_0000498_4439_4771 | 109 |
| 557 | 3300041410 | Ga0439461_0080904 | Ga0439461_0080904_312_644 | 109 |
| 558 | 3300041413 | Ga0439465_0004274 | Ga0439465_0004274_2725_3057 | 109 |
| 559 | 3300041452 | Ga0451793_1471615 | Ga0451793_1471615_310_639 | 109 |
| 560 | 3300041997 | Ga0439431_0000140 | Ga0439431_0000140_12095_12427 | 109 |
| 561 | 3300041997 | Ga0439431_0010888 | Ga0439431_0010888_1629_1961 | 109 |
| 562 | 3300042002 | Ga0439442_013335 | Ga0439442_013335_137_469 | 109 |
| 563 | 3300042004 | Ga0439445_0033115 | Ga0439445_0033115_385_717 | 109 |
| 564 | 3300042004 | Ga0439445_0142362 | Ga0439445_0142362_171_503 | 109 |
| 565 | 3300042006 | Ga0439432_000640 | Ga0439432_000640_10983_11315 | 109 |
| 566 | 3300042010 | Ga0439452_018803 | Ga0439452_018803_1126_1458 | 109 |
| 567 | 3300042015 | Ga0439462_0002776 | Ga0439462_0002776_1149_1481 | 109 |
| 568 | 3300042435 | Ga0439434_0006562 | Ga0439434_0006562_1732_2064 | 109 |
| 569 | 3300044735 | Ga0466968_0038917 | Ga0466968_0038917_1352_1687 | 109 |
| 570 | 3300046513 | Ga0495616_0001456 | Ga0495616_0001456_5067_5399 | 109 |
| 571 | 3300046519 | Ga0495632_0253925 | Ga0495632_0253925_148_483 | 109 |
| 572 | 3300046519 | Ga0495632_0317276 | Ga0495632_0317276_324_656 | 109 |
| 573 | 3300046522 | Ga0495643_0460184 | Ga0495643_0460184_174_506 | 109 |
| 574 | 3300046524 | Ga0495648_0042423 | Ga0495648_0042423_1086_1415 | 109 |
| 575 | 3300046525 | Ga0495663_0044618 | Ga0495663_0044618_803_1135 | 109 |
| 576 | 3300046530 | Ga0495654_0001073 | Ga0495654_0001073_15606_15938 | 109 |
| 577 | 3300046530 | Ga0495654_0116202 | Ga0495654_0116202_768_1103 | 109 |
| 578 | 3300046542 | Ga0495597_0031259 | Ga0495597_0031259_976_1305 | 109 |
| 579 | 3300046616 | Ga0495668_0002221 | Ga0495668_0002221_15041_15373 | 109 |
| 580 | 3300046616 | Ga0495668_0011998 | Ga0495668_0011998_2318_2650 | 109 |
| 581 | 3300046794 | Ga0495589_0067756 | Ga0495589_0067756_422_754 | 109 |
| 582 | 3300047472 | Ga0495686_0001246 | Ga0495686_0001246_25879_26214 | 109 |
| 583 | 3300048904 | Ga0496101_0346342 | Ga0496101_0346342_529_861 | 109 |
| 584 | 3300048905 | Ga0496102_0000069 | Ga0496102_0000069_59827_60156 | 109 |
| 585 | 3300048905 | Ga0496102_0172254 | Ga0496102_0172254_1313_1645 | 109 |
| 586 | 3300048906 | Ga0496103_0000173 | Ga0496103_0000173_18419_18748 | 109 |
| 587 | 3300048906 | Ga0496103_0033025 | Ga0496103_0033025_2491_2823 | 109 |
| 588 | 3300048907 | Ga0496104_0059792 | Ga0496104_0059792_1015_1347 | 109 |
| 589 | 3300048908 | Ga0496105_1191995 | Ga0496105_1191995_59_388 | 109 |
| 590 | 3300048909 | Ga0496106_0076352 | Ga0496106_0076352_825_1157 | 109 |
| 591 | 3300048910 | Ga0496107_0252341 | Ga0496107_0252341_433_765 | 109 |
| 592 | 3300048910 | Ga0496107_1217068 | Ga0496107_1217068_67_408 | 109 |
| 593 | 3300048916 | Ga0496113_0519615 | Ga0496113_0519615_506_841 | 109 |
| 594 | 3300048919 | Ga0496116_0000566 | Ga0496116_0000566_9649_9978 | 109 |
| 595 | 3300048919 | Ga0496116_0032138 | Ga0496116_0032138_2062_2394 | 109 |
| 596 | 3300048920 | Ga0496117_0000485 | Ga0496117_0000485_47862_48191 | 109 |
| 597 | 3300048920 | Ga0496117_0089533 | Ga0496117_0089533_369_704 | 109 |
| 598 | 3300048920 | Ga0496117_0231937 | Ga0496117_0231937_559_891 | 109 |
| 599 | 3300048921 | Ga0496118_0000190 | Ga0496118_0000190_47862_48191 | 109 |
| 600 | 3300048921 | Ga0496118_0015970 | Ga0496118_0015970_977_1312 | 109 |
| 601 | 3300048921 | Ga0496118_0079363 | Ga0496118_0079363_683_1015 | 109 |
| 602 | 3300048922 | Ga0496119_0038129 | Ga0496119_0038129_717_1052 | 109 |
| 603 | 3300048922 | Ga0496119_0072971 | Ga0496119_0072971_663_995 | 109 |
| 604 | 3300048923 | Ga0496120_0110614 | Ga0496120_0110614_1013_1342 | 109 |
| 605 | 3300048923 | Ga0496120_0178484 | Ga0496120_0178484_53_385 | 109 |
| 606 | 3300048924 | Ga0496121_0010499 | Ga0496121_0010499_7704_8039 | 109 |
| 607 | 3300048924 | Ga0496121_0058069 | Ga0496121_0058069_306_638 | 109 |
| 608 | 3300048927 | Ga0496124_0000546 | Ga0496124_0000546_15434_15763 | 109 |
| 609 | 3300048927 | Ga0496124_0081473 | Ga0496124_0081473_892_1224 | 109 |
| 610 | 3300048928 | Ga0496125_0286884 | Ga0496125_0286884_158_493 | 109 |
| 611 | 3300048929 | Ga0496126_0016996 | Ga0496126_0016996_2164_2499 | 109 |
| 612 | 3300048929 | Ga0496126_0150910 | Ga0496126_0150910_700_1032 | 109 |
| 613 | 3300049127 | Ga0501306_009105 | Ga0501306_009105_416_745 | 109 |
| 614 | 3300049161 | Ga0501305_021695 | Ga0501305_021695_305_634 | 109 |
| 615 | 3300049162 | Ga0501307_005380 | Ga0501307_005380_383_712 | 109 |
| 616 | 3300049513 | Ga0501290_000237 | Ga0501290_000237_4696_5031 | 109 |
| 617 | 3300049515 | Ga0501292_000042 | Ga0501292_000042_28170_28505 | 109 |
| 618 | 3300049516 | Ga0501293_018406 | Ga0501293_018406_64_393 | 109 |
| 619 | 3300049520 | Ga0501297_009582 | Ga0501297_009582_628_963 | 109 |
| 620 | 3300049521 | Ga0501298_063023 | Ga0501298_063023_88_417 | 109 |
| 621 | 3300049527 | Ga0501311_027272 | Ga0501311_027272_385_714 | 109 |
| 622 | 3300049528 | Ga0501312_025302 | Ga0501312_025302_170_499 | 109 |
| 623 | 3300049529 | Ga0501313_020213 | Ga0501313_020213_175_504 | 109 |
| 624 | 3300049531 | Ga0501315_000962 | Ga0501315_000962_751_1086 | 109 |
| 625 | 3300049531 | Ga0501315_046231 | Ga0501315_046231_318_650 | 109 |
| 626 | 3300049533 | Ga0501317_002915 | Ga0501317_002915_770_1105 | 109 |
| 627 | 3300049536 | Ga0501320_006506 | Ga0501320_006506_538_867 | 109 |
| 628 | 3300049551 | Ga0501335_013930 | Ga0501335_013930_340_672 | 109 |
| 629 | 3300049569 | Ga0501032_0113352 | Ga0501032_0113352_96_425 | 109 |
| 630 | 3300049575 | Ga0501039_1595636 | Ga0501039_1595636_110_445 | 109 |
| 631 | 3300049578 | Ga0501042_0260954 | Ga0501042_0260954_626_955 | 109 |
| 632 | 3300049579 | Ga0501043_0049166 | Ga0501043_0049166_1983_2318 | 109 |
| 633 | 3300049579 | Ga0501043_0113159 | Ga0501043_0113159_1354_1683 | 109 |
| 634 | 3300049580 | Ga0501046_0030454 | Ga0501046_0030454_2308_2637 | 109 |
| 635 | 3300049581 | Ga0501047_0000731 | Ga0501047_0000731_8945_9274 | 109 |
| 636 | 3300049581 | Ga0501047_0885518 | Ga0501047_0885518_63_392 | 109 |
| 637 | 3300049653 | Ga0501206_008325 | Ga0501206_008325_116_451 | 109 |
| 638 | 3300049662 | Ga0501222_001746 | Ga0501222_001746_1282_1617 | 109 |
| 639 | 3300049663 | Ga0501223_004016 | Ga0501223_004016_1882_2217 | 109 |
| 640 | 3300049664 | Ga0501224_000754 | Ga0501224_000754_2739_3074 | 109 |
| 641 | 3300049665 | Ga0501227_028030 | Ga0501227_028030_297_632 | 109 |
| 642 | 3300049669 | Ga0501235_001097 | Ga0501235_001097_575_910 | 109 |
| 643 | 3300049679 | Ga0501249_000213 | Ga0501249_000213_16367_16696 | 109 |
| 644 | 3300049686 | Ga0501257_000049 | Ga0501257_000049_24640_24969 | 109 |
| 645 | 3300049686 | Ga0501257_013441 | Ga0501257_013441_245_580 | 109 |
| 646 | 3300049688 | Ga0501259_001391 | Ga0501259_001391_1017_1352 | 109 |
| 647 | 3300049690 | Ga0501261_000021 | Ga0501261_000021_24455_24790 | 109 |
| 648 | 3300049704 | Ga0501221_259218 | Ga0501221_259218_114_446 | 109 |
| 649 | 3300049705 | Ga0501225_0006973 | Ga0501225_0006973_2638_2970 | 109 |
| 650 | 3300049705 | Ga0501225_0071549 | Ga0501225_0071549_304_636 | 109 |
| 651 | 3300049707 | Ga0501234_068536 | Ga0501234_068536_89_424 | 109 |
| 652 | 3300049758 | Ga0501241_024823 | Ga0501241_024823_465_797 | 109 |
| 653 | 3300049775 | Ga0501279_000010 | Ga0501279_000010_9706_10041 | 109 |
| 654 | 3300049776 | Ga0501280_000064 | Ga0501280_000064_12340_12675 | 109 |
| 655 | 3300049776 | Ga0501280_001057 | Ga0501280_001057_628_957 | 109 |
| 656 | 3300049778 | Ga0501282_000404 | Ga0501282_000404_673_1008 | 109 |
| 657 | 3300049779 | Ga0501283_001453 | Ga0501283_001453_487_822 | 109 |
| 658 | 3300049822 | Ga0501035_0244287 | Ga0501035_0244287_241_570 | 109 |
| 659 | 3300049823 | Ga0501044_0074300 | Ga0501044_0074300_2100_2435 | 109 |
| 660 | 3300049850 | Ga0501204_000430 | Ga0501204_000430_824_1153 | 109 |
| 661 | 3300053087 | Ga0500643_000135 | Ga0500643_000135_50354_50686 | 109 |
| 662 | 3300053087 | Ga0500643_000195 | Ga0500643_000195_54427_54762 | 109 |
| 663 | 3300053091 | Ga0500647_0137576 | Ga0500647_0137576_572_904 | 109 |
| 664 | 3300053093 | Ga0500651_0086862 | Ga0500651_0086862_690_1019 | 109 |
| 665 | 3300053094 | Ga0500566_0004538 | Ga0500566_0004538_7188_7520 | 109 |
| 666 | 3300053108 | Ga0500562_040866 | Ga0500562_040866_135_467 | 109 |
| 667 | 3300053116 | Ga0500592_000031 | Ga0500592_000031_4783_5118 | 109 |
| 668 | 3300053125 | Ga0500618_014810 | Ga0500618_014810_730_1059 | 109 |
| 669 | 3300053128 | Ga0500626_092170 | Ga0500626_092170_108_440 | 109 |
| 670 | 3300053130 | Ga0500642_0014296 | Ga0500642_0014296_1876_2205 | 109 |
| 671 | 3300053131 | Ga0500652_278543 | Ga0500652_278543_43_372 | 109 |
| 672 | 3300053131 | Ga0500652_371382 | Ga0500652_371382_15_347 | 109 |
| 673 | 3300053133 | Ga0500655_000251 | Ga0500655_000251_8400_8729 | 109 |
| 674 | 3300053148 | Ga0500590_000131 | Ga0500590_000131_7658_7987 | 109 |
| 675 | 3300053151 | Ga0500604_0036484 | Ga0500604_0036484_1084_1416 | 109 |
| 676 | 3300053151 | Ga0500604_0039631 | Ga0500604_0039631_575_907 | 109 |
| 677 | 3300053151 | Ga0500604_0071415 | Ga0500604_0071415_82_417 | 109 |
| 678 | 3300053151 | Ga0500604_0194406 | Ga0500604_0194406_175_507 | 109 |
| 679 | 3300053153 | Ga0500616_0008241 | Ga0500616_0008241_2430_2765 | 109 |
| 680 | 3300053156 | Ga0500622_0025695 | Ga0500622_0025695_48_377 | 109 |
| 681 | 3300053156 | Ga0500622_0091256 | Ga0500622_0091256_415_750 | 109 |
| 682 | 3300053158 | Ga0500627_0000570 | Ga0500627_0000570_6969_7301 | 109 |
| 683 | 3300053158 | Ga0500627_0001223 | Ga0500627_0001223_5749_6084 | 109 |
| 684 | 3300053158 | Ga0500627_0027041 | Ga0500627_0027041_638_970 | 109 |
| 685 | 3300053163 | Ga0500639_139272 | Ga0500639_139272_25_354 | 109 |
| 686 | 3300053177 | Ga0500636_0058873 | Ga0500636_0058873_1684_2016 | 109 |
| 687 | 3300053177 | Ga0500636_0230432 | Ga0500636_0230432_477_806 | 109 |
| 688 | 3300053724 | Ga0500570_004079 | Ga0500570_004079_2738_3067 | 109 |
| 689 | 3300059604 | Ga0587098_059728 | Ga0587098_059728_33_365 | 109 |
| 690 | 2162886007 | SwRhRL2b_contig_944437 | SwRhRL2b_0442.00002650 | 110 |
| 691 | 3300001976 | JGI24752J21851_1000644 | JGI24752J21851_10006446 | 110 |
| 692 | 3300005289 | Ga0065704_10124492 | Ga0065704_101244921 | 110 |
| 693 | 3300005331 | Ga0070670_100000021 | Ga0070670_100000021196 | 110 |
| 694 | 3300005367 | Ga0070667_100000642 | Ga0070667_10000064227 | 110 |
| 695 | 3300005577 | Ga0068857_100021366 | Ga0068857_1000213665 | 110 |
| 696 | 3300005617 | Ga0068859_100042554 | Ga0068859_1000425545 | 110 |
| 697 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004159 | 110 |
| 698 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002160 | 110 |
| 699 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002342 | 110 |
| 700 | 3300006931 | Ga0097620_100042555 | Ga0097620_1000425555 | 110 |
| 701 | 3300009011 | Ga0105251_10001284 | Ga0105251_1000128421 | 110 |
| 702 | 3300009092 | Ga0105250_10487276 | Ga0105250_104872761 | 110 |
| 703 | 3300009177 | Ga0105248_10000010 | Ga0105248_10000010185 | 110 |
| 704 | 3300009177 | Ga0105248_10001558 | Ga0105248_1000155814 | 110 |
| 705 | 3300009177 | Ga0105248_10008696 | Ga0105248_100086969 | 110 |
| 706 | 3300009553 | Ga0105249_10000041 | Ga0105249_10000041127 | 110 |
| 707 | 3300009553 | Ga0105249_10019753 | Ga0105249_100197536 | 110 |
| 708 | 3300013100 | Ga0157373_10428844 | Ga0157373_104288442 | 110 |
| 709 | 3300013306 | Ga0163162_10019579 | Ga0163162_100195798 | 110 |
| 710 | 3300014325 | Ga0163163_10030114 | Ga0163163_100301145 | 110 |
| 711 | 3300014326 | Ga0157380_10808594 | Ga0157380_108085942 | 110 |
| 712 | 3300014968 | Ga0157379_10051644 | Ga0157379_100516441 | 110 |
| 713 | 3300014968 | Ga0157379_10128162 | Ga0157379_101281623 | 110 |
| 714 | 3300025735 | Ga0207713_1001586 | Ga0207713_100158619 | 110 |
| 715 | 3300025925 | Ga0207650_10000083 | Ga0207650_1000008333 | 110 |
| 716 | 3300025941 | Ga0207711_10000035 | Ga0207711_1000003522 | 110 |
| 717 | 3300025961 | Ga0207712_10000620 | Ga0207712_1000062015 | 110 |
| 718 | 3300025986 | Ga0207658_10000388 | Ga0207658_1000038837 | 110 |
| 719 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002640 | 110 |
| 720 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005167 | 110 |
| 721 | 3300026116 | Ga0207674_10131652 | Ga0207674_101316522 | 110 |
| 722 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003349 | 110 |
| 723 | 3300031901 | Ga0307406_10114532 | Ga0307406_101145322 | 110 |
| 724 | 3300044765 | Ga0466970_0632016 | Ga0466970_0632016_117_458 | 110 |
| 725 | 3300048903 | Ga0496100_0652598 | Ga0496100_0652598_395_742 | 110 |
| 726 | 3300048906 | Ga0496103_0030066 | Ga0496103_0030066_1803_2135 | 110 |
| 727 | 3300048910 | Ga0496107_0173558 | Ga0496107_0173558_444_791 | 110 |
| 728 | 3300048920 | Ga0496117_0018342 | Ga0496117_0018342_3290_3622 | 110 |
| 729 | 3300048921 | Ga0496118_0000463 | Ga0496118_0000463_65072_65404 | 110 |
| 730 | 3300048924 | Ga0496121_0016723 | Ga0496121_0016723_4841_5179 | 110 |
| 731 | 3300048924 | Ga0496121_0295366 | Ga0496121_0295366_455_787 | 110 |
| 732 | 3300049516 | Ga0501293_008149 | Ga0501293_008149_247_585 | 110 |
| 733 | 3300049517 | Ga0501294_000032 | Ga0501294_000032_2304_2642 | 110 |
| 734 | 3300049523 | Ga0501300_000392 | Ga0501300_000392_5911_6249 | 110 |
| 735 | 3300049551 | Ga0501335_029598 | Ga0501335_029598_171_509 | 110 |
| 736 | 3300049652 | Ga0501202_063125 | Ga0501202_063125_253_591 | 110 |
| 737 | 3300049654 | Ga0501207_021740 | Ga0501207_021740_615_953 | 110 |
| 738 | 3300049668 | Ga0501233_012436 | Ga0501233_012436_918_1256 | 110 |
| 739 | 3300049670 | Ga0501236_053975 | Ga0501236_053975_67_405 | 110 |
| 740 | 3300049704 | Ga0501221_003846 | Ga0501221_003846_380_718 | 110 |
| 741 | 3300049705 | Ga0501225_0043405 | Ga0501225_0043405_450_788 | 110 |
| 742 | 3300049708 | Ga0501245_001378 | Ga0501245_001378_2557_2895 | 110 |
| 743 | 3300049761 | Ga0501264_008163 | Ga0501264_008163_598_936 | 110 |
| 744 | 3300049773 | Ga0501276_013553 | Ga0501276_013553_81_419 | 110 |
| 745 | 3300049777 | Ga0501281_00086 | Ga0501281_00086_966_1304 | 110 |
| 746 | 3300053116 | Ga0500592_001156 | Ga0500592_001156_2527_2862 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zyw-assembly1.cif.gz_A | crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) | 0.9678 | 5 | 100 |
| 2mma-assembly1.cif.gz_A | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.9603 | 1 | 105 |
| 2yan-assembly2.cif.gz_B | crystal structure of the second glutaredoxin domain of human txnl2 | 0.9532 | 5 | 104 |
| 2wul-assembly1.cif.gz_D | crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster | 0.9524 | 7 | 110 |
| 3gx8-assembly1.cif.gz_A | structural and biochemical characterization of yeast monothiol glutaredoxin grx5 | 0.9502 | 4 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSR7_119_214_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9948 | 9 | 100 | 3.40.30.10 |
| af_A0A1D6ETY4_422_499_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.986 | 9 | 85 | 3.40.30.10 |
| af_Q4CNA8_28_125_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9844 | 10 | 105 | 3.40.30.10 |
| af_Q8IBZ7_179_272_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.984 | 12 | 100 | 3.40.30.10 |
| af_O97232_76_171_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9826 | 10 | 100 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258I2M9-F1-model_v4 | Glutaredoxin | 1.003 | 6 | 110 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A3B9AYU0-F1-model_v4 | deleted | 1.003 | 5 | 98 |
|
| AF-A7IMR7-F1-model_v4 | Glutaredoxin | 1.002 | 6 | 108 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A7S3K0F1-F1-model_v4 | Glutaredoxin domain-containing protein | 1.002 | 4 | 88 |
GO:0005759
GO:0046872 GO:0051537 |
| AF-A0A7R9W3H0-F1-model_v4 | Glutaredoxin domain-containing protein | 0.9997 | 1 | 100 |
GO:0005759
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar