F478781

General Info

Members Datasets Scaffolds Average Seq Length
745 367 1491 86

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10292388|Ga0070658_102923882
Length 95
Sequence MHSGLERAREMSAIIYSLCAATALVCACMLLSGYWRQNYRLLLWSGLCFAGLTLNNLLLVVDKVLLPEVDLSLWRTSVALISMIVLLYGLIWDME

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
83 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
197 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
198 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
199 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
202 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
257 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
258 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
259 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
260 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
261 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
262 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
263 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
289 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
290 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
291 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
292 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
293 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
294 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
295 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
296 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
297 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
298 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
299 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
300 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
301 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
302 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
303 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
304 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
305 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
306 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
307 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
308 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
316 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
317 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
318 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
319 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
320 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
321 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
322 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
323 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
324 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
325 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
339 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
340 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
346 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
353 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
354 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
355 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
356 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
364 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
365 2738541300 Massilia sp. GV016 Isolate Unclassified
366 2738543018 Massilia sp. GV045 Isolate Unclassified
367 2738543030 Massilia sp. GV097 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.4
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 1.34
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 28.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10292388 3300005327 Bacteria 1388
2 rootH1_10118784 3300003316 Bacteria 1134
3 rootH1_10118784 3300003323 Unclassified 1831
4 rootH2_10030263 3300003320 Bacteria 13059
5 rootH2_10131974 3300003320 Bacteria 1798
6 rootH2_10181915 3300003320 Bacteria 6096
7 rootH2_10320555 3300003320 Unclassified 1151
8 rootL2_10180144 3300003322 Bacteria 2134
9 rootL2_10211209 3300003322 Unclassified 1274
10 rootH1_10007381 3300003323 Bacteria 1599
11 rootH1_10052430 3300003323 Bacteria 3891
12 rootH1_10225615 3300003323 Bacteria 1129
13 Ga0070658_10019362 3300005327 Bacteria 5451
14 Ga0070658_11632665 3300005327 Unclassified 558
15 Ga0070676_10795725 3300005328 Unclassified 697
16 Ga0070683_100140667 3300005329 Bacteria 2287
17 Ga0070683_100842435 3300005329 Unclassified 879
18 Ga0070683_101494679 3300005329 Unclassified 649
19 Ga0070690_100089951 3300005330 Bacteria 2020
20 Ga0070670_100067057 3300005331 Bacteria 3080
21 Ga0068869_100079823 3300005334 Bacteria 2439
22 Ga0070666_10007725 3300005335 Bacteria 6640
23 Ga0070666_10017120 3300005335 Bacteria 4645
24 Ga0070666_10597381 3300005335 Bacteria 805
25 Ga0070666_10862654 3300005335 Bacteria 668
26 Ga0070680_100062558 3300005336 Bacteria 3048
27 Ga0070680_100174647 3300005336 Bacteria 1809
28 Ga0070680_100773526 3300005336 Bacteria 827
29 Ga0070682_100001461 3300005337 Bacteria 13260
30 Ga0070682_101572835 3300005337 Bacteria 567
31 Ga0068868_100043411 3300005338 Bacteria 3512
32 Ga0068868_100825859 3300005338 Bacteria 838
33 Ga0070660_100001736 3300005339 Bacteria 14950
34 Ga0070660_100039372 3300005339 Bacteria 3593
35 Ga0070660_100081917 3300005339 Bacteria 2533
36 Ga0070660_100368369 3300005339 Bacteria 1185
37 Ga0070660_101393993 3300005339 Unclassified 595
38 Ga0070689_100750536 3300005340 Unclassified 855
39 Ga0070689_101795334 3300005340 Unclassified 559
40 Ga0070691_10062657 3300005341 Bacteria 1791
41 Ga0070661_100123254 3300005344 Bacteria 1942
42 Ga0070661_100557396 3300005344 Bacteria 923
43 Ga0070661_100825401 3300005344 Unclassified 762
44 Ga0070661_100972063 3300005344 Unclassified 703
45 Ga0070692_10246111 3300005345 Bacteria 1068
46 Ga0070668_101475367 3300005347 Unclassified 621
47 Ga0070671_100055483 3300005355 Bacteria 3296
48 Ga0070671_100811193 3300005355 Bacteria 815
49 Ga0070674_101173629 3300005356 Unclassified 681
50 Ga0070659_101324417 3300005366 Unclassified 639
51 Ga0070667_100029754 3300005367 Bacteria 4553
52 Ga0070667_100778743 3300005367 Bacteria 887
53 Ga0070667_101393311 3300005367 Bacteria 658
54 Ga0070713_101145166 3300005436 Bacteria 752
55 Ga0070705_100086660 3300005440 Bacteria 1939
56 Ga0070705_101908757 3300005440 Unclassified 505
57 Ga0070678_100006697 3300005456 Bacteria 6784
58 Ga0070678_100033835 3300005456 Bacteria 3553
59 Ga0070678_100739389 3300005456 Unclassified 889
60 Ga0070678_101308697 3300005456 Bacteria 674
61 Ga0070662_100004066 3300005457 Bacteria 9192
62 Ga0070662_100273139 3300005457 Bacteria 1365
63 Ga0070662_100316616 3300005457 Bacteria 1271
64 Ga0070681_10499994 3300005458 Bacteria 1129
65 Ga0070681_10638407 3300005458 Unclassified 980
66 Ga0070681_11392370 3300005458 Bacteria 625
67 Ga0070681_11537185 3300005458 Bacteria 590
68 Ga0070681_11578690 3300005458 Unclassified 581
69 Ga0068867_100490310 3300005459 Unclassified 1054
70 Ga0070685_11380750 3300005466 Unclassified 540
71 Ga0070679_100029565 3300005530 Bacteria 5406
72 Ga0070679_100270413 3300005530 Unclassified 1654
73 Ga0070679_100447828 3300005530 Unclassified 1236
74 Ga0070684_100043554 3300005535 Bacteria 3877
75 Ga0070684_100936329 3300005535 Unclassified 812
76 Ga0068853_100112537 3300005539 Bacteria 2419
77 Ga0068853_100134907 3300005539 Bacteria 2212
78 Ga0068853_100559273 3300005539 Bacteria 1084
79 Ga0068853_100679470 3300005539 Unclassified 981
80 Ga0070672_102054673 3300005543 Unclassified 515
81 Ga0070686_101371161 3300005544 Bacteria 592
82 Ga0070693_100215621 3300005547 Bacteria 1255
83 Ga0070665_100018314 3300005548 Bacteria 7020
84 Ga0070665_100029825 3300005548 Bacteria 5489
85 Ga0070665_100034575 3300005548 Bacteria 5082
86 Ga0070665_100045787 3300005548 Bacteria 4393
87 Ga0070665_100262334 3300005548 Bacteria 1729
88 Ga0068855_100053704 3300005563 Bacteria 4739
89 Ga0068855_100072858 3300005563 Bacteria 3992
90 Ga0068855_101852321 3300005563 Bacteria 612
91 Ga0070664_100012736 3300005564 Bacteria 6843
92 Ga0070664_101636175 3300005564 Unclassified 610
93 Ga0068857_100569882 3300005577 Bacteria 1068
94 Ga0068857_101459701 3300005577 Bacteria 666
95 Ga0068857_101924981 3300005577 Unclassified 579
96 Ga0068854_100169036 3300005578 Bacteria 1700
97 Ga0068854_101418124 3300005578 Unclassified 628
98 Ga0068856_100081788 3300005614 Bacteria 3205
99 Ga0068856_100263569 3300005614 Unclassified 1739
100 Ga0068856_100577830 3300005614 Unclassified 1145
101 Ga0070702_100082386 3300005615 Bacteria 1930
102 Ga0070702_100536523 3300005615 Bacteria 866
103 Ga0068852_100002916 3300005616 Bacteria 11878
104 Ga0068852_100328381 3300005616 Unclassified 1487
105 Ga0068859_100737747 3300005617 Bacteria 1074
106 Ga0068859_101097950 3300005617 Bacteria 875
107 Ga0068864_100872173 3300005618 Bacteria 888
108 Ga0068864_101134080 3300005618 Unclassified 779
109 Ga0068866_10799303 3300005718 Bacteria 655
110 Ga0068861_100084560 3300005719 Unclassified 2491
111 Ga0068861_100515744 3300005719 Bacteria 1083
112 Ga0068861_100522092 3300005719 Bacteria 1077
113 Ga0068851_10008911 3300005834 Bacteria 4653
114 Ga0068851_10245111 3300005834 Bacteria 1015
115 Ga0068851_10850221 3300005834 Unclassified 569
116 Ga0068870_10008064 3300005840 Bacteria 4719
117 Ga0068863_100144307 3300005841 Bacteria 2276
118 Ga0068863_102329101 3300005841 Unclassified 545
119 Ga0068858_100025035 3300005842 Bacteria 5553
120 Ga0068858_101157146 3300005842 Bacteria 760
121 Ga0068858_101399049 3300005842 Bacteria 689
122 Ga0068860_100053160 3300005843 Bacteria 3852
123 Ga0068860_100298956 3300005843 Bacteria 1576
124 Ga0068860_100685311 3300005843 Bacteria 1034
125 Ga0068862_100033951 3300005844 Bacteria 4315
126 Ga0068862_100096066 3300005844 Bacteria 2586
127 Ga0068862_101609208 3300005844 Bacteria 657
128 Ga0081455_10257287 3300005937 Bacteria 1273
129 Ga0081455_10382330 3300005937 Bacteria 983
130 Ga0081455_11019343 3300005937 Unclassified 512
131 Ga0081538_10005274 3300005981 Bacteria 11666
132 Ga0081540_1002217 3300005983 Bacteria 16033
133 Ga0075365_11129296 3300006038 Unclassified 552
134 Ga0070712_100672001 3300006175 Bacteria 881
135 Ga0070712_101883440 3300006175 Bacteria 524
136 Ga0075362_10330953 3300006177 Unclassified 760
137 Ga0075366_10560371 3300006195 Unclassified 708
138 Ga0097621_100023872 3300006237 Bacteria 4767
139 Ga0097621_100048974 3300006237 Bacteria 3431
140 Ga0097621_100091415 3300006237 Bacteria 2547
141 Ga0097621_100118877 3300006237 Bacteria 2240
142 Ga0097621_100399683 3300006237 Unclassified 1230
143 Ga0097621_101434075 3300006237 Unclassified 654
144 Ga0097621_101592159 3300006237 Unclassified 621
145 Ga0097621_102140767 3300006237 Unclassified 535
146 Ga0075370_10293515 3300006353 Unclassified 966
147 Ga0068871_100148925 3300006358 Unclassified 1995
148 Ga0068871_100428289 3300006358 Bacteria 1183
149 Ga0068871_100984462 3300006358 Unclassified 785
150 Ga0075428_100007347 3300006844 Bacteria 12210
151 Ga0075430_100117524 3300006846 Unclassified 2217
152 Ga0075429_100035604 3300006880 Bacteria 4330
153 Ga0075429_101605024 3300006880 Bacteria 565
154 Ga0068865_100173560 3300006881 Bacteria 1655
155 Ga0068865_100236578 3300006881 Unclassified 1435
156 Ga0097620_100737680 3300006931 Bacteria 1074
157 Ga0097620_101098023 3300006931 Bacteria 875
158 Ga0075435_100833329 3300007076 Unclassified 803
159 Ga0105240_10020426 3300009093 Bacteria 8834
160 Ga0105240_10022197 3300009093 Bacteria 8419
161 Ga0105240_10027089 3300009093 Bacteria 7510
162 Ga0105240_10173560 3300009093 Bacteria 2550
163 Ga0105240_10355467 3300009093 Bacteria 1661
164 Ga0105240_10682076 3300009093 Unclassified 1123
165 Ga0105240_11144763 3300009093 Bacteria 826
166 Ga0105240_11636357 3300009093 Unclassified 673
167 Ga0105240_12717551 3300009093 Unclassified 510
168 Ga0111539_10013189 3300009094 Bacteria 10333
169 Ga0111539_10888675 3300009094 Unclassified 1036
170 Ga0105245_10006411 3300009098 Bacteria 10354
171 Ga0105247_10333254 3300009101 Bacteria 1062
172 Ga0105247_10735464 3300009101 Bacteria 746
173 Ga0105241_10012157 3300009174 Bacteria 6320
174 Ga0105241_10027763 3300009174 Bacteria 4214
175 Ga0105241_10038341 3300009174 Unclassified 3612
176 Ga0105241_10579751 3300009174 Bacteria 1011
177 Ga0105241_10598501 3300009174 Bacteria 996
178 Ga0105241_11936616 3300009174 Unclassified 579
179 Ga0105241_12031721 3300009174 Bacteria 566
180 Ga0105242_10017569 3300009176 Bacteria 5578
181 Ga0105242_10635384 3300009176 Unclassified 1036
182 Ga0105242_10937666 3300009176 Unclassified 869
183 Ga0105242_11444559 3300009176 Bacteria 717
184 Ga0105248_10080635 3300009177 Bacteria 3658
185 Ga0105248_10085443 3300009177 Bacteria 3550
186 Ga0105248_10976933 3300009177 Unclassified 956
187 Ga0105248_11784842 3300009177 Bacteria 698
188 Ga0105237_10066984 3300009545 Bacteria 3585
189 Ga0105237_10097544 3300009545 Bacteria 2929
190 Ga0105237_10575949 3300009545 Bacteria 1133
191 Ga0105237_10789494 3300009545 Bacteria 956
192 Ga0105237_11030562 3300009545 Bacteria 830
193 Ga0105237_11963860 3300009545 Bacteria 593
194 Ga0105238_10030103 3300009551 Bacteria 5525
195 Ga0105238_10056714 3300009551 Bacteria 3929
196 Ga0105238_10165875 3300009551 Bacteria 2184
197 Ga0105238_10292394 3300009551 Unclassified 1612
198 Ga0105238_10461865 3300009551 Bacteria 1267
199 Ga0105238_10623108 3300009551 Unclassified 1088
200 Ga0105249_10034353 3300009553 Bacteria 4595
201 Ga0105249_10603195 3300009553 Unclassified 1153
202 Ga0105249_10800348 3300009553 Unclassified 1007
203 Ga0105249_11758797 3300009553 Bacteria 692
204 Ga0105029_121233 3300009984 Bacteria 544
205 Ga0105035_102226 3300009988 Unclassified 1415
206 Ga0105239_10138614 3300010375 Bacteria 2710
207 Ga0105239_10346115 3300010375 Bacteria 1678
208 Ga0105239_10464766 3300010375 Unclassified 1436
209 Ga0105239_11503569 3300010375 Bacteria 778
210 Ga0105246_10045637 3300011119 Bacteria 2985
211 Ga0105246_10247119 3300011119 Unclassified 1414
212 Ga0157373_10693148 3300013100 Unclassified 746
213 Ga0157373_10803377 3300013100 Unclassified 694
214 Ga0157373_10880697 3300013100 Bacteria 663
215 Ga0157371_11558776 3300013102 Unclassified 516
216 Ga0157370_10017357 3300013104 Bacteria 7264
217 Ga0157370_10190335 3300013104 Unclassified 1905
218 Ga0157370_10378103 3300013104 Bacteria 1305
219 Ga0157370_11284657 3300013104 Unclassified 660
220 Ga0157369_10086109 3300013105 Bacteria 3356
221 Ga0157369_12522948 3300013105 Unclassified 520
222 Ga0157374_10007748 3300013296 Bacteria 9168
223 Ga0157374_10104852 3300013296 Bacteria 2715
224 Ga0157374_10204016 3300013296 Bacteria 1937
225 Ga0157374_10770833 3300013296 Bacteria 977
226 Ga0157378_10045609 3300013297 Bacteria 3895
227 Ga0157378_10079286 3300013297 Unclassified 2964
228 Ga0157378_10288068 3300013297 Bacteria 1585
229 Ga0163162_10021649 3300013306 Bacteria 6332
230 Ga0163162_10226760 3300013306 Bacteria 1998
231 Ga0163162_12505640 3300013306 Bacteria 593
232 Ga0157372_10051159 3300013307 Bacteria 4597
233 Ga0157372_10100764 3300013307 Bacteria 3296
234 Ga0157375_10420552 3300013308 Bacteria 1502
235 Ga0157375_11611667 3300013308 Unclassified 767
236 Ga0163163_10701991 3300014325 Bacteria 1075
237 Ga0163163_13044929 3300014325 Bacteria 523
238 Ga0157379_10349708 3300014968 Bacteria 1353
239 Ga0157379_11613423 3300014968 Unclassified 634
240 Ga0157376_11127613 3300014969 Bacteria 811
241 Ga0157376_11680520 3300014969 Unclassified 670
242 Ga0157376_12375424 3300014969 Unclassified 570
243 Ga0206351_10618919 3300020077 Unclassified 824
244 Ga0209758_1000028 3300025297 Bacteria 530102
245 Ga0209758_1131233 3300025297 Unclassified 662
246 Ga0209050_1002767 3300025298 Bacteria 14080
247 Ga0207426_1086508 3300025302 Unclassified 839
248 Ga0209051_1025241 3300025303 Bacteria 2423
249 Ga0209257_1000574 3300025304 Bacteria 61789
250 Ga0207656_10746750 3300025321 Unclassified 502
251 Ga0207710_10268156 3300025900 Bacteria 857
252 Ga0207680_10510499 3300025903 Bacteria 857
253 Ga0207680_10575682 3300025903 Bacteria 805
254 Ga0207680_10741393 3300025903 Bacteria 704
255 Ga0207647_10245426 3300025904 Bacteria 1028
256 Ga0207645_10671479 3300025907 Unclassified 704
257 Ga0207643_10011617 3300025908 Bacteria 4755
258 Ga0207705_10011204 3300025909 Bacteria 6500
259 Ga0207705_10014846 3300025909 Bacteria 5601
260 Ga0207705_10379860 3300025909 Bacteria 1091
261 Ga0207705_10460770 3300025909 Bacteria 986
262 Ga0207705_10518958 3300025909 Unclassified 926
263 Ga0207705_11232334 3300025909 Unclassified 573
264 Ga0207705_11475587 3300025909 Unclassified 515
265 Ga0207654_10062683 3300025911 Bacteria 2179
266 Ga0207654_10072421 3300025911 Bacteria 2051
267 Ga0207654_10120282 3300025911 Bacteria 1648
268 Ga0207654_10665831 3300025911 Unclassified 746
269 Ga0207707_10218818 3300025912 Bacteria 1658
270 Ga0207707_10561573 3300025912 Bacteria 969
271 Ga0207707_11144795 3300025912 Unclassified 632
272 Ga0207695_10005068 3300025913 Bacteria 17663
273 Ga0207695_10053953 3300025913 Bacteria 4201
274 Ga0207695_10069109 3300025913 Bacteria 3616
275 Ga0207695_10248597 3300025913 Bacteria 1678
276 Ga0207695_10404824 3300025913 Bacteria 1249
277 Ga0207695_10642287 3300025913 Unclassified 942
278 Ga0207695_11567841 3300025913 Unclassified 539
279 Ga0207671_10133411 3300025914 Bacteria 1908
280 Ga0207671_10345845 3300025914 Bacteria 1179
281 Ga0207671_10512537 3300025914 Bacteria 956
282 Ga0207671_10526506 3300025914 Bacteria 942
283 Ga0207693_10655188 3300025915 Unclassified 815
284 Ga0207660_10112270 3300025917 Unclassified 2053
285 Ga0207660_10275511 3300025917 Unclassified 1334
286 Ga0207660_10309861 3300025917 Bacteria 1259
287 Ga0207660_10353014 3300025917 Unclassified 1179
288 Ga0207660_11154599 3300025917 Unclassified 631
289 Ga0207657_10003976 3300025919 Bacteria 15705
290 Ga0207657_10022961 3300025919 Bacteria 5821
291 Ga0207657_10302214 3300025919 Bacteria 1267
292 Ga0207657_11488404 3300025919 Bacteria 506
293 Ga0207649_10079732 3300025920 Unclassified 2116
294 Ga0207649_10181066 3300025920 Bacteria 1475
295 Ga0207649_11575989 3300025920 Unclassified 520
296 Ga0207652_10065966 3300025921 Bacteria 3136
297 Ga0207652_10073311 3300025921 Bacteria 2978
298 Ga0207652_10274157 3300025921 Bacteria 1522
299 Ga0207652_10327649 3300025921 Unclassified 1383
300 Ga0207694_10030274 3300025924 Bacteria 4133
301 Ga0207694_10034379 3300025924 Bacteria 3886
302 Ga0207694_10320774 3300025924 Bacteria 1278
303 Ga0207694_11036567 3300025924 Unclassified 694
304 Ga0207650_10254409 3300025925 Bacteria 1423
305 Ga0207650_10466932 3300025925 Bacteria 1052
306 Ga0207687_10232982 3300025927 Bacteria 1455
307 Ga0207687_11339678 3300025927 Bacteria 615
308 Ga0207664_10000078 3300025929 Bacteria 97308
309 Ga0207664_11955335 3300025929 Unclassified 509
310 Ga0207644_10568380 3300025931 Unclassified 940
311 Ga0207644_10899564 3300025931 Unclassified 742
312 Ga0207706_10062067 3300025933 Bacteria 3292
313 Ga0207706_10201290 3300025933 Bacteria 1747
314 Ga0207706_10477081 3300025933 Bacteria 1078
315 Ga0207686_10015197 3300025934 Bacteria 4301
316 Ga0207686_10226218 3300025934 Bacteria 1354
317 Ga0207686_11521884 3300025934 Unclassified 552
318 Ga0207686_11683192 3300025934 Unclassified 524
319 Ga0207669_11301755 3300025937 Unclassified 617
320 Ga0207704_10153680 3300025938 Bacteria 1627
321 Ga0207704_10198599 3300025938 Bacteria 1466
322 Ga0207665_10105297 3300025939 Bacteria 1975
323 Ga0207691_11674814 3300025940 Unclassified 515
324 Ga0207711_10029833 3300025941 Bacteria 4601
325 Ga0207711_10221420 3300025941 Bacteria 1731
326 Ga0207711_10666514 3300025941 Bacteria 970
327 Ga0207689_10062635 3300025942 Bacteria 3059
328 Ga0207689_10064251 3300025942 Bacteria 3020
329 Ga0207689_10287369 3300025942 Unclassified 1362
330 Ga0207661_10112973 3300025944 Bacteria 2301
331 Ga0207661_10287893 3300025944 Unclassified 1470
332 Ga0207679_10426687 3300025945 Unclassified 1171
333 Ga0207667_10006875 3300025949 Bacteria 13743
334 Ga0207667_11618516 3300025949 Bacteria 616
335 Ga0207712_11057512 3300025961 Bacteria 721
336 Ga0207640_10262359 3300025981 Unclassified 1347
337 Ga0207658_10287086 3300025986 Bacteria 1413
338 Ga0207658_10379976 3300025986 Unclassified 1237
339 Ga0207658_12084861 3300025986 Unclassified 515
340 Ga0207658_12172721 3300025986 Bacteria 504
341 Ga0207677_10000004 3300026023 Bacteria 299062
342 Ga0207677_10063109 3300026023 Bacteria 2574
343 Ga0207677_10268905 3300026023 Bacteria 1393
344 Ga0207677_10543356 3300026023 Bacteria 1011
345 Ga0207677_10700317 3300026023 Bacteria 899
346 Ga0207703_10926979 3300026035 Bacteria 834
347 Ga0207703_11516497 3300026035 Unclassified 645
348 Ga0207703_11752130 3300026035 Unclassified 597
349 Ga0207639_10071232 3300026041 Bacteria 2718
350 Ga0207639_11624439 3300026041 Bacteria 606
351 Ga0207702_10011606 3300026078 Bacteria 7341
352 Ga0207702_10061064 3300026078 Bacteria 3214
353 Ga0207702_10313340 3300026078 Bacteria 1492
354 Ga0207702_11311975 3300026078 Unclassified 718
355 Ga0207641_10743950 3300026088 Bacteria 967
356 Ga0207641_10838505 3300026088 Bacteria 911
357 Ga0207648_10673513 3300026089 Unclassified 957
358 Ga0207648_11964412 3300026089 Unclassified 546
359 Ga0207676_10800802 3300026095 Unclassified 919
360 Ga0207676_11672544 3300026095 Bacteria 635
361 Ga0207674_10420784 3300026116 Bacteria 1291
362 Ga0207675_100528643 3300026118 Bacteria 1177
363 Ga0207675_100724078 3300026118 Bacteria 1005
364 Ga0207683_10029354 3300026121 Bacteria 4761
365 Ga0207683_10128529 3300026121 Bacteria 2278
366 Ga0207683_11176807 3300026121 Bacteria 711
367 Ga0207683_11310176 3300026121 Bacteria 670
368 Ga0207698_10143101 3300026142 Bacteria 2063
369 Ga0207698_10582236 3300026142 Unclassified 1101
370 Ga0210002_1023723 3300027617 Unclassified 999
371 Ga0209971_1038461 3300027682 Bacteria 1152
372 Ga0209974_10176473 3300027876 Bacteria 781
373 Ga0207428_10158239 3300027907 Unclassified 1721
374 Ga0268266_10066516 3300028379 Bacteria 3117
375 Ga0268266_10118596 3300028379 Bacteria 2352
376 Ga0268266_10131310 3300028379 Bacteria 2240
377 Ga0268266_10135479 3300028379 Bacteria 2205
378 Ga0268266_10347409 3300028379 Bacteria 1393
379 Ga0268266_10551151 3300028379 Bacteria 1105
380 Ga0268265_10002160 3300028380 Bacteria 15223
381 Ga0268265_10528540 3300028380 Bacteria 1116
382 Ga0268265_10884014 3300028380 Bacteria 876
383 Ga0268265_12074366 3300028380 Unclassified 576
384 Ga0268264_10048640 3300028381 Unclassified 3528
385 Ga0268264_10283735 3300028381 Bacteria 1552
386 Ga0268264_10684069 3300028381 Bacteria 1018
387 Ga0307408_100035242 3300031548 Bacteria 3510
388 Ga0307408_100105857 3300031548 Bacteria 2151
389 Ga0307408_100129213 3300031548 Bacteria 1969
390 Ga0307408_100310301 3300031548 Bacteria 1325
391 Ga0307408_100925653 3300031548 Unclassified 799
392 Ga0307405_10545051 3300031731 Bacteria 938
393 Ga0307413_10089355 3300031824 Bacteria 2001
394 Ga0307413_11116710 3300031824 Bacteria 682
395 Ga0307413_11508145 3300031824 Unclassified 594
396 Ga0307410_10053704 3300031852 Bacteria 2728
397 Ga0307410_10073014 3300031852 Bacteria 2384
398 Ga0307410_10749946 3300031852 Bacteria 827
399 Ga0307410_11011308 3300031852 Unclassified 717
400 Ga0307406_10151165 3300031901 Bacteria 1656
401 Ga0307406_10276666 3300031901 Bacteria 1278
402 Ga0307406_11322488 3300031901 Bacteria 630
403 Ga0307406_11540489 3300031901 Bacteria 586
404 Ga0307407_10078127 3300031903 Bacteria 1993
405 Ga0307407_10175649 3300031903 Bacteria 1415
406 Ga0307412_10103127 3300031911 Bacteria 2021
407 Ga0307412_10426248 3300031911 Bacteria 1086
408 Ga0307409_100032336 3300031995 Bacteria 3792
409 Ga0307409_101264665 3300031995 Bacteria 762
410 Ga0307409_102601389 3300031995 Unclassified 534
411 Ga0307416_100069826 3300032002 Bacteria 2909
412 Ga0307416_100211933 3300032002 Bacteria 1849
413 Ga0307416_100327542 3300032002 Unclassified 1538
414 Ga0307416_100416907 3300032002 Bacteria 1385
415 Ga0307416_101290997 3300032002 Unclassified 836
416 Ga0307414_10025995 3300032004 Bacteria 3761
417 Ga0307414_10082808 3300032004 Unclassified 2354
418 Ga0307411_10010772 3300032005 Bacteria 4893
419 Ga0307411_10013670 3300032005 Bacteria 4488
420 Ga0307411_10136484 3300032005 Unclassified 1802
421 Ga0307411_10245120 3300032005 Bacteria 1405
422 Ga0307415_100090510 3300032126 Bacteria 2213
423 Ga0307415_100631337 3300032126 Unclassified 958
424 Ga0307415_101514866 3300032126 Bacteria 642
425 Ga0307415_102298409 3300032126 Bacteria 529
426 Ga0307510_10136350 3300033180 Unclassified 2111
427 Ga0307510_10269164 3300033180 Bacteria 1181
428 Ga0373934_0011032 3300035086 Bacteria 3399
429 Ga0373923_0122549 3300035111 Bacteria 1163
430 Ga0373932_0121324 3300035112 Bacteria 872
431 Ga0373939_0304031 3300035114 Unclassified 637
432 Ga0373953_0001379 3300035117 Bacteria 6984
433 Ga0373954_0000313 3300035118 Bacteria 17689
434 Ga0373957_0002825 3300035120 Bacteria 5013
435 Ga0373955_0000495 3300035172 Bacteria 16716
436 Ga0373933_0003323 3300035724 Bacteria 8978
437 Ga0373937_0001044 3300036401 Bacteria 23401
438 Ga0395899_0002950 3300037312 Bacteria 13635
439 Ga0395899_0643597 3300037312 Bacteria 671
440 Ga0395900_0100094 3300037418 Bacteria 2977
441 Ga0395898_0028340 3300037466 Bacteria 5613
442 Ga0395898_0054854 3300037466 Bacteria 3888
443 Ga0395905_0552121 3300037471 Bacteria 1053
444 Ga0395901_0002816 3300038443 Bacteria 17562
445 Ga0395901_0004332 3300038443 Bacteria 14320
446 Ga0395901_0213460 3300038443 Bacteria 2019
447 Ga0395901_1592169 3300038443 Unclassified 607
448 Ga0439439_0065005 3300041406 Bacteria 973
449 Ga0439461_0065414 3300041410 Unclassified 833
450 Ga0439461_0079844 3300041410 Bacteria 770
451 Ga0451787_178779 3300041441 Unclassified 541
452 Ga0451789_0529924 3300041443 Unclassified 525
453 Ga0451793_0317576 3300041452 Bacteria 886
454 Ga0451798_0756100 3300041458 Unclassified 1939
455 Ga0451807_0049124 3300041486 Unclassified 978
456 Ga0451853_2821110 3300041512 Bacteria 887
457 Ga0439431_0106524 3300041997 Unclassified 774
458 Ga0439433_0017664 3300041999 Bacteria 1585
459 Ga0439441_016970 3300042001 Unclassified 1303
460 Ga0439442_050322 3300042002 Bacteria 879
461 Ga0439443_006736 3300042003 Bacteria 1579
462 Ga0450911_036276 3300042115 Bacteria 639
463 Ga0450922_041753 3300042124 Unclassified 520
464 Ga0450923_007548 3300042125 Bacteria 1844
465 Ga0450895_007079 3300042132 Bacteria 925
466 Ga0450896_004133 3300042133 Bacteria 1959
467 Ga0439446_0058145 3300042156 Unclassified 1165
468 Ga0439458_0235844 3300042157 Unclassified 506
469 Ga0439434_0019414 3300042435 Bacteria 2038
470 Ga0439434_0023489 3300042435 Bacteria 1857
471 Ga0439435_0001054 3300042436 Bacteria 4865
472 Ga0439444_0024881 3300042437 Bacteria 1085
473 Ga0439460_0077928 3300042461 Bacteria 1036
474 Ga0439440_0110970 3300042993 Bacteria 755
475 Ga0466957_0318426 3300044842 Unclassified 1049
476 Ga0466960_0532951 3300044901 Unclassified 691
477 Ga0466960_0742290 3300044901 Unclassified 591
478 Ga0451576_1700425 3300045051 Unclassified 653
479 Ga0495617_172051 3300046452 Unclassified 684
480 Ga0495592_0005825 3300046454 Bacteria 9139
481 Ga0495629_0100613 3300046459 Bacteria 2017
482 Ga0495638_0162233 3300046460 Bacteria 1289
483 Ga0495651_0001257 3300046462 Bacteria 19640
484 Ga0495653_0000881 3300046463 Bacteria 23166
485 Ga0495585_0287373 3300046492 Bacteria 811
486 Ga0495608_0000687 3300046511 Bacteria 23407
487 Ga0495618_0382736 3300046514 Bacteria 863
488 Ga0495628_0107721 3300046516 Unclassified 2145
489 Ga0495632_0113801 3300046519 Unclassified 1269
490 Ga0495648_0436445 3300046524 Bacteria 576
491 Ga0495652_0004854 3300046529 Bacteria 12771
492 Ga0495640_0180023 3300046533 Bacteria 1347
493 Ga0495587_0000799 3300046536 Bacteria 20999
494 Ga0495645_0123207 3300046543 Bacteria 1823
495 Ga0495667_0001241 3300046559 Bacteria 16709
496 Ga0495656_0253082 3300046615 Bacteria 890
497 Ga0495634_0059065 3300046642 Bacteria 2555
498 Ga0495635_0001738 3300046663 Bacteria 14661
499 Ga0495661_0214614 3300046665 Bacteria 1000
500 Ga0495657_0001772 3300046675 Bacteria 18460
501 Ga0495599_0000559 3300046678 Bacteria 21250
502 Ga0495623_0021090 3300046679 Bacteria 4209
503 Ga0495646_0100308 3300046680 Bacteria 1661
504 Ga0495613_0677674 3300046689 Bacteria 680
505 Ga0495671_0024903 3300046692 Bacteria 3114
506 Ga0495600_0000253 3300046809 Bacteria 29204
507 Ga0495604_0001029 3300047317 Bacteria 23248
508 Ga0495674_0028383 3300047319 Bacteria 5102
509 Ga0495680_0001875 3300047322 Bacteria 22125
510 Ga0495675_0000610 3300047444 Bacteria 23039
511 Ga0495684_0001161 3300047471 Bacteria 21170
512 Ga0495593_0005318 3300047673 Bacteria 7609
513 Ga0495602_0009531 3300048088 Bacteria 10091
514 Ga0496100_0831928 3300048903 Unclassified 724
515 Ga0496104_0014095 3300048907 Bacteria 7216
516 Ga0496105_0193278 3300048908 Bacteria 1663
517 Ga0496110_0583995 3300048913 Bacteria 1014
518 Ga0496111_0212404 3300048914 Bacteria 1437
519 Ga0496124_0076789 3300048927 Bacteria 2756
520 Ga0501310_011971 3300049130 Unclassified 989
521 Ga0495682_0288058 3300049460 Bacteria 580
522 Ga0501294_001163 3300049517 Bacteria 2739
523 Ga0501294_007365 3300049517 Bacteria 1062
524 Ga0501296_058241 3300049519 Bacteria 579
525 Ga0501297_013151 3300049520 Bacteria 969
526 Ga0501297_067949 3300049520 Unclassified 557
527 Ga0501298_019896 3300049521 Bacteria 1246
528 Ga0501298_037230 3300049521 Unclassified 976
529 Ga0501300_001721 3300049523 Bacteria 3281
530 Ga0501302_017427 3300049525 Bacteria 591
531 Ga0501303_008507 3300049526 Bacteria 933
532 Ga0501315_024542 3300049531 Unclassified 834
533 Ga0501031_0318872 3300049568 Unclassified 1007
534 Ga0501031_0645411 3300049568 Bacteria 680
535 Ga0501031_1108401 3300049568 Bacteria 505
536 Ga0501032_0006405 3300049569 Bacteria 8664
537 Ga0501032_0126398 3300049569 Bacteria 1689
538 Ga0501032_0135183 3300049569 Bacteria 1625
539 Ga0501032_0779513 3300049569 Unclassified 604
540 Ga0501034_0000135 3300049571 Bacteria 137151
541 Ga0501034_0021435 3300049571 Bacteria 6587
542 Ga0501034_0027030 3300049571 Bacteria 5837
543 Ga0501034_0107456 3300049571 Bacteria 2782
544 Ga0501034_0355484 3300049571 Unclassified 1393
545 Ga0501034_0862247 3300049571 Unclassified 795
546 Ga0501034_0984384 3300049571 Bacteria 728
547 Ga0501034_1001188 3300049571 Unclassified 720
548 Ga0501034_1389820 3300049571 Unclassified 577
549 Ga0501036_0005221 3300049572 Bacteria 10503
550 Ga0501036_0024356 3300049572 Bacteria 5102
551 Ga0501036_0668607 3300049572 Unclassified 859
552 Ga0501037_0003668 3300049573 Bacteria 11144
553 Ga0501037_0116032 3300049573 Bacteria 1927
554 Ga0501037_0291148 3300049573 Bacteria 1136
555 Ga0501037_0440131 3300049573 Bacteria 890
556 Ga0501037_0463122 3300049573 Unclassified 864
557 Ga0501038_0476178 3300049574 Unclassified 957
558 Ga0501039_0000180 3300049575 Bacteria 45008
559 Ga0501039_0234692 3300049575 Bacteria 1442
560 Ga0501040_0076541 3300049576 Bacteria 2314
561 Ga0501040_0101741 3300049576 Bacteria 2005
562 Ga0501040_0129578 3300049576 Unclassified 1773
563 Ga0501042_0171797 3300049578 Bacteria 1564
564 Ga0501043_0554549 3300049579 Unclassified 853
565 Ga0501043_0582437 3300049579 Bacteria 828
566 Ga0501043_1147235 3300049579 Unclassified 547
567 Ga0501046_0003402 3300049580 Bacteria 14604
568 Ga0501046_0163883 3300049580 Bacteria 1671
569 Ga0501046_0214584 3300049580 Bacteria 1427
570 Ga0501046_0235713 3300049580 Bacteria 1351
571 Ga0501046_0970177 3300049580 Unclassified 591
572 Ga0501047_0000897 3300049581 Bacteria 30435
573 Ga0501047_0008106 3300049581 Bacteria 9913
574 Ga0501047_0017104 3300049581 Bacteria 6935
575 Ga0501047_0023931 3300049581 Bacteria 5864
576 Ga0501047_0082177 3300049581 Bacteria 3097
577 Ga0501047_0619504 3300049581 Bacteria 903
578 Ga0501047_0705539 3300049581 Bacteria 826
579 Ga0501047_0974235 3300049581 Bacteria 661
580 Ga0501048_0227897 3300049582 Bacteria 1322
581 Ga0501048_0238380 3300049582 Unclassified 1291
582 Ga0501048_0620884 3300049582 Bacteria 776
583 Ga0501067_0004604 3300049583 Bacteria 7634
584 Ga0501068_0304788 3300049584 Bacteria 1020
585 Ga0501068_0923605 3300049584 Unclassified 574
586 Ga0501068_0985588 3300049584 Unclassified 556
587 Ga0501069_0029067 3300049585 Bacteria 3033
588 Ga0501069_0045771 3300049585 Bacteria 2425
589 Ga0501070_0002980 3300049586 Bacteria 14744
590 Ga0501070_0025565 3300049586 Bacteria 4952
591 Ga0501070_0065076 3300049586 Bacteria 3019
592 Ga0501070_0326194 3300049586 Bacteria 1248
593 Ga0501070_0395470 3300049586 Bacteria 1118
594 Ga0501071_0018219 3300049587 Bacteria 4858
595 Ga0501071_0119043 3300049587 Bacteria 1957
596 Ga0501072_0067808 3300049588 Bacteria 2816
597 Ga0501072_0335667 3300049588 Bacteria 1201
598 Ga0501072_1453544 3300049588 Unclassified 530
599 Ga0501073_0009593 3300049589 Bacteria 7138
600 Ga0501073_0023910 3300049589 Bacteria 4387
601 Ga0501073_0082204 3300049589 Bacteria 2240
602 Ga0501073_0097705 3300049589 Bacteria 2040
603 Ga0501073_0327854 3300049589 Bacteria 1057
604 Ga0501073_0458538 3300049589 Unclassified 881
605 Ga0501073_1118494 3300049589 Unclassified 541
606 Ga0501074_0007311 3300049590 Bacteria 7984
607 Ga0501074_0063957 3300049590 Bacteria 2649
608 Ga0501074_1091405 3300049590 Unclassified 560
609 Ga0501075_0053722 3300049591 Bacteria 3030
610 Ga0501075_0456132 3300049591 Bacteria 975
611 Ga0501076_0011401 3300049592 Bacteria 6618
612 Ga0501076_0462194 3300049592 Bacteria 1045
613 Ga0501076_0891341 3300049592 Bacteria 733
614 Ga0501077_0041159 3300049593 Bacteria 2942
615 Ga0501077_0331648 3300049593 Bacteria 970
616 Ga0501077_0711360 3300049593 Unclassified 646
617 Ga0501077_0990637 3300049593 Unclassified 541
618 Ga0501206_036028 3300049653 Unclassified 750
619 Ga0501206_048665 3300049653 Bacteria 670
620 Ga0501207_004182 3300049654 Bacteria 1954
621 Ga0501210_001617 3300049657 Bacteria 1312
622 Ga0501211_000217 3300049658 Bacteria 4959
623 Ga0501222_003244 3300049662 Bacteria 2233
624 Ga0501222_006973 3300049662 Bacteria 1514
625 Ga0501223_014718 3300049663 Bacteria 1551
626 Ga0501223_047419 3300049663 Bacteria 833
627 Ga0501227_002884 3300049665 Bacteria 3773
628 Ga0501233_003766 3300049668 Bacteria 2744
629 Ga0501235_006211 3300049669 Bacteria 2602
630 Ga0501236_015234 3300049670 Unclassified 1074
631 Ga0501242_060384 3300049674 Bacteria 575
632 Ga0501243_089665 3300049675 Bacteria 609
633 Ga0501247_027834 3300049677 Bacteria 760
634 Ga0501251_015400 3300049681 Bacteria 961
635 Ga0501252_008463 3300049682 Bacteria 1182
636 Ga0501253_008143 3300049683 Bacteria 1496
637 Ga0501253_054206 3300049683 Unclassified 848
638 Ga0501255_000809 3300049684 Bacteria 2303
639 Ga0501257_028296 3300049686 Unclassified 1344
640 Ga0501257_174427 3300049686 Bacteria 605
641 Ga0501258_004012 3300049687 Bacteria 1375
642 Ga0501259_046328 3300049688 Unclassified 871
643 Ga0501221_000226 3300049704 Bacteria 8090
644 Ga0501225_0118543 3300049705 Unclassified 785
645 Ga0501229_002173 3300049706 Bacteria 2303
646 Ga0501079_0006178 3300049741 Bacteria 8985
647 Ga0501079_0072081 3300049741 Bacteria 2669
648 Ga0501079_0217344 3300049741 Bacteria 1493
649 Ga0501079_0263166 3300049741 Bacteria 1348
650 Ga0501080_0000298 3300049742 Bacteria 37784
651 Ga0501080_0017691 3300049742 Bacteria 6594
652 Ga0501080_0027130 3300049742 Bacteria 5326
653 Ga0501080_0077838 3300049742 Bacteria 3085
654 Ga0501080_0182396 3300049742 Bacteria 1931
655 Ga0501080_0197177 3300049742 Bacteria 1849
656 Ga0501080_0378407 3300049742 Unclassified 1276
657 Ga0501080_0383668 3300049742 Bacteria 1266
658 Ga0501080_0467694 3300049742 Unclassified 1129
659 Ga0501080_1167768 3300049742 Unclassified 663
660 Ga0501081_0046548 3300049743 Bacteria 2982
661 Ga0501081_0052097 3300049743 Bacteria 2823
662 Ga0501081_0370996 3300049743 Bacteria 1057
663 Ga0501081_1273014 3300049743 Unclassified 557
664 Ga0501083_0111702 3300049744 Bacteria 1796
665 Ga0501083_0398809 3300049744 Unclassified 895
666 Ga0501232_001758 3300049757 Bacteria 1781
667 Ga0501262_005214 3300049759 Bacteria 1530
668 Ga0501262_014117 3300049759 Unclassified 1037
669 Ga0501265_004898 3300049762 Bacteria 1537
670 Ga0501265_019968 3300049762 Bacteria 898
671 Ga0501267_005752 3300049764 Bacteria 1178
672 Ga0501268_073517 3300049765 Unclassified 695
673 Ga0501270_050502 3300049767 Bacteria 752
674 Ga0501272_006284 3300049769 Bacteria 1268
675 Ga0501272_038274 3300049769 Unclassified 632
676 Ga0501273_032887 3300049770 Unclassified 744
677 Ga0501274_036899 3300049771 Unclassified 573
678 Ga0501282_024536 3300049778 Unclassified 672
679 Ga0501283_012928 3300049779 Bacteria 1260
680 Ga0501283_098284 3300049779 Unclassified 567
681 Ga0501035_0000056 3300049822 Bacteria 137385
682 Ga0501035_0000282 3300049822 Bacteria 60259
683 Ga0501035_0006294 3300049822 Bacteria 11163
684 Ga0501035_0006746 3300049822 Bacteria 10735
685 Ga0501044_0000536 3300049823 Bacteria 46054
686 Ga0501044_0011806 3300049823 Bacteria 9463
687 Ga0501044_0039275 3300049823 Bacteria 4938
688 Ga0501044_0089593 3300049823 Bacteria 3105
689 Ga0501044_1414806 3300049823 Unclassified 561
690 Ga0501045_0005467 3300049824 Bacteria 8794
691 Ga0501045_0659797 3300049824 Unclassified 773
692 Ga0501226_014596 3300049853 Bacteria 867
693 nmdc:mga03683_352107_c1 3300050489 Unclassified 697
694 nmdc:mga0qj67_108492_c1 3300050509 Unclassified 2240
695 nmdc:mga08y16_1371723_c1 3300050511 Unclassified 671
696 nmdc:mga08y16_9336_c1 3300050511 Bacteria 10287
697 nmdc:mga0rr50_1780915_c1 3300050513 Unclassified 518
698 nmdc:mga0sz30_77694_c1 3300050516 Bacteria 1434
699 Ga0495601_0084566 3300053077 Bacteria 2038
700 Ga0495595_0001458 3300053084 Bacteria 9234
701 Ga0495619_0000685 3300053085 Bacteria 22151
702 Ga0500644_0055826 3300053088 Bacteria 1372
703 Ga0500646_0026524 3300053090 Bacteria 1571
704 Ga0500583_0161346 3300053092 Unclassified 1116
705 Ga0500583_0287338 3300053092 Unclassified 806
706 Ga0500651_0417854 3300053093 Bacteria 751
707 Ga0500650_0123477 3300053098 Bacteria 1206
708 Ga0500562_172481 3300053108 Unclassified 588
709 Ga0500595_001067 3300053119 Bacteria 15236
710 Ga0500614_216726 3300053123 Unclassified 593
711 Ga0500642_0000738 3300053130 Bacteria 9649
712 Ga0500658_0008532 3300053134 Bacteria 3784
713 Ga0500658_0109577 3300053134 Unclassified 1214
714 Ga0500568_0046479 3300053139 Bacteria 1722
715 Ga0500577_0127182 3300053142 Bacteria 1065
716 Ga0500588_0018850 3300053146 Bacteria 1825
717 Ga0500604_0004159 3300053151 Bacteria 3859
718 Ga0500604_0020715 3300053151 Bacteria 1853
719 Ga0500611_033113 3300053727 Bacteria 1085
720 Ga0500611_161832 3300053727 Unclassified 619
721 Ga0500609_000975 3300053731 Bacteria 4297
722 Ga0500656_026355 3300053732 Unclassified 751
723 Ga0500599_008793 3300053736 Bacteria 1316
724 Ga0500587_004650 3300053739 Bacteria 1876
725 Ga0501084_0000206 3300054114 Bacteria 45694
726 Ga0501084_0001708 3300054114 Bacteria 17419
727 Ga0501084_0090756 3300054114 Bacteria 2565
728 Ga0501084_1041794 3300054114 Bacteria 687
729 Ga0590071_008554 3300059421 Bacteria 2406
730 Ga0590074_024903 3300059423 Bacteria 1042
731 Ga0590075_004438 3300059424 Bacteria 3320
732 Ga0590077_046200 3300059426 Bacteria 973
733 Ga0501082_0007428 3300060353 Bacteria 9456
734 Ga0501082_0011459 3300060353 Bacteria 7632
735 Ga0501082_0060553 3300060353 Bacteria 3259
736 Ga0501082_0147165 3300060353 Bacteria 2045
737 Ga0501082_0161541 3300060353 Bacteria 1947
738 Ga0501082_0486732 3300060353 Bacteria 1078
739 Ga0501082_0685151 3300060353 Bacteria 897
740 Ga0530510_0392280 3300061734 Bacteria 1045
741 Ga0530510_0718054 3300061734 Bacteria 762
742 Ga0530510_1595916 3300061734 Unclassified 501
743 2644304246 2643221654 Bacteria 5273570
744 2738845094 2738541300 Bacteria 6675882
745 2739274679 2738543018 Bacteria 6718814
746 2739343723 2738543030 Bacteria 6719714
747 Ga0070658_10292388
748 rootH1_10118784
749 rootH2_10030263
750 rootH2_10131974
751 rootH2_10181915
752 rootH2_10320555
753 rootL2_10180144
754 rootL2_10211209
755 rootH1_10007381
756 rootH1_10052430
757 rootH1_10225615
758 Ga0070658_10019362
759 Ga0070658_11632665
760 Ga0070676_10795725
761 Ga0070683_100140667
762 Ga0070683_100842435
763 Ga0070683_101494679
764 Ga0070690_100089951
765 Ga0070670_100067057
766 Ga0068869_100079823
767 Ga0070666_10007725
768 Ga0070666_10017120
769 Ga0070666_10597381
770 Ga0070666_10862654
771 Ga0070680_100062558
772 Ga0070680_100174647
773 Ga0070680_100773526
774 Ga0070682_100001461
775 Ga0070682_101572835
776 Ga0068868_100043411
777 Ga0068868_100825859
778 Ga0070660_100001736
779 Ga0070660_100039372
780 Ga0070660_100081917
781 Ga0070660_100368369
782 Ga0070660_101393993
783 Ga0070689_100750536
784 Ga0070689_101795334
785 Ga0070691_10062657
786 Ga0070661_100123254
787 Ga0070661_100557396
788 Ga0070661_100825401
789 Ga0070661_100972063
790 Ga0070692_10246111
791 Ga0070668_101475367
792 Ga0070671_100055483
793 Ga0070671_100811193
794 Ga0070674_101173629
795 Ga0070659_101324417
796 Ga0070667_100029754
797 Ga0070667_100778743
798 Ga0070667_101393311
799 Ga0070713_101145166
800 Ga0070705_100086660
801 Ga0070705_101908757
802 Ga0070678_100006697
803 Ga0070678_100033835
804 Ga0070678_100739389
805 Ga0070678_101308697
806 Ga0070662_100004066
807 Ga0070662_100273139
808 Ga0070662_100316616
809 Ga0070681_10499994
810 Ga0070681_10638407
811 Ga0070681_11392370
812 Ga0070681_11537185
813 Ga0070681_11578690
814 Ga0068867_100490310
815 Ga0070685_11380750
816 Ga0070679_100029565
817 Ga0070679_100270413
818 Ga0070679_100447828
819 Ga0070684_100043554
820 Ga0070684_100936329
821 Ga0068853_100112537
822 Ga0068853_100134907
823 Ga0068853_100559273
824 Ga0068853_100679470
825 Ga0070672_102054673
826 Ga0070686_101371161
827 Ga0070693_100215621
828 Ga0070665_100018314
829 Ga0070665_100029825
830 Ga0070665_100034575
831 Ga0070665_100045787
832 Ga0070665_100262334
833 Ga0068855_100053704
834 Ga0068855_100072858
835 Ga0068855_101852321
836 Ga0070664_100012736
837 Ga0070664_101636175
838 Ga0068857_100569882
839 Ga0068857_101459701
840 Ga0068857_101924981
841 Ga0068854_100169036
842 Ga0068854_101418124
843 Ga0068856_100081788
844 Ga0068856_100263569
845 Ga0068856_100577830
846 Ga0070702_100082386
847 Ga0070702_100536523
848 Ga0068852_100002916
849 Ga0068852_100328381
850 Ga0068859_100737747
851 Ga0068859_101097950
852 Ga0068864_100872173
853 Ga0068864_101134080
854 Ga0068866_10799303
855 Ga0068861_100084560
856 Ga0068861_100515744
857 Ga0068861_100522092
858 Ga0068851_10008911
859 Ga0068851_10245111
860 Ga0068851_10850221
861 Ga0068870_10008064
862 Ga0068863_100144307
863 Ga0068863_102329101
864 Ga0068858_100025035
865 Ga0068858_101157146
866 Ga0068858_101399049
867 Ga0068860_100053160
868 Ga0068860_100298956
869 Ga0068860_100685311
870 Ga0068862_100033951
871 Ga0068862_100096066
872 Ga0068862_101609208
873 Ga0081455_10257287
874 Ga0081455_10382330
875 Ga0081455_11019343
876 Ga0081538_10005274
877 Ga0081540_1002217
878 Ga0075365_11129296
879 Ga0070712_100672001
880 Ga0070712_101883440
881 Ga0075362_10330953
882 Ga0075366_10560371
883 Ga0097621_100023872
884 Ga0097621_100048974
885 Ga0097621_100091415
886 Ga0097621_100118877
887 Ga0097621_100399683
888 Ga0097621_101434075
889 Ga0097621_101592159
890 Ga0097621_102140767
891 Ga0075370_10293515
892 Ga0068871_100148925
893 Ga0068871_100428289
894 Ga0068871_100984462
895 Ga0075428_100007347
896 Ga0075430_100117524
897 Ga0075429_100035604
898 Ga0075429_101605024
899 Ga0068865_100173560
900 Ga0068865_100236578
901 Ga0097620_100737680
902 Ga0097620_101098023
903 Ga0075435_100833329
904 Ga0105240_10020426
905 Ga0105240_10022197
906 Ga0105240_10027089
907 Ga0105240_10173560
908 Ga0105240_10355467
909 Ga0105240_10682076
910 Ga0105240_11144763
911 Ga0105240_11636357
912 Ga0105240_12717551
913 Ga0111539_10013189
914 Ga0111539_10888675
915 Ga0105245_10006411
916 Ga0105247_10333254
917 Ga0105247_10735464
918 Ga0105241_10012157
919 Ga0105241_10027763
920 Ga0105241_10038341
921 Ga0105241_10579751
922 Ga0105241_10598501
923 Ga0105241_11936616
924 Ga0105241_12031721
925 Ga0105242_10017569
926 Ga0105242_10635384
927 Ga0105242_10937666
928 Ga0105242_11444559
929 Ga0105248_10080635
930 Ga0105248_10085443
931 Ga0105248_10976933
932 Ga0105248_11784842
933 Ga0105237_10066984
934 Ga0105237_10097544
935 Ga0105237_10575949
936 Ga0105237_10789494
937 Ga0105237_11030562
938 Ga0105237_11963860
939 Ga0105238_10030103
940 Ga0105238_10056714
941 Ga0105238_10165875
942 Ga0105238_10292394
943 Ga0105238_10461865
944 Ga0105238_10623108
945 Ga0105249_10034353
946 Ga0105249_10603195
947 Ga0105249_10800348
948 Ga0105249_11758797
949 Ga0105029_121233
950 Ga0105035_102226
951 Ga0105239_10138614
952 Ga0105239_10346115
953 Ga0105239_10464766
954 Ga0105239_11503569
955 Ga0105246_10045637
956 Ga0105246_10247119
957 Ga0157373_10693148
958 Ga0157373_10803377
959 Ga0157373_10880697
960 Ga0157371_11558776
961 Ga0157370_10017357
962 Ga0157370_10190335
963 Ga0157370_10378103
964 Ga0157370_11284657
965 Ga0157369_10086109
966 Ga0157369_12522948
967 Ga0157374_10007748
968 Ga0157374_10104852
969 Ga0157374_10204016
970 Ga0157374_10770833
971 Ga0157378_10045609
972 Ga0157378_10079286
973 Ga0157378_10288068
974 Ga0163162_10021649
975 Ga0163162_10226760
976 Ga0163162_12505640
977 Ga0157372_10051159
978 Ga0157372_10100764
979 Ga0157375_10420552
980 Ga0157375_11611667
981 Ga0163163_10701991
982 Ga0163163_13044929
983 Ga0157379_10349708
984 Ga0157379_11613423
985 Ga0157376_11127613
986 Ga0157376_11680520
987 Ga0157376_12375424
988 Ga0206351_10618919
989 Ga0209758_1000028
990 Ga0209758_1131233
991 Ga0209050_1002767
992 Ga0207426_1086508
993 Ga0209051_1025241
994 Ga0209257_1000574
995 Ga0207656_10746750
996 Ga0207710_10268156
997 Ga0207680_10510499
998 Ga0207680_10575682
999 Ga0207680_10741393
1000 Ga0207647_10245426
1001 Ga0207645_10671479
1002 Ga0207643_10011617
1003 Ga0207705_10011204
1004 Ga0207705_10014846
1005 Ga0207705_10379860
1006 Ga0207705_10460770
1007 Ga0207705_10518958
1008 Ga0207705_11232334
1009 Ga0207705_11475587
1010 Ga0207654_10062683
1011 Ga0207654_10072421
1012 Ga0207654_10120282
1013 Ga0207654_10665831
1014 Ga0207707_10218818
1015 Ga0207707_10561573
1016 Ga0207707_11144795
1017 Ga0207695_10005068
1018 Ga0207695_10053953
1019 Ga0207695_10069109
1020 Ga0207695_10248597
1021 Ga0207695_10404824
1022 Ga0207695_10642287
1023 Ga0207695_11567841
1024 Ga0207671_10133411
1025 Ga0207671_10345845
1026 Ga0207671_10512537
1027 Ga0207671_10526506
1028 Ga0207693_10655188
1029 Ga0207660_10112270
1030 Ga0207660_10275511
1031 Ga0207660_10309861
1032 Ga0207660_10353014
1033 Ga0207660_11154599
1034 Ga0207657_10003976
1035 Ga0207657_10022961
1036 Ga0207657_10302214
1037 Ga0207657_11488404
1038 Ga0207649_10079732
1039 Ga0207649_10181066
1040 Ga0207649_11575989
1041 Ga0207652_10065966
1042 Ga0207652_10073311
1043 Ga0207652_10274157
1044 Ga0207652_10327649
1045 Ga0207694_10030274
1046 Ga0207694_10034379
1047 Ga0207694_10320774
1048 Ga0207694_11036567
1049 Ga0207650_10254409
1050 Ga0207650_10466932
1051 Ga0207687_10232982
1052 Ga0207687_11339678
1053 Ga0207664_10000078
1054 Ga0207664_11955335
1055 Ga0207644_10568380
1056 Ga0207644_10899564
1057 Ga0207706_10062067
1058 Ga0207706_10201290
1059 Ga0207706_10477081
1060 Ga0207686_10015197
1061 Ga0207686_10226218
1062 Ga0207686_11521884
1063 Ga0207686_11683192
1064 Ga0207669_11301755
1065 Ga0207704_10153680
1066 Ga0207704_10198599
1067 Ga0207665_10105297
1068 Ga0207691_11674814
1069 Ga0207711_10029833
1070 Ga0207711_10221420
1071 Ga0207711_10666514
1072 Ga0207689_10062635
1073 Ga0207689_10064251
1074 Ga0207689_10287369
1075 Ga0207661_10112973
1076 Ga0207661_10287893
1077 Ga0207679_10426687
1078 Ga0207667_10006875
1079 Ga0207667_11618516
1080 Ga0207712_11057512
1081 Ga0207640_10262359
1082 Ga0207658_10287086
1083 Ga0207658_10379976
1084 Ga0207658_12084861
1085 Ga0207658_12172721
1086 Ga0207677_10000004
1087 Ga0207677_10063109
1088 Ga0207677_10268905
1089 Ga0207677_10543356
1090 Ga0207677_10700317
1091 Ga0207703_10926979
1092 Ga0207703_11516497
1093 Ga0207703_11752130
1094 Ga0207639_10071232
1095 Ga0207639_11624439
1096 Ga0207702_10011606
1097 Ga0207702_10061064
1098 Ga0207702_10313340
1099 Ga0207702_11311975
1100 Ga0207641_10743950
1101 Ga0207641_10838505
1102 Ga0207648_10673513
1103 Ga0207648_11964412
1104 Ga0207676_10800802
1105 Ga0207676_11672544
1106 Ga0207674_10420784
1107 Ga0207675_100528643
1108 Ga0207675_100724078
1109 Ga0207683_10029354
1110 Ga0207683_10128529
1111 Ga0207683_11176807
1112 Ga0207683_11310176
1113 Ga0207698_10143101
1114 Ga0207698_10582236
1115 Ga0210002_1023723
1116 Ga0209971_1038461
1117 Ga0209974_10176473
1118 Ga0207428_10158239
1119 Ga0268266_10066516
1120 Ga0268266_10118596
1121 Ga0268266_10131310
1122 Ga0268266_10135479
1123 Ga0268266_10347409
1124 Ga0268266_10551151
1125 Ga0268265_10002160
1126 Ga0268265_10528540
1127 Ga0268265_10884014
1128 Ga0268265_12074366
1129 Ga0268264_10048640
1130 Ga0268264_10283735
1131 Ga0268264_10684069
1132 Ga0307408_100035242
1133 Ga0307408_100105857
1134 Ga0307408_100129213
1135 Ga0307408_100310301
1136 Ga0307408_100925653
1137 Ga0307405_10545051
1138 Ga0307413_10089355
1139 Ga0307413_11116710
1140 Ga0307413_11508145
1141 Ga0307410_10053704
1142 Ga0307410_10073014
1143 Ga0307410_10749946
1144 Ga0307410_11011308
1145 Ga0307406_10151165
1146 Ga0307406_10276666
1147 Ga0307406_11322488
1148 Ga0307406_11540489
1149 Ga0307407_10078127
1150 Ga0307407_10175649
1151 Ga0307412_10103127
1152 Ga0307412_10426248
1153 Ga0307409_100032336
1154 Ga0307409_101264665
1155 Ga0307409_102601389
1156 Ga0307416_100069826
1157 Ga0307416_100211933
1158 Ga0307416_100327542
1159 Ga0307416_100416907
1160 Ga0307416_101290997
1161 Ga0307414_10025995
1162 Ga0307414_10082808
1163 Ga0307411_10010772
1164 Ga0307411_10013670
1165 Ga0307411_10136484
1166 Ga0307411_10245120
1167 Ga0307415_100090510
1168 Ga0307415_100631337
1169 Ga0307415_101514866
1170 Ga0307415_102298409
1171 Ga0307510_10136350
1172 Ga0307510_10269164
1173 Ga0373934_0011032
1174 Ga0373923_0122549
1175 Ga0373932_0121324
1176 Ga0373939_0304031
1177 Ga0373953_0001379
1178 Ga0373954_0000313
1179 Ga0373957_0002825
1180 Ga0373955_0000495
1181 Ga0373933_0003323
1182 Ga0373937_0001044
1183 Ga0395899_0002950
1184 Ga0395899_0643597
1185 Ga0395900_0100094
1186 Ga0395898_0028340
1187 Ga0395898_0054854
1188 Ga0395905_0552121
1189 Ga0395901_0002816
1190 Ga0395901_0004332
1191 Ga0395901_0213460
1192 Ga0395901_1592169
1193 Ga0439439_0065005
1194 Ga0439461_0065414
1195 Ga0439461_0079844
1196 Ga0451787_178779
1197 Ga0451789_0529924
1198 Ga0451793_0317576
1199 Ga0451798_0756100
1200 Ga0451807_0049124
1201 Ga0451853_2821110
1202 Ga0439431_0106524
1203 Ga0439433_0017664
1204 Ga0439441_016970
1205 Ga0439442_050322
1206 Ga0439443_006736
1207 Ga0450911_036276
1208 Ga0450922_041753
1209 Ga0450923_007548
1210 Ga0450895_007079
1211 Ga0450896_004133
1212 Ga0439446_0058145
1213 Ga0439458_0235844
1214 Ga0439434_0019414
1215 Ga0439434_0023489
1216 Ga0439435_0001054
1217 Ga0439444_0024881
1218 Ga0439460_0077928
1219 Ga0439440_0110970
1220 Ga0466957_0318426
1221 Ga0466960_0532951
1222 Ga0466960_0742290
1223 Ga0451576_1700425
1224 Ga0495617_172051
1225 Ga0495592_0005825
1226 Ga0495629_0100613
1227 Ga0495638_0162233
1228 Ga0495651_0001257
1229 Ga0495653_0000881
1230 Ga0495585_0287373
1231 Ga0495608_0000687
1232 Ga0495618_0382736
1233 Ga0495628_0107721
1234 Ga0495632_0113801
1235 Ga0495648_0436445
1236 Ga0495652_0004854
1237 Ga0495640_0180023
1238 Ga0495587_0000799
1239 Ga0495645_0123207
1240 Ga0495667_0001241
1241 Ga0495656_0253082
1242 Ga0495634_0059065
1243 Ga0495635_0001738
1244 Ga0495661_0214614
1245 Ga0495657_0001772
1246 Ga0495599_0000559
1247 Ga0495623_0021090
1248 Ga0495646_0100308
1249 Ga0495613_0677674
1250 Ga0495671_0024903
1251 Ga0495600_0000253
1252 Ga0495604_0001029
1253 Ga0495674_0028383
1254 Ga0495680_0001875
1255 Ga0495675_0000610
1256 Ga0495684_0001161
1257 Ga0495593_0005318
1258 Ga0495602_0009531
1259 Ga0496100_0831928
1260 Ga0496104_0014095
1261 Ga0496105_0193278
1262 Ga0496110_0583995
1263 Ga0496111_0212404
1264 Ga0496124_0076789
1265 Ga0501310_011971
1266 Ga0495682_0288058
1267 Ga0501294_001163
1268 Ga0501294_007365
1269 Ga0501296_058241
1270 Ga0501297_013151
1271 Ga0501297_067949
1272 Ga0501298_019896
1273 Ga0501298_037230
1274 Ga0501300_001721
1275 Ga0501302_017427
1276 Ga0501303_008507
1277 Ga0501315_024542
1278 Ga0501031_0318872
1279 Ga0501031_0645411
1280 Ga0501031_1108401
1281 Ga0501032_0006405
1282 Ga0501032_0126398
1283 Ga0501032_0135183
1284 Ga0501032_0779513
1285 Ga0501034_0000135
1286 Ga0501034_0021435
1287 Ga0501034_0027030
1288 Ga0501034_0107456
1289 Ga0501034_0355484
1290 Ga0501034_0862247
1291 Ga0501034_0984384
1292 Ga0501034_1001188
1293 Ga0501034_1389820
1294 Ga0501036_0005221
1295 Ga0501036_0024356
1296 Ga0501036_0668607
1297 Ga0501037_0003668
1298 Ga0501037_0116032
1299 Ga0501037_0291148
1300 Ga0501037_0440131
1301 Ga0501037_0463122
1302 Ga0501038_0476178
1303 Ga0501039_0000180
1304 Ga0501039_0234692
1305 Ga0501040_0076541
1306 Ga0501040_0101741
1307 Ga0501040_0129578
1308 Ga0501042_0171797
1309 Ga0501043_0554549
1310 Ga0501043_0582437
1311 Ga0501043_1147235
1312 Ga0501046_0003402
1313 Ga0501046_0163883
1314 Ga0501046_0214584
1315 Ga0501046_0235713
1316 Ga0501046_0970177
1317 Ga0501047_0000897
1318 Ga0501047_0008106
1319 Ga0501047_0017104
1320 Ga0501047_0023931
1321 Ga0501047_0082177
1322 Ga0501047_0619504
1323 Ga0501047_0705539
1324 Ga0501047_0974235
1325 Ga0501048_0227897
1326 Ga0501048_0238380
1327 Ga0501048_0620884
1328 Ga0501067_0004604
1329 Ga0501068_0304788
1330 Ga0501068_0923605
1331 Ga0501068_0985588
1332 Ga0501069_0029067
1333 Ga0501069_0045771
1334 Ga0501070_0002980
1335 Ga0501070_0025565
1336 Ga0501070_0065076
1337 Ga0501070_0326194
1338 Ga0501070_0395470
1339 Ga0501071_0018219
1340 Ga0501071_0119043
1341 Ga0501072_0067808
1342 Ga0501072_0335667
1343 Ga0501072_1453544
1344 Ga0501073_0009593
1345 Ga0501073_0023910
1346 Ga0501073_0082204
1347 Ga0501073_0097705
1348 Ga0501073_0327854
1349 Ga0501073_0458538
1350 Ga0501073_1118494
1351 Ga0501074_0007311
1352 Ga0501074_0063957
1353 Ga0501074_1091405
1354 Ga0501075_0053722
1355 Ga0501075_0456132
1356 Ga0501076_0011401
1357 Ga0501076_0462194
1358 Ga0501076_0891341
1359 Ga0501077_0041159
1360 Ga0501077_0331648
1361 Ga0501077_0711360
1362 Ga0501077_0990637
1363 Ga0501206_036028
1364 Ga0501206_048665
1365 Ga0501207_004182
1366 Ga0501210_001617
1367 Ga0501211_000217
1368 Ga0501222_003244
1369 Ga0501222_006973
1370 Ga0501223_014718
1371 Ga0501223_047419
1372 Ga0501227_002884
1373 Ga0501233_003766
1374 Ga0501235_006211
1375 Ga0501236_015234
1376 Ga0501242_060384
1377 Ga0501243_089665
1378 Ga0501247_027834
1379 Ga0501251_015400
1380 Ga0501252_008463
1381 Ga0501253_008143
1382 Ga0501253_054206
1383 Ga0501255_000809
1384 Ga0501257_028296
1385 Ga0501257_174427
1386 Ga0501258_004012
1387 Ga0501259_046328
1388 Ga0501221_000226
1389 Ga0501225_0118543
1390 Ga0501229_002173
1391 Ga0501079_0006178
1392 Ga0501079_0072081
1393 Ga0501079_0217344
1394 Ga0501079_0263166
1395 Ga0501080_0000298
1396 Ga0501080_0017691
1397 Ga0501080_0027130
1398 Ga0501080_0077838
1399 Ga0501080_0182396
1400 Ga0501080_0197177
1401 Ga0501080_0378407
1402 Ga0501080_0383668
1403 Ga0501080_0467694
1404 Ga0501080_1167768
1405 Ga0501081_0046548
1406 Ga0501081_0052097
1407 Ga0501081_0370996
1408 Ga0501081_1273014
1409 Ga0501083_0111702
1410 Ga0501083_0398809
1411 Ga0501232_001758
1412 Ga0501262_005214
1413 Ga0501262_014117
1414 Ga0501265_004898
1415 Ga0501265_019968
1416 Ga0501267_005752
1417 Ga0501268_073517
1418 Ga0501270_050502
1419 Ga0501272_006284
1420 Ga0501272_038274
1421 Ga0501273_032887
1422 Ga0501274_036899
1423 Ga0501282_024536
1424 Ga0501283_012928
1425 Ga0501283_098284
1426 Ga0501035_0000056
1427 Ga0501035_0000282
1428 Ga0501035_0006294
1429 Ga0501035_0006746
1430 Ga0501044_0000536
1431 Ga0501044_0011806
1432 Ga0501044_0039275
1433 Ga0501044_0089593
1434 Ga0501044_1414806
1435 Ga0501045_0005467
1436 Ga0501045_0659797
1437 Ga0501226_014596
1438 nmdc:mga03683_352107_c1
1439 nmdc:mga0qj67_108492_c1
1440 nmdc:mga08y16_1371723_c1
1441 nmdc:mga08y16_9336_c1
1442 nmdc:mga0rr50_1780915_c1
1443 nmdc:mga0sz30_77694_c1
1444 Ga0495601_0084566
1445 Ga0495595_0001458
1446 Ga0495619_0000685
1447 Ga0500644_0055826
1448 Ga0500646_0026524
1449 Ga0500583_0161346
1450 Ga0500583_0287338
1451 Ga0500651_0417854
1452 Ga0500650_0123477
1453 Ga0500562_172481
1454 Ga0500595_001067
1455 Ga0500614_216726
1456 Ga0500642_0000738
1457 Ga0500658_0008532
1458 Ga0500658_0109577
1459 Ga0500568_0046479
1460 Ga0500577_0127182
1461 Ga0500588_0018850
1462 Ga0500604_0004159
1463 Ga0500604_0020715
1464 Ga0500611_033113
1465 Ga0500611_161832
1466 Ga0500609_000975
1467 Ga0500656_026355
1468 Ga0500599_008793
1469 Ga0500587_004650
1470 Ga0501084_0000206
1471 Ga0501084_0001708
1472 Ga0501084_0090756
1473 Ga0501084_1041794
1474 Ga0590071_008554
1475 Ga0590074_024903
1476 Ga0590075_004438
1477 Ga0590077_046200
1478 Ga0501082_0007428
1479 Ga0501082_0011459
1480 Ga0501082_0060553
1481 Ga0501082_0147165
1482 Ga0501082_0161541
1483 Ga0501082_0486732
1484 Ga0501082_0685151
1485 Ga0530510_0392280
1486 Ga0530510_0718054
1487 Ga0530510_1595916
1488 2644304246
1489 2738845094
1490 2739274679
1491 2739343723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19447

DUF5985

Family of unknown function (DUF5985)

11

95

0.98

Map