F478703
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 352 | 723 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0199304|Ga0495686_0199304_100_531 |
| Length | 143 |
| Sequence | MCRLGRSAQGPVEKPGQATGLSMEELLLEYLPILIFIGLAAVLGSVLVAVPLLIAPSKPDPEKLSAYECGFPAFGDARMKFDVRFYLVAILFIIFDLEVAFLFPWAITLGDTGVFAFWSMMAFLGVLTVGFIYEWKKGALEWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 2 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 3 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 4 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 5 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 6 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 7 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 8 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 9 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 10 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 11 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 12 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 13 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 14 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 15 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 16 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 17 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 18 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 102 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 326 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 328 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 334 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 335 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 339 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 340 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 341 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 351 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 352 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.42 |
| Metatranscriptomes | 1.88 |
| Isolates | 2.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.25 |
| Nodule | 0.4 |
| Rhizoplane | 2.56 |
| Rhizosphere | 87.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031580 | 3300001979 | Bacteria | 1705 |
| 2 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 3 | JGI25153J46596_10000466 | 3300003215 | Bacteria | 25873 |
| 4 | Ga0058862_12843542 | 3300004803 | Unclassified | 845 |
| 5 | Ga0070658_10006762 | 3300005327 | Bacteria | 9281 |
| 6 | Ga0070658_10027665 | 3300005327 | Bacteria | 4549 |
| 7 | Ga0070658_10064135 | 3300005327 | Bacteria | 2996 |
| 8 | Ga0070658_10153901 | 3300005327 | Bacteria | 1927 |
| 9 | Ga0070658_10771702 | 3300005327 | Bacteria | 835 |
| 10 | Ga0070658_11573163 | 3300005327 | Bacteria | 570 |
| 11 | Ga0070676_10036937 | 3300005328 | Bacteria | 2815 |
| 12 | Ga0070676_10426680 | 3300005328 | Bacteria | 928 |
| 13 | Ga0070683_100089181 | 3300005329 | Bacteria | 2894 |
| 14 | Ga0070670_100631867 | 3300005331 | Bacteria | 960 |
| 15 | Ga0068869_100031662 | 3300005334 | Bacteria | 3721 |
| 16 | Ga0068869_100051960 | 3300005334 | Bacteria | 2975 |
| 17 | Ga0068869_100605648 | 3300005334 | Bacteria | 926 |
| 18 | Ga0070666_10012585 | 3300005335 | Bacteria | 5342 |
| 19 | Ga0070666_10122423 | 3300005335 | Bacteria | 1804 |
| 20 | Ga0068868_100062032 | 3300005338 | Bacteria | 2962 |
| 21 | Ga0068868_100169734 | 3300005338 | Bacteria | 1806 |
| 22 | Ga0068868_100611535 | 3300005338 | Bacteria | 966 |
| 23 | Ga0068868_101558809 | 3300005338 | Bacteria | 620 |
| 24 | Ga0068868_101580075 | 3300005338 | Bacteria | 616 |
| 25 | Ga0070660_100025903 | 3300005339 | Bacteria | 4362 |
| 26 | Ga0070660_100265338 | 3300005339 | Bacteria | 1403 |
| 27 | Ga0070689_100425155 | 3300005340 | Bacteria | 1127 |
| 28 | Ga0070691_10239573 | 3300005341 | Bacteria | 969 |
| 29 | Ga0070661_100356565 | 3300005344 | Bacteria | 1148 |
| 30 | Ga0070661_100403928 | 3300005344 | Bacteria | 1080 |
| 31 | Ga0070661_100724066 | 3300005344 | Bacteria | 812 |
| 32 | Ga0070668_100555709 | 3300005347 | Bacteria | 1000 |
| 33 | Ga0070668_101440033 | 3300005347 | Bacteria | 629 |
| 34 | Ga0070669_100831247 | 3300005353 | Bacteria | 786 |
| 35 | Ga0070675_100833052 | 3300005354 | Bacteria | 844 |
| 36 | Ga0070675_101429804 | 3300005354 | Bacteria | 638 |
| 37 | Ga0070675_102025577 | 3300005354 | Bacteria | 531 |
| 38 | Ga0070671_100112922 | 3300005355 | Bacteria | 2283 |
| 39 | Ga0070671_100119966 | 3300005355 | Bacteria | 2212 |
| 40 | Ga0070671_100644702 | 3300005355 | Bacteria | 917 |
| 41 | Ga0070671_100838247 | 3300005355 | Bacteria | 802 |
| 42 | Ga0070671_101251801 | 3300005355 | Bacteria | 654 |
| 43 | Ga0070674_100339651 | 3300005356 | Bacteria | 1209 |
| 44 | Ga0070674_100384288 | 3300005356 | Bacteria | 1143 |
| 45 | Ga0070674_100736085 | 3300005356 | Bacteria | 846 |
| 46 | Ga0070673_100014920 | 3300005364 | Bacteria | 5437 |
| 47 | Ga0070673_100152263 | 3300005364 | Bacteria | 1960 |
| 48 | Ga0070673_100545769 | 3300005364 | Bacteria | 1052 |
| 49 | Ga0070673_100727339 | 3300005364 | Bacteria | 913 |
| 50 | Ga0070659_100019822 | 3300005366 | Bacteria | 5105 |
| 51 | Ga0070667_100548381 | 3300005367 | Bacteria | 1062 |
| 52 | Ga0070714_100557379 | 3300005435 | Bacteria | 1098 |
| 53 | Ga0070714_101584568 | 3300005435 | Bacteria | 640 |
| 54 | Ga0070713_100598101 | 3300005436 | Bacteria | 1048 |
| 55 | Ga0070710_11545418 | 3300005437 | Bacteria | 500 |
| 56 | Ga0070701_10930445 | 3300005438 | Bacteria | 602 |
| 57 | Ga0070711_100458579 | 3300005439 | Bacteria | 1045 |
| 58 | Ga0070700_101443544 | 3300005441 | Bacteria | 583 |
| 59 | Ga0070694_101230478 | 3300005444 | Bacteria | 628 |
| 60 | Ga0070708_100696733 | 3300005445 | Bacteria | 956 |
| 61 | Ga0070678_100008807 | 3300005456 | Bacteria | 6067 |
| 62 | Ga0070678_100027342 | 3300005456 | Bacteria | 3872 |
| 63 | Ga0070678_100146986 | 3300005456 | Bacteria | 1893 |
| 64 | Ga0070678_100396678 | 3300005456 | Bacteria | 1197 |
| 65 | Ga0070678_100450097 | 3300005456 | Bacteria | 1128 |
| 66 | Ga0070662_100613439 | 3300005457 | Bacteria | 916 |
| 67 | Ga0070681_10113225 | 3300005458 | Bacteria | 2652 |
| 68 | Ga0070681_10225086 | 3300005458 | Bacteria | 1790 |
| 69 | Ga0070681_10258469 | 3300005458 | Bacteria | 1653 |
| 70 | Ga0068867_100185526 | 3300005459 | Bacteria | 1656 |
| 71 | Ga0068867_100411179 | 3300005459 | Bacteria | 1143 |
| 72 | Ga0068867_100663055 | 3300005459 | Bacteria | 917 |
| 73 | Ga0070685_10130177 | 3300005466 | Bacteria | 1573 |
| 74 | Ga0070685_10473299 | 3300005466 | Bacteria | 882 |
| 75 | Ga0070706_100570149 | 3300005467 | Bacteria | 1053 |
| 76 | Ga0070679_100385320 | 3300005530 | Bacteria | 1348 |
| 77 | Ga0070679_101107194 | 3300005530 | Bacteria | 737 |
| 78 | Ga0070684_100063794 | 3300005535 | Bacteria | 3230 |
| 79 | Ga0068853_100609167 | 3300005539 | Bacteria | 1037 |
| 80 | Ga0068853_100774801 | 3300005539 | Bacteria | 917 |
| 81 | Ga0068853_100803930 | 3300005539 | Bacteria | 901 |
| 82 | Ga0070672_100739438 | 3300005543 | Bacteria | 863 |
| 83 | Ga0070695_100067425 | 3300005545 | Bacteria | 2334 |
| 84 | Ga0070696_100012732 | 3300005546 | Bacteria | 5649 |
| 85 | Ga0070696_100066678 | 3300005546 | Bacteria | 2525 |
| 86 | Ga0070693_100326366 | 3300005547 | Bacteria | 1043 |
| 87 | Ga0070665_100000377 | 3300005548 | Bacteria | 66234 |
| 88 | Ga0070665_100031419 | 3300005548 | Bacteria | 5345 |
| 89 | Ga0070665_100561842 | 3300005548 | Bacteria | 1153 |
| 90 | Ga0070665_100939019 | 3300005548 | Bacteria | 877 |
| 91 | Ga0070704_100034903 | 3300005549 | Bacteria | 3415 |
| 92 | Ga0068855_100139889 | 3300005563 | Bacteria | 2760 |
| 93 | Ga0068855_100229654 | 3300005563 | Bacteria | 2079 |
| 94 | Ga0068855_100870162 | 3300005563 | Bacteria | 954 |
| 95 | Ga0068855_100930950 | 3300005563 | Bacteria | 916 |
| 96 | Ga0070664_100255968 | 3300005564 | Bacteria | 1575 |
| 97 | Ga0068857_100197011 | 3300005577 | Bacteria | 1835 |
| 98 | Ga0068857_100320837 | 3300005577 | Bacteria | 1431 |
| 99 | Ga0068857_100880813 | 3300005577 | Bacteria | 858 |
| 100 | Ga0068854_100317130 | 3300005578 | Bacteria | 1266 |
| 101 | Ga0068854_100631331 | 3300005578 | Bacteria | 918 |
| 102 | Ga0068854_101308650 | 3300005578 | Bacteria | 653 |
| 103 | Ga0068856_100285398 | 3300005614 | Bacteria | 1667 |
| 104 | Ga0068856_100358190 | 3300005614 | Bacteria | 1477 |
| 105 | Ga0070702_100399023 | 3300005615 | Bacteria | 983 |
| 106 | Ga0070702_100402483 | 3300005615 | Bacteria | 980 |
| 107 | Ga0070702_100871093 | 3300005615 | Bacteria | 703 |
| 108 | Ga0068852_100198042 | 3300005616 | Bacteria | 1900 |
| 109 | Ga0068852_100755757 | 3300005616 | Bacteria | 985 |
| 110 | Ga0068859_100241259 | 3300005617 | Bacteria | 1896 |
| 111 | Ga0068864_100219031 | 3300005618 | Bacteria | 1755 |
| 112 | Ga0068866_10154976 | 3300005718 | Bacteria | 1330 |
| 113 | Ga0068866_10274005 | 3300005718 | Bacteria | 1042 |
| 114 | Ga0068861_101108744 | 3300005719 | Bacteria | 761 |
| 115 | Ga0068861_101402057 | 3300005719 | Bacteria | 683 |
| 116 | Ga0068870_10328909 | 3300005840 | Bacteria | 974 |
| 117 | Ga0068863_100050041 | 3300005841 | Bacteria | 3962 |
| 118 | Ga0068863_100371455 | 3300005841 | Bacteria | 1396 |
| 119 | Ga0068863_101807961 | 3300005841 | Bacteria | 621 |
| 120 | Ga0068858_100057444 | 3300005842 | Bacteria | 3596 |
| 121 | Ga0068860_100294865 | 3300005843 | Bacteria | 1587 |
| 122 | Ga0068860_100617451 | 3300005843 | Bacteria | 1090 |
| 123 | Ga0068860_100846710 | 3300005843 | Bacteria | 929 |
| 124 | Ga0068860_101680740 | 3300005843 | Bacteria | 657 |
| 125 | Ga0068862_100200824 | 3300005844 | Bacteria | 1798 |
| 126 | Ga0068862_101295600 | 3300005844 | Bacteria | 730 |
| 127 | Ga0081540_1000205 | 3300005983 | Bacteria | 61689 |
| 128 | Ga0075364_10045490 | 3300006051 | Bacteria | 2857 |
| 129 | Ga0070712_100062640 | 3300006175 | Bacteria | 2631 |
| 130 | Ga0075367_10116750 | 3300006178 | Bacteria | 1642 |
| 131 | Ga0075367_10134580 | 3300006178 | Bacteria | 1529 |
| 132 | Ga0097621_100009066 | 3300006237 | Bacteria | 7209 |
| 133 | Ga0097621_100062488 | 3300006237 | Bacteria | 3057 |
| 134 | Ga0097621_100072773 | 3300006237 | Bacteria | 2844 |
| 135 | Ga0097621_100091216 | 3300006237 | Bacteria | 2550 |
| 136 | Ga0097621_100170206 | 3300006237 | Bacteria | 1877 |
| 137 | Ga0097621_100295270 | 3300006237 | Bacteria | 1430 |
| 138 | Ga0097621_100562573 | 3300006237 | Bacteria | 1039 |
| 139 | Ga0097621_100762088 | 3300006237 | Bacteria | 894 |
| 140 | Ga0097621_102208653 | 3300006237 | Bacteria | 526 |
| 141 | Ga0068871_100003001 | 3300006358 | Bacteria | 11579 |
| 142 | Ga0068871_100041132 | 3300006358 | Bacteria | 3705 |
| 143 | Ga0068871_100049228 | 3300006358 | Bacteria | 3406 |
| 144 | Ga0068871_100056443 | 3300006358 | Bacteria | 3192 |
| 145 | Ga0068871_100113445 | 3300006358 | Bacteria | 2282 |
| 146 | Ga0068871_100140742 | 3300006358 | Bacteria | 2051 |
| 147 | Ga0068871_100151086 | 3300006358 | Bacteria | 1981 |
| 148 | Ga0068871_100666783 | 3300006358 | Bacteria | 951 |
| 149 | Ga0075429_100004626 | 3300006880 | Bacteria | 11835 |
| 150 | Ga0068865_100005270 | 3300006881 | Bacteria | 7820 |
| 151 | Ga0068865_100099769 | 3300006881 | Bacteria | 2123 |
| 152 | Ga0068865_100232949 | 3300006881 | Bacteria | 1446 |
| 153 | Ga0097620_100241269 | 3300006931 | Bacteria | 1896 |
| 154 | Ga0105240_10007049 | 3300009093 | Bacteria | 16391 |
| 155 | Ga0105240_10042137 | 3300009093 | Bacteria | 5820 |
| 156 | Ga0105240_10467879 | 3300009093 | Bacteria | 1407 |
| 157 | Ga0105240_10583969 | 3300009093 | Bacteria | 1232 |
| 158 | Ga0105240_10690502 | 3300009093 | Bacteria | 1115 |
| 159 | Ga0105240_10813144 | 3300009093 | Bacteria | 1012 |
| 160 | Ga0105245_10563910 | 3300009098 | Bacteria | 1162 |
| 161 | Ga0105245_11035888 | 3300009098 | Bacteria | 866 |
| 162 | Ga0105245_11811942 | 3300009098 | Bacteria | 663 |
| 163 | Ga0105247_11161610 | 3300009101 | Bacteria | 612 |
| 164 | Ga0114129_10019435 | 3300009147 | Bacteria | 9672 |
| 165 | Ga0105243_10009445 | 3300009148 | Bacteria | 7431 |
| 166 | Ga0105243_10139405 | 3300009148 | Bacteria | 2067 |
| 167 | Ga0105243_10564307 | 3300009148 | Bacteria | 1090 |
| 168 | Ga0105243_11831897 | 3300009148 | Bacteria | 638 |
| 169 | Ga0105243_12104632 | 3300009148 | Bacteria | 600 |
| 170 | Ga0105241_10090260 | 3300009174 | Bacteria | 2416 |
| 171 | Ga0105241_10621210 | 3300009174 | Bacteria | 978 |
| 172 | Ga0105241_10786911 | 3300009174 | Bacteria | 875 |
| 173 | Ga0105241_12159981 | 3300009174 | Bacteria | 551 |
| 174 | Ga0105242_10007194 | 3300009176 | Bacteria | 8584 |
| 175 | Ga0105242_10008474 | 3300009176 | Bacteria | 7897 |
| 176 | Ga0105242_10155999 | 3300009176 | Bacteria | 1994 |
| 177 | Ga0105242_10170667 | 3300009176 | Bacteria | 1912 |
| 178 | Ga0105242_10825289 | 3300009176 | Bacteria | 920 |
| 179 | Ga0105242_11305792 | 3300009176 | Bacteria | 749 |
| 180 | Ga0105242_11386908 | 3300009176 | Bacteria | 730 |
| 181 | Ga0105242_12250612 | 3300009176 | Bacteria | 591 |
| 182 | Ga0105248_10037444 | 3300009177 | Bacteria | 5427 |
| 183 | Ga0105248_10117451 | 3300009177 | Bacteria | 3000 |
| 184 | Ga0105248_11534200 | 3300009177 | Bacteria | 754 |
| 185 | Ga0105237_10067577 | 3300009545 | Bacteria | 3568 |
| 186 | Ga0105237_10093949 | 3300009545 | Bacteria | 2988 |
| 187 | Ga0105237_10173036 | 3300009545 | Bacteria | 2159 |
| 188 | Ga0105237_10243423 | 3300009545 | Bacteria | 1800 |
| 189 | Ga0105237_10655266 | 3300009545 | Bacteria | 1057 |
| 190 | Ga0105238_10406100 | 3300009551 | Bacteria | 1356 |
| 191 | Ga0105238_10594474 | 3300009551 | Bacteria | 1114 |
| 192 | Ga0105238_11623997 | 3300009551 | Bacteria | 677 |
| 193 | Ga0105238_12530499 | 3300009551 | Bacteria | 549 |
| 194 | Ga0105249_10009654 | 3300009553 | Bacteria | 8456 |
| 195 | Ga0105249_10808087 | 3300009553 | Bacteria | 1002 |
| 196 | Ga0105148_109339 | 3300009978 | Bacteria | 739 |
| 197 | Ga0105028_100930 | 3300009993 | Bacteria | 3087 |
| 198 | Ga0105239_10133642 | 3300010375 | Bacteria | 2761 |
| 199 | Ga0105239_10315734 | 3300010375 | Bacteria | 1762 |
| 200 | Ga0105239_10333868 | 3300010375 | Bacteria | 1710 |
| 201 | Ga0105239_10934987 | 3300010375 | Bacteria | 995 |
| 202 | Ga0105239_11097277 | 3300010375 | Bacteria | 916 |
| 203 | Ga0105246_10026077 | 3300011119 | Bacteria | 3814 |
| 204 | Ga0105246_10117058 | 3300011119 | Bacteria | 1968 |
| 205 | Ga0105246_10603178 | 3300011119 | Bacteria | 949 |
| 206 | Ga0157373_10348522 | 3300013100 | Bacteria | 1056 |
| 207 | Ga0157373_10411083 | 3300013100 | Bacteria | 970 |
| 208 | Ga0157373_10640363 | 3300013100 | Bacteria | 776 |
| 209 | Ga0157373_10725236 | 3300013100 | Bacteria | 729 |
| 210 | Ga0157373_10963001 | 3300013100 | Bacteria | 635 |
| 211 | Ga0157370_10044464 | 3300013104 | Bacteria | 4268 |
| 212 | Ga0157370_10376156 | 3300013104 | Bacteria | 1308 |
| 213 | Ga0157369_10202414 | 3300013105 | Bacteria | 2083 |
| 214 | Ga0157369_10216271 | 3300013105 | Bacteria | 2007 |
| 215 | Ga0157374_10154379 | 3300013296 | Bacteria | 2233 |
| 216 | Ga0157374_10599568 | 3300013296 | Bacteria | 1111 |
| 217 | Ga0157374_10721804 | 3300013296 | Bacteria | 1010 |
| 218 | Ga0157378_10027149 | 3300013297 | Bacteria | 5051 |
| 219 | Ga0157378_10191007 | 3300013297 | Bacteria | 1931 |
| 220 | Ga0157378_10399326 | 3300013297 | Bacteria | 1354 |
| 221 | Ga0157378_10482734 | 3300013297 | Bacteria | 1235 |
| 222 | Ga0157378_10532737 | 3300013297 | Bacteria | 1177 |
| 223 | Ga0157378_10772059 | 3300013297 | Bacteria | 985 |
| 224 | Ga0157378_11446277 | 3300013297 | Bacteria | 731 |
| 225 | Ga0163162_10037679 | 3300013306 | Bacteria | 4826 |
| 226 | Ga0163162_10502992 | 3300013306 | Bacteria | 1342 |
| 227 | Ga0163162_11116554 | 3300013306 | Bacteria | 893 |
| 228 | Ga0163162_11338825 | 3300013306 | Bacteria | 814 |
| 229 | Ga0163162_12372709 | 3300013306 | Bacteria | 610 |
| 230 | Ga0157372_10126860 | 3300013307 | Bacteria | 2934 |
| 231 | Ga0157372_12087128 | 3300013307 | Bacteria | 651 |
| 232 | Ga0157375_10720366 | 3300013308 | Bacteria | 1150 |
| 233 | Ga0157375_11155580 | 3300013308 | Bacteria | 907 |
| 234 | Ga0157375_11941443 | 3300013308 | Bacteria | 699 |
| 235 | Ga0157375_11972143 | 3300013308 | Bacteria | 694 |
| 236 | Ga0157375_12752162 | 3300013308 | Bacteria | 588 |
| 237 | Ga0163163_10000491 | 3300014325 | Bacteria | 35805 |
| 238 | Ga0163163_10548764 | 3300014325 | Bacteria | 1218 |
| 239 | Ga0163163_12894005 | 3300014325 | Bacteria | 536 |
| 240 | Ga0157380_11421511 | 3300014326 | Bacteria | 745 |
| 241 | Ga0157377_10540259 | 3300014745 | Bacteria | 821 |
| 242 | Ga0157379_10037573 | 3300014968 | Bacteria | 4318 |
| 243 | Ga0157379_10062631 | 3300014968 | Bacteria | 3326 |
| 244 | Ga0157379_10078369 | 3300014968 | Bacteria | 2959 |
| 245 | Ga0157379_11876925 | 3300014968 | Bacteria | 590 |
| 246 | Ga0157376_10014841 | 3300014969 | Bacteria | 5863 |
| 247 | Ga0157376_10371772 | 3300014969 | Bacteria | 1374 |
| 248 | Ga0157376_10519062 | 3300014969 | Bacteria | 1174 |
| 249 | Ga0163161_10645300 | 3300017792 | Bacteria | 877 |
| 250 | Ga0206355_1210900 | 3300020076 | Eukaryota | 1000 |
| 251 | Ga0206350_10075980 | 3300020080 | Eukaryota | 912 |
| 252 | Ga0213874_10010862 | 3300021377 | Bacteria | 2291 |
| 253 | Ga0213874_10018562 | 3300021377 | Bacteria | 1881 |
| 254 | Ga0213871_10216264 | 3300021441 | Bacteria | 601 |
| 255 | Ga0224712_10177435 | 3300022467 | Bacteria | 958 |
| 256 | Ga0209563_118080 | 3300025230 | Bacteria | 833 |
| 257 | Ga0207427_104324 | 3300025231 | Bacteria | 2445 |
| 258 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 259 | Ga0209455_1013367 | 3300025272 | Bacteria | 1909 |
| 260 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 261 | Ga0207642_10217920 | 3300025899 | Bacteria | 1065 |
| 262 | Ga0207642_10292620 | 3300025899 | Bacteria | 941 |
| 263 | Ga0207642_10304755 | 3300025899 | Bacteria | 925 |
| 264 | Ga0207710_10201397 | 3300025900 | Bacteria | 983 |
| 265 | Ga0207645_10003004 | 3300025907 | Bacteria | 13034 |
| 266 | Ga0207645_10119125 | 3300025907 | Bacteria | 1713 |
| 267 | Ga0207643_10090745 | 3300025908 | Bacteria | 1781 |
| 268 | Ga0207643_10331058 | 3300025908 | Bacteria | 953 |
| 269 | Ga0207643_10607876 | 3300025908 | Bacteria | 704 |
| 270 | Ga0207705_10020579 | 3300025909 | Bacteria | 4711 |
| 271 | Ga0207705_10098319 | 3300025909 | Bacteria | 2150 |
| 272 | Ga0207705_10413766 | 3300025909 | Bacteria | 1043 |
| 273 | Ga0207705_10573863 | 3300025909 | Bacteria | 877 |
| 274 | Ga0207705_10686248 | 3300025909 | Bacteria | 796 |
| 275 | Ga0207684_10796322 | 3300025910 | Bacteria | 799 |
| 276 | Ga0207654_10048312 | 3300025911 | Bacteria | 2435 |
| 277 | Ga0207654_10592483 | 3300025911 | Bacteria | 790 |
| 278 | Ga0207654_10595488 | 3300025911 | Bacteria | 788 |
| 279 | Ga0207654_10719908 | 3300025911 | Bacteria | 718 |
| 280 | Ga0207707_10248987 | 3300025912 | Bacteria | 1544 |
| 281 | Ga0207707_10519529 | 3300025912 | Bacteria | 1014 |
| 282 | Ga0207707_10548205 | 3300025912 | Bacteria | 983 |
| 283 | Ga0207695_10538508 | 3300025913 | Bacteria | 1049 |
| 284 | Ga0207695_10841025 | 3300025913 | Bacteria | 798 |
| 285 | Ga0207695_10874433 | 3300025913 | Bacteria | 778 |
| 286 | Ga0207671_10214680 | 3300025914 | Bacteria | 1506 |
| 287 | Ga0207693_10425375 | 3300025915 | Bacteria | 1038 |
| 288 | Ga0207693_11164100 | 3300025915 | Bacteria | 583 |
| 289 | Ga0207663_11471634 | 3300025916 | Bacteria | 548 |
| 290 | Ga0207660_10413469 | 3300025917 | Bacteria | 1087 |
| 291 | Ga0207660_10808507 | 3300025917 | Bacteria | 765 |
| 292 | Ga0207662_10616523 | 3300025918 | Bacteria | 756 |
| 293 | Ga0207657_10042479 | 3300025919 | Bacteria | 4011 |
| 294 | Ga0207657_10124492 | 3300025919 | Bacteria | 2118 |
| 295 | Ga0207657_10272755 | 3300025919 | Bacteria | 1344 |
| 296 | Ga0207657_10486208 | 3300025919 | Bacteria | 967 |
| 297 | Ga0207649_11073600 | 3300025920 | Bacteria | 635 |
| 298 | Ga0207649_11429036 | 3300025920 | Bacteria | 547 |
| 299 | Ga0207652_10201022 | 3300025921 | Bacteria | 1793 |
| 300 | Ga0207652_10253755 | 3300025921 | Bacteria | 1586 |
| 301 | Ga0207681_11109693 | 3300025923 | Bacteria | 664 |
| 302 | Ga0207694_10163831 | 3300025924 | Bacteria | 1797 |
| 303 | Ga0207694_10174938 | 3300025924 | Bacteria | 1739 |
| 304 | Ga0207694_10175068 | 3300025924 | Bacteria | 1739 |
| 305 | Ga0207694_10178854 | 3300025924 | Bacteria | 1720 |
| 306 | Ga0207694_10419033 | 3300025924 | Bacteria | 1115 |
| 307 | Ga0207650_10308105 | 3300025925 | Bacteria | 1295 |
| 308 | Ga0207650_10476343 | 3300025925 | Bacteria | 1041 |
| 309 | Ga0207650_10560029 | 3300025925 | Bacteria | 959 |
| 310 | Ga0207659_11119211 | 3300025926 | Bacteria | 677 |
| 311 | Ga0207687_10187066 | 3300025927 | Bacteria | 1609 |
| 312 | Ga0207687_10672471 | 3300025927 | Bacteria | 877 |
| 313 | Ga0207687_10815368 | 3300025927 | Bacteria | 796 |
| 314 | Ga0207644_10210438 | 3300025931 | Bacteria | 1537 |
| 315 | Ga0207644_10276952 | 3300025931 | Bacteria | 1346 |
| 316 | Ga0207644_10793003 | 3300025931 | Bacteria | 792 |
| 317 | Ga0207644_11107522 | 3300025931 | Bacteria | 665 |
| 318 | Ga0207644_11220708 | 3300025931 | Bacteria | 632 |
| 319 | Ga0207690_10340979 | 3300025932 | Bacteria | 1183 |
| 320 | Ga0207690_10380054 | 3300025932 | Bacteria | 1122 |
| 321 | Ga0207690_10725611 | 3300025932 | Bacteria | 818 |
| 322 | Ga0207686_10022782 | 3300025934 | Bacteria | 3609 |
| 323 | Ga0207686_10147789 | 3300025934 | Bacteria | 1632 |
| 324 | Ga0207686_10466369 | 3300025934 | Bacteria | 974 |
| 325 | Ga0207709_10035973 | 3300025935 | Bacteria | 2932 |
| 326 | Ga0207709_10136610 | 3300025935 | Bacteria | 1679 |
| 327 | Ga0207670_10288462 | 3300025936 | Bacteria | 1281 |
| 328 | Ga0207669_10412133 | 3300025937 | Bacteria | 1061 |
| 329 | Ga0207669_10747290 | 3300025937 | Bacteria | 807 |
| 330 | Ga0207704_10019753 | 3300025938 | Bacteria | 3547 |
| 331 | Ga0207704_10064811 | 3300025938 | Bacteria | 2285 |
| 332 | Ga0207704_10158813 | 3300025938 | Bacteria | 1606 |
| 333 | Ga0207704_10822407 | 3300025938 | Bacteria | 777 |
| 334 | Ga0207704_11846130 | 3300025938 | Bacteria | 520 |
| 335 | Ga0207691_10126233 | 3300025940 | Bacteria | 2263 |
| 336 | Ga0207711_10019519 | 3300025941 | Bacteria | 5642 |
| 337 | Ga0207689_10024757 | 3300025942 | Bacteria | 5032 |
| 338 | Ga0207689_10077600 | 3300025942 | Bacteria | 2730 |
| 339 | Ga0207689_10195184 | 3300025942 | Bacteria | 1671 |
| 340 | Ga0207689_10294490 | 3300025942 | Bacteria | 1344 |
| 341 | Ga0207689_10801200 | 3300025942 | Bacteria | 795 |
| 342 | Ga0207661_10481164 | 3300025944 | Bacteria | 1133 |
| 343 | Ga0207679_10914844 | 3300025945 | Bacteria | 803 |
| 344 | Ga0207667_10071670 | 3300025949 | Bacteria | 3602 |
| 345 | Ga0207667_10246640 | 3300025949 | Bacteria | 1827 |
| 346 | Ga0207667_10441256 | 3300025949 | Bacteria | 1323 |
| 347 | Ga0207667_10626635 | 3300025949 | Bacteria | 1083 |
| 348 | Ga0207667_10816911 | 3300025949 | Bacteria | 928 |
| 349 | Ga0207667_11270137 | 3300025949 | Bacteria | 714 |
| 350 | Ga0207651_10540750 | 3300025960 | Bacteria | 1012 |
| 351 | Ga0207651_11947679 | 3300025960 | Bacteria | 528 |
| 352 | Ga0207712_10048552 | 3300025961 | Bacteria | 2953 |
| 353 | Ga0207712_10348833 | 3300025961 | Bacteria | 1230 |
| 354 | Ga0207668_10702134 | 3300025972 | Bacteria | 889 |
| 355 | Ga0207640_10261887 | 3300025981 | Bacteria | 1348 |
| 356 | Ga0207640_10732565 | 3300025981 | Bacteria | 851 |
| 357 | Ga0207640_10995687 | 3300025981 | Bacteria | 737 |
| 358 | Ga0207658_10340416 | 3300025986 | Bacteria | 1303 |
| 359 | Ga0207677_10886672 | 3300026023 | Bacteria | 803 |
| 360 | Ga0207677_11964559 | 3300026023 | Bacteria | 544 |
| 361 | Ga0207703_10090432 | 3300026035 | Bacteria | 2573 |
| 362 | Ga0207639_10383353 | 3300026041 | Bacteria | 1263 |
| 363 | Ga0207639_10667485 | 3300026041 | Bacteria | 963 |
| 364 | Ga0207639_11344134 | 3300026041 | Bacteria | 671 |
| 365 | Ga0207678_10636500 | 3300026067 | Bacteria | 936 |
| 366 | Ga0207678_10677124 | 3300026067 | Bacteria | 907 |
| 367 | Ga0207702_10267177 | 3300026078 | Bacteria | 1612 |
| 368 | Ga0207702_10400325 | 3300026078 | Bacteria | 1324 |
| 369 | Ga0207702_10850731 | 3300026078 | Bacteria | 903 |
| 370 | Ga0207702_11158794 | 3300026078 | Bacteria | 767 |
| 371 | Ga0207641_10031995 | 3300026088 | Bacteria | 4365 |
| 372 | Ga0207641_11090129 | 3300026088 | Bacteria | 797 |
| 373 | Ga0207648_10034161 | 3300026089 | Bacteria | 4484 |
| 374 | Ga0207648_10034253 | 3300026089 | Bacteria | 4477 |
| 375 | Ga0207648_10906949 | 3300026089 | Bacteria | 823 |
| 376 | Ga0207648_11053719 | 3300026089 | Bacteria | 762 |
| 377 | Ga0207676_11682612 | 3300026095 | Bacteria | 633 |
| 378 | Ga0207676_11885917 | 3300026095 | Bacteria | 596 |
| 379 | Ga0207674_10117367 | 3300026116 | Bacteria | 2631 |
| 380 | Ga0207674_10462892 | 3300026116 | Bacteria | 1225 |
| 381 | Ga0207674_10846167 | 3300026116 | Bacteria | 882 |
| 382 | Ga0207674_11144211 | 3300026116 | Bacteria | 748 |
| 383 | Ga0207675_101179940 | 3300026118 | Bacteria | 786 |
| 384 | Ga0207675_102065079 | 3300026118 | Bacteria | 587 |
| 385 | Ga0207683_10026414 | 3300026121 | Bacteria | 5010 |
| 386 | Ga0207683_10030002 | 3300026121 | Bacteria | 4710 |
| 387 | Ga0207683_10162911 | 3300026121 | Bacteria | 2017 |
| 388 | Ga0207683_10576933 | 3300026121 | Bacteria | 1040 |
| 389 | Ga0207683_10779530 | 3300026121 | Bacteria | 887 |
| 390 | Ga0207683_11039319 | 3300026121 | Bacteria | 760 |
| 391 | Ga0207698_10229526 | 3300026142 | Bacteria | 1684 |
| 392 | Ga0207698_11922732 | 3300026142 | Bacteria | 606 |
| 393 | Ga0268266_10392286 | 3300028379 | Bacteria | 1311 |
| 394 | Ga0268266_10685065 | 3300028379 | Bacteria | 987 |
| 395 | Ga0268265_10638737 | 3300028380 | Bacteria | 1022 |
| 396 | Ga0268265_11072674 | 3300028380 | Bacteria | 799 |
| 397 | Ga0268264_10876763 | 3300028381 | Bacteria | 900 |
| 398 | Ga0265318_10001257 | 3300028577 | Bacteria | 15341 |
| 399 | Ga0265338_10486327 | 3300028800 | Bacteria | 870 |
| 400 | Ga0265338_10715930 | 3300028800 | Bacteria | 690 |
| 401 | Ga0265324_10001784 | 3300029957 | Bacteria | 11754 |
| 402 | Ga0265324_10254405 | 3300029957 | Bacteria | 597 |
| 403 | Ga0265330_10053979 | 3300031235 | Bacteria | 1757 |
| 404 | Ga0265330_10165280 | 3300031235 | Bacteria | 939 |
| 405 | Ga0265330_10362549 | 3300031235 | Bacteria | 612 |
| 406 | Ga0265332_10007275 | 3300031238 | Bacteria | 5008 |
| 407 | Ga0265332_10176988 | 3300031238 | Bacteria | 889 |
| 408 | Ga0265328_10103375 | 3300031239 | Bacteria | 1056 |
| 409 | Ga0265328_10195220 | 3300031239 | Bacteria | 768 |
| 410 | Ga0265325_10002319 | 3300031241 | Bacteria | 12918 |
| 411 | Ga0265325_10039093 | 3300031241 | Bacteria | 2500 |
| 412 | Ga0265325_10107400 | 3300031241 | Bacteria | 1360 |
| 413 | Ga0265329_10073585 | 3300031242 | Bacteria | 1081 |
| 414 | Ga0265340_10179016 | 3300031247 | Bacteria | 959 |
| 415 | Ga0265339_10005265 | 3300031249 | Bacteria | 8630 |
| 416 | Ga0265339_10049879 | 3300031249 | Bacteria | 2290 |
| 417 | Ga0265339_10085331 | 3300031249 | Bacteria | 1662 |
| 418 | Ga0265331_10000066 | 3300031250 | Bacteria | 163571 |
| 419 | Ga0265331_10135656 | 3300031250 | Bacteria | 1121 |
| 420 | Ga0265331_10210177 | 3300031250 | Bacteria | 876 |
| 421 | Ga0265316_10056849 | 3300031344 | Bacteria | 3053 |
| 422 | Ga0265316_10399001 | 3300031344 | Bacteria | 991 |
| 423 | Ga0265316_10414262 | 3300031344 | Bacteria | 969 |
| 424 | Ga0265316_10844982 | 3300031344 | Bacteria | 641 |
| 425 | Ga0307513_11012325 | 3300031456 | Bacteria | 541 |
| 426 | Ga0307509_10664965 | 3300031507 | Bacteria | 710 |
| 427 | Ga0265313_10003662 | 3300031595 | Bacteria | 12297 |
| 428 | Ga0265313_10008701 | 3300031595 | Bacteria | 6708 |
| 429 | Ga0265313_10017912 | 3300031595 | Bacteria | 4000 |
| 430 | Ga0265314_10000125 | 3300031711 | Bacteria | 118671 |
| 431 | Ga0265314_10015417 | 3300031711 | Bacteria | 6067 |
| 432 | Ga0265314_10063862 | 3300031711 | Bacteria | 2496 |
| 433 | Ga0265314_10101807 | 3300031711 | Bacteria | 1845 |
| 434 | Ga0265314_10468408 | 3300031711 | Bacteria | 668 |
| 435 | Ga0265342_10142787 | 3300031712 | Bacteria | 1335 |
| 436 | Ga0265342_10257693 | 3300031712 | Bacteria | 929 |
| 437 | Ga0265342_10309157 | 3300031712 | Bacteria | 831 |
| 438 | Ga0316576_10097823 | 3300031727 | Bacteria | 2191 |
| 439 | Ga0316578_10036022 | 3300031728 | Bacteria | 2847 |
| 440 | Ga0307516_10063104 | 3300031730 | Bacteria | 3588 |
| 441 | Ga0307405_11200022 | 3300031731 | Bacteria | 656 |
| 442 | Ga0307406_10562495 | 3300031901 | Bacteria | 935 |
| 443 | Ga0307409_102474495 | 3300031995 | Bacteria | 548 |
| 444 | Ga0307416_100751936 | 3300032002 | Bacteria | 1068 |
| 445 | Ga0307411_10248580 | 3300032005 | Bacteria | 1397 |
| 446 | Ga0316585_10254928 | 3300032137 | Bacteria | 582 |
| 447 | Ga0316593_10032416 | 3300032168 | Bacteria | 1707 |
| 448 | Ga0316593_10157933 | 3300032168 | Bacteria | 827 |
| 449 | Ga0316593_10223314 | 3300032168 | Bacteria | 700 |
| 450 | Ga0316593_10255282 | 3300032168 | Bacteria | 657 |
| 451 | Ga0307510_10247674 | 3300033180 | Bacteria | 1272 |
| 452 | Ga0307510_10268418 | 3300033180 | Bacteria | 1184 |
| 453 | Ga0316587_1034131 | 3300033529 | Bacteria | 906 |
| 454 | Ga0373939_0176091 | 3300035114 | Bacteria | 795 |
| 455 | Ga0373953_0349090 | 3300035117 | Bacteria | 648 |
| 456 | Ga0373955_0275466 | 3300035172 | Bacteria | 1012 |
| 457 | Ga0316574_0202438 | 3300035398 | Bacteria | 1275 |
| 458 | Ga0373931_0581748 | 3300035691 | Bacteria | 730 |
| 459 | Ga0373933_0851632 | 3300035724 | Bacteria | 600 |
| 460 | Ga0373937_0067460 | 3300036401 | Bacteria | 3296 |
| 461 | Ga0373937_0145830 | 3300036401 | Bacteria | 2216 |
| 462 | Ga0316582_0040931 | 3300036647 | Bacteria | 2894 |
| 463 | Ga0316584_0000187 | 3300036712 | Bacteria | 30114 |
| 464 | Ga0316584_0123400 | 3300036712 | Bacteria | 1935 |
| 465 | Ga0395899_0380977 | 3300037312 | Bacteria | 937 |
| 466 | Ga0395900_0040247 | 3300037418 | Bacteria | 4817 |
| 467 | Ga0395905_0017082 | 3300037471 | Bacteria | 6890 |
| 468 | Ga0395905_1520550 | 3300037471 | Bacteria | 574 |
| 469 | Ga0395905_1887499 | 3300037471 | Bacteria | 504 |
| 470 | Ga0395901_1043192 | 3300038443 | Bacteria | 791 |
| 471 | Ga0436365_0437804 | 3300039437 | Bacteria | 1242 |
| 472 | Ga0436360_0181532 | 3300039438 | Bacteria | 2321 |
| 473 | Ga0436360_0464388 | 3300039438 | Bacteria | 645 |
| 474 | Ga0436360_1035776 | 3300039438 | Bacteria | 4465 |
| 475 | Ga0436360_1308938 | 3300039438 | Bacteria | 1394 |
| 476 | Ga0436361_1147293 | 3300039447 | Bacteria | 1029 |
| 477 | Ga0436363_0072239 | 3300039450 | Bacteria | 1409 |
| 478 | Ga0436363_0370956 | 3300039450 | Bacteria | 5153 |
| 479 | Ga0436363_1493646 | 3300039450 | Bacteria | 614 |
| 480 | Ga0436363_1576522 | 3300039450 | Bacteria | 636 |
| 481 | Ga0436362_0226131 | 3300039453 | Bacteria | 706 |
| 482 | Ga0436362_0755406 | 3300039453 | Bacteria | 628 |
| 483 | Ga0439465_0260153 | 3300041413 | Bacteria | 643 |
| 484 | Ga0451789_0426280 | 3300041443 | Bacteria | 527 |
| 485 | Ga0451793_1912129 | 3300041452 | Bacteria | 1106 |
| 486 | Ga0451853_2188647 | 3300041512 | Bacteria | 578 |
| 487 | Ga0466969_0032441 | 3300044656 | Bacteria | 2655 |
| 488 | Ga0466972_0005552 | 3300044658 | Bacteria | 6318 |
| 489 | Ga0466965_0013493 | 3300044683 | Bacteria | 3856 |
| 490 | Ga0466966_0029784 | 3300044684 | Bacteria | 3549 |
| 491 | Ga0466961_0034201 | 3300044693 | Bacteria | 3263 |
| 492 | Ga0466963_0049226 | 3300044694 | Bacteria | 2787 |
| 493 | Ga0466963_0339405 | 3300044694 | Bacteria | 1058 |
| 494 | Ga0466964_0356825 | 3300044706 | Bacteria | 753 |
| 495 | Ga0453684_0006154 | 3300044712 | Bacteria | 23083 |
| 496 | Ga0453684_0010839 | 3300044712 | Bacteria | 15449 |
| 497 | Ga0453684_1862699 | 3300044712 | Unclassified | 610 |
| 498 | Ga0466959_0032290 | 3300045049 | Bacteria | 3875 |
| 499 | Ga0466967_0552571 | 3300045976 | Bacteria | 1133 |
| 500 | Ga0495584_0429651 | 3300046491 | Bacteria | 672 |
| 501 | Ga0495583_0381251 | 3300046506 | Bacteria | 555 |
| 502 | Ga0495606_0376267 | 3300046507 | Bacteria | 746 |
| 503 | Ga0495648_0404954 | 3300046524 | Bacteria | 609 |
| 504 | Ga0495652_0650608 | 3300046529 | Bacteria | 714 |
| 505 | Ga0495652_0758145 | 3300046529 | Bacteria | 649 |
| 506 | Ga0495587_0141879 | 3300046536 | Bacteria | 1371 |
| 507 | Ga0495587_0826541 | 3300046536 | Bacteria | 505 |
| 508 | Ga0495598_0260408 | 3300046537 | Bacteria | 645 |
| 509 | Ga0495609_0061548 | 3300046538 | Bacteria | 1658 |
| 510 | Ga0495621_0183290 | 3300046539 | Bacteria | 836 |
| 511 | Ga0495645_0529773 | 3300046543 | Bacteria | 733 |
| 512 | Ga0495622_0002413 | 3300046557 | Bacteria | 9081 |
| 513 | Ga0495625_0117728 | 3300046660 | Bacteria | 1811 |
| 514 | Ga0495657_0643311 | 3300046675 | Bacteria | 612 |
| 515 | Ga0495599_0422479 | 3300046678 | Bacteria | 792 |
| 516 | Ga0495623_0298600 | 3300046679 | Bacteria | 891 |
| 517 | Ga0495658_0384503 | 3300046683 | Bacteria | 894 |
| 518 | Ga0495669_0305792 | 3300046684 | Bacteria | 767 |
| 519 | Ga0495669_0436480 | 3300046684 | Bacteria | 636 |
| 520 | Ga0495624_0572118 | 3300046690 | Bacteria | 674 |
| 521 | Ga0495671_0410750 | 3300046692 | Bacteria | 648 |
| 522 | Ga0495649_0205481 | 3300046694 | Bacteria | 1022 |
| 523 | Ga0495589_0471785 | 3300046794 | Bacteria | 574 |
| 524 | Ga0495600_0393921 | 3300046809 | Bacteria | 863 |
| 525 | Ga0495674_0072391 | 3300047319 | Bacteria | 2973 |
| 526 | Ga0495675_0427202 | 3300047444 | Bacteria | 769 |
| 527 | Ga0495681_0328824 | 3300047470 | Bacteria | 585 |
| 528 | Ga0495686_0199304 | 3300047472 | Bacteria | 1150 |
| 529 | Ga0496100_0393869 | 3300048903 | Bacteria | 1054 |
| 530 | Ga0496101_0528839 | 3300048904 | Bacteria | 932 |
| 531 | Ga0496101_0620582 | 3300048904 | Bacteria | 855 |
| 532 | Ga0496104_0159085 | 3300048907 | Bacteria | 2167 |
| 533 | Ga0496104_0258418 | 3300048907 | Bacteria | 1655 |
| 534 | Ga0496106_0251736 | 3300048909 | Bacteria | 1412 |
| 535 | Ga0496106_1066746 | 3300048909 | Bacteria | 634 |
| 536 | Ga0496107_0841040 | 3300048910 | Bacteria | 671 |
| 537 | Ga0496108_1113509 | 3300048911 | Bacteria | 670 |
| 538 | Ga0496109_0107185 | 3300048912 | Bacteria | 2595 |
| 539 | Ga0496109_0257522 | 3300048912 | Bacteria | 1643 |
| 540 | Ga0496110_0083171 | 3300048913 | Bacteria | 2855 |
| 541 | Ga0496111_0166415 | 3300048914 | Bacteria | 1637 |
| 542 | Ga0496113_0083234 | 3300048916 | Bacteria | 2455 |
| 543 | Ga0496113_0803199 | 3300048916 | Bacteria | 747 |
| 544 | Ga0496115_0360664 | 3300048918 | Bacteria | 1184 |
| 545 | Ga0496115_0397658 | 3300048918 | Bacteria | 1118 |
| 546 | Ga0496117_0570678 | 3300048920 | Bacteria | 535 |
| 547 | Ga0496124_0000206 | 3300048927 | Bacteria | 116591 |
| 548 | Ga0496126_0124615 | 3300048929 | Bacteria | 2231 |
| 549 | Ga0496126_0632921 | 3300048929 | Bacteria | 839 |
| 550 | Ga0501335_050008 | 3300049551 | Bacteria | 508 |
| 551 | Ga0501031_0055737 | 3300049568 | Bacteria | 2576 |
| 552 | Ga0501032_0028469 | 3300049569 | Bacteria | 3839 |
| 553 | Ga0501032_0191710 | 3300049569 | Bacteria | 1336 |
| 554 | Ga0501032_0673496 | 3300049569 | Bacteria | 656 |
| 555 | Ga0501033_0005971 | 3300049570 | Bacteria | 9558 |
| 556 | Ga0501033_0033498 | 3300049570 | Bacteria | 3856 |
| 557 | Ga0501033_0098453 | 3300049570 | Bacteria | 2136 |
| 558 | Ga0501033_0099741 | 3300049570 | Bacteria | 2120 |
| 559 | Ga0501033_0156275 | 3300049570 | Bacteria | 1643 |
| 560 | Ga0501033_0194501 | 3300049570 | Bacteria | 1450 |
| 561 | Ga0501033_0389886 | 3300049570 | Bacteria | 972 |
| 562 | Ga0501033_0419602 | 3300049570 | Bacteria | 932 |
| 563 | Ga0501033_0486685 | 3300049570 | Bacteria | 854 |
| 564 | Ga0501033_0660730 | 3300049570 | Bacteria | 713 |
| 565 | Ga0501033_1126035 | 3300049570 | Bacteria | 521 |
| 566 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 567 | Ga0501034_0007641 | 3300049571 | Bacteria | 11499 |
| 568 | Ga0501034_0022877 | 3300049571 | Bacteria | 6367 |
| 569 | Ga0501034_0025819 | 3300049571 | Bacteria | 5983 |
| 570 | Ga0501034_0065576 | 3300049571 | Bacteria | 3644 |
| 571 | Ga0501034_0137305 | 3300049571 | Bacteria | 2426 |
| 572 | Ga0501034_0149015 | 3300049571 | Bacteria | 2316 |
| 573 | Ga0501034_0197895 | 3300049571 | Bacteria | 1969 |
| 574 | Ga0501034_0408115 | 3300049571 | Bacteria | 1281 |
| 575 | Ga0501034_0560524 | 3300049571 | Bacteria | 1051 |
| 576 | Ga0501034_1331686 | 3300049571 | Bacteria | 594 |
| 577 | Ga0501036_0000599 | 3300049572 | Bacteria | 26132 |
| 578 | Ga0501036_0011755 | 3300049572 | Bacteria | 7253 |
| 579 | Ga0501036_0096558 | 3300049572 | Bacteria | 2498 |
| 580 | Ga0501036_0127636 | 3300049572 | Bacteria | 2148 |
| 581 | Ga0501036_0474276 | 3300049572 | Bacteria | 1042 |
| 582 | Ga0501036_0557681 | 3300049572 | Bacteria | 952 |
| 583 | Ga0501036_1020219 | 3300049572 | Bacteria | 677 |
| 584 | Ga0501036_1028072 | 3300049572 | Bacteria | 674 |
| 585 | Ga0501037_0009260 | 3300049573 | Bacteria | 7219 |
| 586 | Ga0501037_0306682 | 3300049573 | Bacteria | 1101 |
| 587 | Ga0501037_0558818 | 3300049573 | Bacteria | 772 |
| 588 | Ga0501038_0015209 | 3300049574 | Bacteria | 6997 |
| 589 | Ga0501038_0159627 | 3300049574 | Bacteria | 1833 |
| 590 | Ga0501038_0220162 | 3300049574 | Bacteria | 1515 |
| 591 | Ga0501038_1235484 | 3300049574 | Bacteria | 541 |
| 592 | Ga0501039_0000020 | 3300049575 | Bacteria | 162656 |
| 593 | Ga0501039_0090768 | 3300049575 | Bacteria | 2381 |
| 594 | Ga0501039_0217253 | 3300049575 | Bacteria | 1503 |
| 595 | Ga0501039_0461240 | 3300049575 | Bacteria | 998 |
| 596 | Ga0501040_0517947 | 3300049576 | Bacteria | 860 |
| 597 | Ga0501041_0171467 | 3300049577 | Bacteria | 1358 |
| 598 | Ga0501042_0291156 | 3300049578 | Bacteria | 1179 |
| 599 | Ga0501042_0891354 | 3300049578 | Bacteria | 648 |
| 600 | Ga0501043_0040103 | 3300049579 | Bacteria | 3680 |
| 601 | Ga0501043_0277810 | 3300049579 | Bacteria | 1284 |
| 602 | Ga0501043_0337953 | 3300049579 | Bacteria | 1146 |
| 603 | Ga0501043_0520561 | 3300049579 | Bacteria | 886 |
| 604 | Ga0501043_0825251 | 3300049579 | Bacteria | 669 |
| 605 | Ga0501043_1072902 | 3300049579 | Bacteria | 570 |
| 606 | Ga0501046_0002229 | 3300049580 | Bacteria | 18281 |
| 607 | Ga0501046_0052222 | 3300049580 | Bacteria | 3222 |
| 608 | Ga0501046_0183796 | 3300049580 | Bacteria | 1562 |
| 609 | Ga0501046_0187613 | 3300049580 | Bacteria | 1544 |
| 610 | Ga0501046_0193427 | 3300049580 | Bacteria | 1516 |
| 611 | Ga0501047_0000257 | 3300049581 | Bacteria | 62079 |
| 612 | Ga0501047_0022850 | 3300049581 | Bacteria | 6004 |
| 613 | Ga0501047_0024473 | 3300049581 | Bacteria | 5794 |
| 614 | Ga0501047_0029451 | 3300049581 | Bacteria | 5293 |
| 615 | Ga0501047_0106894 | 3300049581 | Bacteria | 2679 |
| 616 | Ga0501047_0132561 | 3300049581 | Bacteria | 2372 |
| 617 | Ga0501047_0255560 | 3300049581 | Bacteria | 1600 |
| 618 | Ga0501047_0310146 | 3300049581 | Bacteria | 1418 |
| 619 | Ga0501047_0372572 | 3300049581 | Bacteria | 1263 |
| 620 | Ga0501047_0627217 | 3300049581 | Bacteria | 895 |
| 621 | Ga0501047_0828851 | 3300049581 | Bacteria | 739 |
| 622 | Ga0501048_0000588 | 3300049582 | Bacteria | 25774 |
| 623 | Ga0501048_0003231 | 3300049582 | Bacteria | 12423 |
| 624 | Ga0501048_0330690 | 3300049582 | Bacteria | 1086 |
| 625 | Ga0501068_0096297 | 3300049584 | Bacteria | 1831 |
| 626 | Ga0501069_0026474 | 3300049585 | Bacteria | 3176 |
| 627 | Ga0501069_0052122 | 3300049585 | Bacteria | 2278 |
| 628 | Ga0501070_0017840 | 3300049586 | Bacteria | 5959 |
| 629 | Ga0501070_0053047 | 3300049586 | Bacteria | 3364 |
| 630 | Ga0501070_0156181 | 3300049586 | Bacteria | 1881 |
| 631 | Ga0501070_0620642 | 3300049586 | Bacteria | 861 |
| 632 | Ga0501070_0952393 | 3300049586 | Bacteria | 667 |
| 633 | Ga0501071_1432467 | 3300049587 | Bacteria | 533 |
| 634 | Ga0501072_0538791 | 3300049588 | Bacteria | 922 |
| 635 | Ga0501073_0007903 | 3300049589 | Bacteria | 7891 |
| 636 | Ga0501073_0174001 | 3300049589 | Bacteria | 1490 |
| 637 | Ga0501073_0190178 | 3300049589 | Bacteria | 1420 |
| 638 | Ga0501073_0536781 | 3300049589 | Bacteria | 808 |
| 639 | Ga0501074_0006918 | 3300049590 | Bacteria | 8188 |
| 640 | Ga0501074_0012043 | 3300049590 | Bacteria | 6282 |
| 641 | Ga0501074_0581738 | 3300049590 | Bacteria | 792 |
| 642 | Ga0501076_1224553 | 3300049592 | Bacteria | 618 |
| 643 | Ga0501076_1714651 | 3300049592 | Bacteria | 515 |
| 644 | Ga0501249_165636 | 3300049679 | Bacteria | 564 |
| 645 | Ga0501219_024403 | 3300049703 | Bacteria | 542 |
| 646 | Ga0501079_0052216 | 3300049741 | Bacteria | 3155 |
| 647 | Ga0501080_0000183 | 3300049742 | Bacteria | 45555 |
| 648 | Ga0501080_0209359 | 3300049742 | Bacteria | 1787 |
| 649 | Ga0501080_0899322 | 3300049742 | Bacteria | 772 |
| 650 | Ga0501080_1605307 | 3300049742 | Bacteria | 551 |
| 651 | Ga0501080_1668884 | 3300049742 | Bacteria | 538 |
| 652 | Ga0501083_0007725 | 3300049744 | Bacteria | 7624 |
| 653 | Ga0501083_0012732 | 3300049744 | Bacteria | 5882 |
| 654 | Ga0501083_0076257 | 3300049744 | Bacteria | 2225 |
| 655 | Ga0501083_0100623 | 3300049744 | Bacteria | 1906 |
| 656 | Ga0501083_0390055 | 3300049744 | Bacteria | 906 |
| 657 | Ga0501083_0529756 | 3300049744 | Bacteria | 767 |
| 658 | Ga0501035_0013093 | 3300049822 | Bacteria | 7655 |
| 659 | Ga0501035_0037027 | 3300049822 | Bacteria | 4420 |
| 660 | Ga0501035_0059854 | 3300049822 | Bacteria | 3392 |
| 661 | Ga0501035_0116655 | 3300049822 | Bacteria | 2336 |
| 662 | Ga0501035_0118870 | 3300049822 | Bacteria | 2312 |
| 663 | Ga0501035_0137265 | 3300049822 | Bacteria | 2128 |
| 664 | Ga0501035_0245579 | 3300049822 | Bacteria | 1521 |
| 665 | Ga0501035_0287046 | 3300049822 | Bacteria | 1389 |
| 666 | Ga0501035_1225882 | 3300049822 | Bacteria | 581 |
| 667 | Ga0501044_0001700 | 3300049823 | Bacteria | 25816 |
| 668 | Ga0501044_0005286 | 3300049823 | Bacteria | 14356 |
| 669 | Ga0501044_0037841 | 3300049823 | Bacteria | 5041 |
| 670 | Ga0501044_0077196 | 3300049823 | Bacteria | 3379 |
| 671 | Ga0501044_0122579 | 3300049823 | Bacteria | 2599 |
| 672 | Ga0501044_0156054 | 3300049823 | Bacteria | 2262 |
| 673 | Ga0501044_0186812 | 3300049823 | Bacteria | 2037 |
| 674 | Ga0501044_0267456 | 3300049823 | Bacteria | 1646 |
| 675 | Ga0501044_0443089 | 3300049823 | Bacteria | 1206 |
| 676 | Ga0501044_0641829 | 3300049823 | Bacteria | 951 |
| 677 | Ga0501044_0807877 | 3300049823 | Bacteria | 817 |
| 678 | Ga0501044_1409192 | 3300049823 | Bacteria | 562 |
| 679 | Ga0501045_0473472 | 3300049824 | Bacteria | 931 |
| 680 | nmdc:mga03n38_21522_c1 | 3300050490 | Bacteria | 2167 |
| 681 | nmdc:mga03n38_490481_c1 | 3300050490 | Bacteria | 688 |
| 682 | nmdc:mga06z11_74517_c1 | 3300050494 | Bacteria | 1805 |
| 683 | nmdc:mga04h51_3910_c1 | 3300050495 | Bacteria | 3664 |
| 684 | nmdc:mga07m45_255690_c1 | 3300050496 | Bacteria | 1019 |
| 685 | nmdc:mga05p37_41697_c1 | 3300050507 | Bacteria | 5637 |
| 686 | nmdc:mga09592_31860_c1 | 3300050508 | Bacteria | 4395 |
| 687 | nmdc:mga0qj67_8249_c1 | 3300050509 | Bacteria | 7723 |
| 688 | nmdc:mga06r32_1832829_c1 | 3300050510 | Bacteria | 542 |
| 689 | Ga0500635_0175456 | 3300053080 | Bacteria | 826 |
| 690 | Ga0495619_0034703 | 3300053085 | Bacteria | 3280 |
| 691 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 692 | Ga0500646_0054934 | 3300053090 | Bacteria | 1158 |
| 693 | Ga0500646_0311446 | 3300053090 | Bacteria | 567 |
| 694 | Ga0500641_0298351 | 3300053096 | Bacteria | 662 |
| 695 | Ga0500556_0035718 | 3300053104 | Bacteria | 1719 |
| 696 | Ga0500593_138306 | 3300053117 | Bacteria | 962 |
| 697 | Ga0500595_000793 | 3300053119 | Bacteria | 18365 |
| 698 | Ga0500595_022389 | 3300053119 | Bacteria | 2239 |
| 699 | Ga0500595_073621 | 3300053119 | Bacteria | 1010 |
| 700 | Ga0500595_084132 | 3300053119 | Bacteria | 928 |
| 701 | Ga0500595_131264 | 3300053119 | Bacteria | 705 |
| 702 | Ga0500608_305605 | 3300053122 | Bacteria | 587 |
| 703 | Ga0500614_111246 | 3300053123 | Bacteria | 799 |
| 704 | Ga0500655_129826 | 3300053133 | Bacteria | 538 |
| 705 | Ga0500559_0162219 | 3300053136 | Bacteria | 1050 |
| 706 | Ga0500559_0188504 | 3300053136 | Bacteria | 972 |
| 707 | Ga0500568_0023085 | 3300053139 | Bacteria | 2650 |
| 708 | Ga0500568_0070303 | 3300053139 | Bacteria | 1341 |
| 709 | Ga0500573_0000008 | 3300053140 | Bacteria | 237795 |
| 710 | Ga0500600_0002542 | 3300053149 | Bacteria | 10288 |
| 711 | Ga0500604_0000195 | 3300053151 | Bacteria | 17351 |
| 712 | Ga0500639_129880 | 3300053163 | Bacteria | 1195 |
| 713 | Ga0500645_063977 | 3300053730 | Bacteria | 1061 |
| 714 | Ga0501084_0012879 | 3300054114 | Bacteria | 6927 |
| 715 | Ga0501084_0473492 | 3300054114 | Bacteria | 1059 |
| 716 | Ga0587077_112908 | 3300059493 | Bacteria | 668 |
| 717 | Ga0587101_005090 | 3300059623 | Bacteria | 1441 |
| 718 | Ga0587062_009839 | 3300059639 | Bacteria | 1174 |
| 719 | Ga0587076_045441 | 3300059645 | Bacteria | 837 |
| 720 | Ga0501082_0040697 | 3300060353 | Bacteria | 4008 |
| 721 | Ga0501082_0498399 | 3300060353 | Bacteria | 1064 |
| 722 | Ga0466962_0063065 | 3300061719 | Bacteria | 1769 |
| 723 | Ga0530510_1580002 | 3300061734 | Bacteria | 504 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0000206 | Ga0496124_0000206_74967_75365 | 104 |
| 2 | 3300009093 | Ga0105240_10007049 | Ga0105240_1000704913 | 107 |
| 3 | 3300009545 | Ga0105237_10093949 | Ga0105237_100939492 | 107 |
| 4 | 3300010375 | Ga0105239_10315734 | Ga0105239_103157342 | 107 |
| 5 | 3300037471 | Ga0395905_0017082 | Ga0395905_0017082_5703_6074 | 114 |
| 6 | 3300049551 | Ga0501335_050008 | Ga0501335_050008_29_400 | 114 |
| 7 | iso_pu_bacteria | 2511231027 | 2511390628 | 117 |
| 8 | iso_pu_bacteria | 2545555834 | 2545679384 | 117 |
| 9 | iso_pu_bacteria | 2595698237 | 2596375143 | 117 |
| 10 | iso_pu_bacteria | 2643221629 | 2644167519 | 117 |
| 11 | iso_pu_bacteria | 2643221662 | 2644347282 | 117 |
| 12 | iso_pu_bacteria | 2837678835 | 2837680167 | 117 |
| 13 | iso_pu_bacteria | 2842694124 | 2842696897 | 117 |
| 14 | iso_pu_bacteria | 2842871566 | 2842872841 | 117 |
| 15 | iso_pu_bacteria | 2889306138 | 2889311774 | 117 |
| 16 | iso_pu_bacteria | 2894817345 | 2894818422 | 117 |
| 17 | iso_pu_bacteria | 2902330777 | 2902335352 | 117 |
| 18 | iso_pu_bacteria | 2902405164 | 2902409445 | 117 |
| 19 | iso_pu_bacteria | 2909042592 | 2909048083 | 117 |
| 20 | iso_pu_bacteria | 2928125067 | 2928126493 | 117 |
| 21 | iso_pu_bacteria | 2928521798 | 2928524301 | 117 |
| 22 | iso_pu_bacteria | 2954011201 | 2954015423 | 117 |
| 23 | iso_pu_bacteria | 3002141150 | 3002143548 | 117 |
| 24 | iso_pu_bacteria | 3003665799 | 3003670821 | 117 |
| 25 | iso_pu_bacteria | 641522639 | 641644531 | 117 |
| 26 | iso_pu_bacteria | 8045864390 | 8045865185 | 117 |
| 27 | 3300005344 | Ga0070661_100403928 | Ga0070661_1004039282 | 118 |
| 28 | 3300005445 | Ga0070708_100696733 | Ga0070708_1006967331 | 118 |
| 29 | 3300006880 | Ga0075429_100004626 | Ga0075429_1000046267 | 118 |
| 30 | 3300009147 | Ga0114129_10019435 | Ga0114129_1001943512 | 118 |
| 31 | 3300013100 | Ga0157373_10411083 | Ga0157373_104110832 | 118 |
| 32 | 3300013100 | Ga0157373_10963001 | Ga0157373_109630011 | 118 |
| 33 | 3300014968 | Ga0157379_11876925 | Ga0157379_118769252 | 118 |
| 34 | 3300020080 | Ga0206350_10075980 | Ga0206350_100759801 | 118 |
| 35 | 3300022467 | Ga0224712_10177435 | Ga0224712_101774353 | 118 |
| 36 | 3300025920 | Ga0207649_11429036 | Ga0207649_114290361 | 118 |
| 37 | 3300025927 | Ga0207687_10187066 | Ga0207687_101870664 | 118 |
| 38 | 3300025938 | Ga0207704_11846130 | Ga0207704_118461301 | 118 |
| 39 | 3300025949 | Ga0207667_10071670 | Ga0207667_100716705 | 118 |
| 40 | 3300031727 | Ga0316576_10097823 | Ga0316576_100978233 | 118 |
| 41 | 3300031728 | Ga0316578_10036022 | Ga0316578_100360222 | 118 |
| 42 | 3300032137 | Ga0316585_10254928 | Ga0316585_102549282 | 118 |
| 43 | 3300032168 | Ga0316593_10157933 | Ga0316593_101579331 | 118 |
| 44 | 3300032168 | Ga0316593_10223314 | Ga0316593_102233142 | 118 |
| 45 | 3300032168 | Ga0316593_10255282 | Ga0316593_102552821 | 118 |
| 46 | 3300033529 | Ga0316587_1034131 | Ga0316587_10341311 | 118 |
| 47 | 3300035398 | Ga0316574_0202438 | Ga0316574_0202438_82_438 | 118 |
| 48 | 3300036712 | Ga0316584_0000187 | Ga0316584_0000187_14819_15175 | 118 |
| 49 | 3300039438 | Ga0436360_1035776 | Ga0436360_1035776_454_810 | 118 |
| 50 | 3300039450 | Ga0436363_1493646 | Ga0436363_1493646_96_464 | 118 |
| 51 | 3300044712 | Ga0453684_0006154 | Ga0453684_0006154_8111_8467 | 118 |
| 52 | 3300048916 | Ga0496113_0083234 | Ga0496113_0083234_1564_1932 | 118 |
| 53 | 3300049679 | Ga0501249_165636 | Ga0501249_165636_169_525 | 118 |
| 54 | 3300049703 | Ga0501219_024403 | Ga0501219_024403_77_433 | 118 |
| 55 | 3300050507 | nmdc:mga05p37_41697_c1 | nmdc:mga05p37_41697_c1_2679_3035 | 118 |
| 56 | 3300050508 | nmdc:mga09592_31860_c1 | nmdc:mga09592_31860_c1_126_482 | 118 |
| 57 | 3300050509 | nmdc:mga0qj67_8249_c1 | nmdc:mga0qj67_8249_c1_2679_3035 | 118 |
| 58 | 3300050510 | nmdc:mga06r32_1832829_c1 | nmdc:mga06r32_1832829_c1_164_532 | 118 |
| 59 | 3300053119 | Ga0500595_073621 | Ga0500595_073621_544_900 | 118 |
| 60 | 3300004803 | Ga0058862_12843542 | Ga0058862_128435422 | 119 |
| 61 | 3300005841 | Ga0068863_100371455 | Ga0068863_1003714553 | 119 |
| 62 | 3300006051 | Ga0075364_10045490 | Ga0075364_100454902 | 119 |
| 63 | 3300013308 | Ga0157375_12752162 | Ga0157375_127521621 | 119 |
| 64 | 3300020076 | Ga0206355_1210900 | Ga0206355_12109004 | 119 |
| 65 | 3300025931 | Ga0207644_10793003 | Ga0207644_107930031 | 119 |
| 66 | 3300039437 | Ga0436365_0437804 | Ga0436365_0437804_618_977 | 119 |
| 67 | 3300044656 | Ga0466969_0032441 | Ga0466969_0032441_1182_1541 | 119 |
| 68 | 3300044658 | Ga0466972_0005552 | Ga0466972_0005552_5422_5781 | 119 |
| 69 | 3300044683 | Ga0466965_0013493 | Ga0466965_0013493_3286_3645 | 119 |
| 70 | 3300044684 | Ga0466966_0029784 | Ga0466966_0029784_161_520 | 119 |
| 71 | 3300044693 | Ga0466961_0034201 | Ga0466961_0034201_1301_1660 | 119 |
| 72 | 3300044694 | Ga0466963_0049226 | Ga0466963_0049226_2166_2525 | 119 |
| 73 | 3300045049 | Ga0466959_0032290 | Ga0466959_0032290_882_1241 | 119 |
| 74 | 3300049581 | Ga0501047_0029451 | Ga0501047_0029451_1545_1904 | 119 |
| 75 | 3300049822 | Ga0501035_0116655 | Ga0501035_0116655_1740_2099 | 119 |
| 76 | 3300049823 | Ga0501044_0001700 | Ga0501044_0001700_4570_4929 | 119 |
| 77 | 3300049823 | Ga0501044_0807877 | Ga0501044_0807877_202_561 | 119 |
| 78 | 3300053149 | Ga0500600_0002542 | Ga0500600_0002542_9206_9565 | 119 |
| 79 | 3300061719 | Ga0466962_0063065 | Ga0466962_0063065_251_610 | 119 |
| 80 | 3300026041 | Ga0207639_11344134 | Ga0207639_113441342 | 120 |
| 81 | 3300028379 | Ga0268266_10392286 | Ga0268266_103922861 | 120 |
| 82 | 3300049570 | Ga0501033_0033498 | Ga0501033_0033498_2866_3231 | 120 |
| 83 | 3300001979 | JGI24740J21852_10031580 | JGI24740J21852_100315801 | 121 |
| 84 | 3300003214 | JGI25165J46597_1000003 | JGI25165J46597_10000031 | 121 |
| 85 | 3300003215 | JGI25153J46596_10000466 | JGI25153J46596_100004668 | 121 |
| 86 | 3300005327 | Ga0070658_10006762 | Ga0070658_100067629 | 121 |
| 87 | 3300005327 | Ga0070658_10027665 | Ga0070658_100276658 | 121 |
| 88 | 3300005327 | Ga0070658_10064135 | Ga0070658_100641357 | 121 |
| 89 | 3300005327 | Ga0070658_10153901 | Ga0070658_101539015 | 121 |
| 90 | 3300005327 | Ga0070658_10771702 | Ga0070658_107717022 | 121 |
| 91 | 3300005327 | Ga0070658_11573163 | Ga0070658_115731631 | 121 |
| 92 | 3300005328 | Ga0070676_10036937 | Ga0070676_100369374 | 121 |
| 93 | 3300005328 | Ga0070676_10426680 | Ga0070676_104266802 | 121 |
| 94 | 3300005329 | Ga0070683_100089181 | Ga0070683_1000891814 | 121 |
| 95 | 3300005331 | Ga0070670_100631867 | Ga0070670_1006318672 | 121 |
| 96 | 3300005334 | Ga0068869_100031662 | Ga0068869_1000316622 | 121 |
| 97 | 3300005334 | Ga0068869_100051960 | Ga0068869_1000519603 | 121 |
| 98 | 3300005334 | Ga0068869_100605648 | Ga0068869_1006056482 | 121 |
| 99 | 3300005335 | Ga0070666_10012585 | Ga0070666_100125855 | 121 |
| 100 | 3300005335 | Ga0070666_10122423 | Ga0070666_101224233 | 121 |
| 101 | 3300005338 | Ga0068868_100062032 | Ga0068868_1000620323 | 121 |
| 102 | 3300005338 | Ga0068868_100169734 | Ga0068868_1001697344 | 121 |
| 103 | 3300005338 | Ga0068868_100611535 | Ga0068868_1006115352 | 121 |
| 104 | 3300005338 | Ga0068868_101558809 | Ga0068868_1015588092 | 121 |
| 105 | 3300005338 | Ga0068868_101580075 | Ga0068868_1015800751 | 121 |
| 106 | 3300005339 | Ga0070660_100025903 | Ga0070660_1000259032 | 121 |
| 107 | 3300005339 | Ga0070660_100265338 | Ga0070660_1002653382 | 121 |
| 108 | 3300005340 | Ga0070689_100425155 | Ga0070689_1004251552 | 121 |
| 109 | 3300005341 | Ga0070691_10239573 | Ga0070691_102395732 | 121 |
| 110 | 3300005344 | Ga0070661_100356565 | Ga0070661_1003565652 | 121 |
| 111 | 3300005344 | Ga0070661_100724066 | Ga0070661_1007240662 | 121 |
| 112 | 3300005347 | Ga0070668_100555709 | Ga0070668_1005557092 | 121 |
| 113 | 3300005347 | Ga0070668_101440033 | Ga0070668_1014400331 | 121 |
| 114 | 3300005353 | Ga0070669_100831247 | Ga0070669_1008312472 | 121 |
| 115 | 3300005354 | Ga0070675_100833052 | Ga0070675_1008330521 | 121 |
| 116 | 3300005354 | Ga0070675_101429804 | Ga0070675_1014298041 | 121 |
| 117 | 3300005354 | Ga0070675_102025577 | Ga0070675_1020255771 | 121 |
| 118 | 3300005355 | Ga0070671_100112922 | Ga0070671_1001129221 | 121 |
| 119 | 3300005355 | Ga0070671_100119966 | Ga0070671_1001199665 | 121 |
| 120 | 3300005355 | Ga0070671_100644702 | Ga0070671_1006447022 | 121 |
| 121 | 3300005355 | Ga0070671_100838247 | Ga0070671_1008382471 | 121 |
| 122 | 3300005355 | Ga0070671_101251801 | Ga0070671_1012518011 | 121 |
| 123 | 3300005356 | Ga0070674_100339651 | Ga0070674_1003396512 | 121 |
| 124 | 3300005356 | Ga0070674_100384288 | Ga0070674_1003842882 | 121 |
| 125 | 3300005356 | Ga0070674_100736085 | Ga0070674_1007360851 | 121 |
| 126 | 3300005364 | Ga0070673_100014920 | Ga0070673_1000149209 | 121 |
| 127 | 3300005364 | Ga0070673_100152263 | Ga0070673_1001522632 | 121 |
| 128 | 3300005364 | Ga0070673_100545769 | Ga0070673_1005457691 | 121 |
| 129 | 3300005364 | Ga0070673_100727339 | Ga0070673_1007273392 | 121 |
| 130 | 3300005366 | Ga0070659_100019822 | Ga0070659_1000198227 | 121 |
| 131 | 3300005367 | Ga0070667_100548381 | Ga0070667_1005483812 | 121 |
| 132 | 3300005435 | Ga0070714_100557379 | Ga0070714_1005573792 | 121 |
| 133 | 3300005435 | Ga0070714_101584568 | Ga0070714_1015845682 | 121 |
| 134 | 3300005436 | Ga0070713_100598101 | Ga0070713_1005981012 | 121 |
| 135 | 3300005437 | Ga0070710_11545418 | Ga0070710_115454181 | 121 |
| 136 | 3300005438 | Ga0070701_10930445 | Ga0070701_109304452 | 121 |
| 137 | 3300005439 | Ga0070711_100458579 | Ga0070711_1004585793 | 121 |
| 138 | 3300005441 | Ga0070700_101443544 | Ga0070700_1014435441 | 121 |
| 139 | 3300005444 | Ga0070694_101230478 | Ga0070694_1012304781 | 121 |
| 140 | 3300005456 | Ga0070678_100008807 | Ga0070678_1000088073 | 121 |
| 141 | 3300005456 | Ga0070678_100027342 | Ga0070678_1000273425 | 121 |
| 142 | 3300005456 | Ga0070678_100146986 | Ga0070678_1001469862 | 121 |
| 143 | 3300005456 | Ga0070678_100396678 | Ga0070678_1003966782 | 121 |
| 144 | 3300005456 | Ga0070678_100450097 | Ga0070678_1004500972 | 121 |
| 145 | 3300005457 | Ga0070662_100613439 | Ga0070662_1006134392 | 121 |
| 146 | 3300005458 | Ga0070681_10113225 | Ga0070681_101132254 | 121 |
| 147 | 3300005458 | Ga0070681_10225086 | Ga0070681_102250863 | 121 |
| 148 | 3300005458 | Ga0070681_10258469 | Ga0070681_102584692 | 121 |
| 149 | 3300005459 | Ga0068867_100185526 | Ga0068867_1001855263 | 121 |
| 150 | 3300005459 | Ga0068867_100411179 | Ga0068867_1004111792 | 121 |
| 151 | 3300005459 | Ga0068867_100663055 | Ga0068867_1006630551 | 121 |
| 152 | 3300005466 | Ga0070685_10130177 | Ga0070685_101301771 | 121 |
| 153 | 3300005466 | Ga0070685_10473299 | Ga0070685_104732992 | 121 |
| 154 | 3300005467 | Ga0070706_100570149 | Ga0070706_1005701491 | 121 |
| 155 | 3300005530 | Ga0070679_100385320 | Ga0070679_1003853202 | 121 |
| 156 | 3300005530 | Ga0070679_101107194 | Ga0070679_1011071941 | 121 |
| 157 | 3300005535 | Ga0070684_100063794 | Ga0070684_1000637941 | 121 |
| 158 | 3300005539 | Ga0068853_100609167 | Ga0068853_1006091672 | 121 |
| 159 | 3300005539 | Ga0068853_100774801 | Ga0068853_1007748012 | 121 |
| 160 | 3300005539 | Ga0068853_100803930 | Ga0068853_1008039302 | 121 |
| 161 | 3300005543 | Ga0070672_100739438 | Ga0070672_1007394381 | 121 |
| 162 | 3300005545 | Ga0070695_100067425 | Ga0070695_1000674252 | 121 |
| 163 | 3300005546 | Ga0070696_100012732 | Ga0070696_1000127322 | 121 |
| 164 | 3300005546 | Ga0070696_100066678 | Ga0070696_1000666782 | 121 |
| 165 | 3300005547 | Ga0070693_100326366 | Ga0070693_1003263662 | 121 |
| 166 | 3300005548 | Ga0070665_100000377 | Ga0070665_10000037713 | 121 |
| 167 | 3300005548 | Ga0070665_100031419 | Ga0070665_1000314194 | 121 |
| 168 | 3300005548 | Ga0070665_100561842 | Ga0070665_1005618423 | 121 |
| 169 | 3300005548 | Ga0070665_100939019 | Ga0070665_1009390192 | 121 |
| 170 | 3300005549 | Ga0070704_100034903 | Ga0070704_1000349035 | 121 |
| 171 | 3300005563 | Ga0068855_100139889 | Ga0068855_1001398894 | 121 |
| 172 | 3300005563 | Ga0068855_100229654 | Ga0068855_1002296542 | 121 |
| 173 | 3300005563 | Ga0068855_100870162 | Ga0068855_1008701622 | 121 |
| 174 | 3300005563 | Ga0068855_100930950 | Ga0068855_1009309502 | 121 |
| 175 | 3300005564 | Ga0070664_100255968 | Ga0070664_1002559683 | 121 |
| 176 | 3300005577 | Ga0068857_100197011 | Ga0068857_1001970112 | 121 |
| 177 | 3300005577 | Ga0068857_100320837 | Ga0068857_1003208373 | 121 |
| 178 | 3300005577 | Ga0068857_100880813 | Ga0068857_1008808131 | 121 |
| 179 | 3300005578 | Ga0068854_100317130 | Ga0068854_1003171302 | 121 |
| 180 | 3300005578 | Ga0068854_100631331 | Ga0068854_1006313312 | 121 |
| 181 | 3300005578 | Ga0068854_101308650 | Ga0068854_1013086502 | 121 |
| 182 | 3300005614 | Ga0068856_100285398 | Ga0068856_1002853983 | 121 |
| 183 | 3300005614 | Ga0068856_100358190 | Ga0068856_1003581902 | 121 |
| 184 | 3300005615 | Ga0070702_100399023 | Ga0070702_1003990232 | 121 |
| 185 | 3300005615 | Ga0070702_100402483 | Ga0070702_1004024831 | 121 |
| 186 | 3300005615 | Ga0070702_100871093 | Ga0070702_1008710931 | 121 |
| 187 | 3300005616 | Ga0068852_100198042 | Ga0068852_1001980422 | 121 |
| 188 | 3300005616 | Ga0068852_100755757 | Ga0068852_1007557572 | 121 |
| 189 | 3300005617 | Ga0068859_100241259 | Ga0068859_1002412593 | 121 |
| 190 | 3300005618 | Ga0068864_100219031 | Ga0068864_1002190312 | 121 |
| 191 | 3300005718 | Ga0068866_10154976 | Ga0068866_101549763 | 121 |
| 192 | 3300005718 | Ga0068866_10274005 | Ga0068866_102740052 | 121 |
| 193 | 3300005719 | Ga0068861_101108744 | Ga0068861_1011087441 | 121 |
| 194 | 3300005719 | Ga0068861_101402057 | Ga0068861_1014020571 | 121 |
| 195 | 3300005840 | Ga0068870_10328909 | Ga0068870_103289092 | 121 |
| 196 | 3300005841 | Ga0068863_100050041 | Ga0068863_1000500414 | 121 |
| 197 | 3300005841 | Ga0068863_101807961 | Ga0068863_1018079612 | 121 |
| 198 | 3300005842 | Ga0068858_100057444 | Ga0068858_1000574442 | 121 |
| 199 | 3300005843 | Ga0068860_100294865 | Ga0068860_1002948653 | 121 |
| 200 | 3300005843 | Ga0068860_100617451 | Ga0068860_1006174512 | 121 |
| 201 | 3300005843 | Ga0068860_100846710 | Ga0068860_1008467101 | 121 |
| 202 | 3300005843 | Ga0068860_101680740 | Ga0068860_1016807402 | 121 |
| 203 | 3300005844 | Ga0068862_100200824 | Ga0068862_1002008242 | 121 |
| 204 | 3300005844 | Ga0068862_101295600 | Ga0068862_1012956001 | 121 |
| 205 | 3300005983 | Ga0081540_1000205 | Ga0081540_100020526 | 121 |
| 206 | 3300006175 | Ga0070712_100062640 | Ga0070712_1000626403 | 121 |
| 207 | 3300006178 | Ga0075367_10116750 | Ga0075367_101167502 | 121 |
| 208 | 3300006178 | Ga0075367_10134580 | Ga0075367_101345801 | 121 |
| 209 | 3300006237 | Ga0097621_100009066 | Ga0097621_1000090664 | 121 |
| 210 | 3300006237 | Ga0097621_100062488 | Ga0097621_1000624883 | 121 |
| 211 | 3300006237 | Ga0097621_100072773 | Ga0097621_1000727733 | 121 |
| 212 | 3300006237 | Ga0097621_100091216 | Ga0097621_1000912161 | 121 |
| 213 | 3300006237 | Ga0097621_100170206 | Ga0097621_1001702061 | 121 |
| 214 | 3300006237 | Ga0097621_100295270 | Ga0097621_1002952702 | 121 |
| 215 | 3300006237 | Ga0097621_100562573 | Ga0097621_1005625731 | 121 |
| 216 | 3300006237 | Ga0097621_100762088 | Ga0097621_1007620882 | 121 |
| 217 | 3300006237 | Ga0097621_102208653 | Ga0097621_1022086532 | 121 |
| 218 | 3300006358 | Ga0068871_100003001 | Ga0068871_1000030011 | 121 |
| 219 | 3300006358 | Ga0068871_100041132 | Ga0068871_1000411323 | 121 |
| 220 | 3300006358 | Ga0068871_100049228 | Ga0068871_1000492285 | 121 |
| 221 | 3300006358 | Ga0068871_100056443 | Ga0068871_1000564434 | 121 |
| 222 | 3300006358 | Ga0068871_100113445 | Ga0068871_1001134454 | 121 |
| 223 | 3300006358 | Ga0068871_100140742 | Ga0068871_1001407422 | 121 |
| 224 | 3300006358 | Ga0068871_100151086 | Ga0068871_1001510864 | 121 |
| 225 | 3300006358 | Ga0068871_100666783 | Ga0068871_1006667831 | 121 |
| 226 | 3300006881 | Ga0068865_100005270 | Ga0068865_1000052709 | 121 |
| 227 | 3300006881 | Ga0068865_100099769 | Ga0068865_1000997693 | 121 |
| 228 | 3300006881 | Ga0068865_100232949 | Ga0068865_1002329491 | 121 |
| 229 | 3300006931 | Ga0097620_100241269 | Ga0097620_1002412693 | 121 |
| 230 | 3300009093 | Ga0105240_10042137 | Ga0105240_100421376 | 121 |
| 231 | 3300009093 | Ga0105240_10467879 | Ga0105240_104678793 | 121 |
| 232 | 3300009093 | Ga0105240_10583969 | Ga0105240_105839692 | 121 |
| 233 | 3300009093 | Ga0105240_10690502 | Ga0105240_106905022 | 121 |
| 234 | 3300009093 | Ga0105240_10813144 | Ga0105240_108131442 | 121 |
| 235 | 3300009098 | Ga0105245_10563910 | Ga0105245_105639102 | 121 |
| 236 | 3300009098 | Ga0105245_11035888 | Ga0105245_110358882 | 121 |
| 237 | 3300009098 | Ga0105245_11811942 | Ga0105245_118119422 | 121 |
| 238 | 3300009101 | Ga0105247_11161610 | Ga0105247_111616102 | 121 |
| 239 | 3300009148 | Ga0105243_10009445 | Ga0105243_1000944510 | 121 |
| 240 | 3300009148 | Ga0105243_10139405 | Ga0105243_101394053 | 121 |
| 241 | 3300009148 | Ga0105243_10564307 | Ga0105243_105643071 | 121 |
| 242 | 3300009148 | Ga0105243_11831897 | Ga0105243_118318972 | 121 |
| 243 | 3300009148 | Ga0105243_12104632 | Ga0105243_121046321 | 121 |
| 244 | 3300009174 | Ga0105241_10090260 | Ga0105241_100902604 | 121 |
| 245 | 3300009174 | Ga0105241_10621210 | Ga0105241_106212102 | 121 |
| 246 | 3300009174 | Ga0105241_10786911 | Ga0105241_107869111 | 121 |
| 247 | 3300009174 | Ga0105241_12159981 | Ga0105241_121599811 | 121 |
| 248 | 3300009176 | Ga0105242_10007194 | Ga0105242_1000719412 | 121 |
| 249 | 3300009176 | Ga0105242_10008474 | Ga0105242_100084748 | 121 |
| 250 | 3300009176 | Ga0105242_10155999 | Ga0105242_101559992 | 121 |
| 251 | 3300009176 | Ga0105242_10170667 | Ga0105242_101706671 | 121 |
| 252 | 3300009176 | Ga0105242_10825289 | Ga0105242_108252892 | 121 |
| 253 | 3300009176 | Ga0105242_11305792 | Ga0105242_113057922 | 121 |
| 254 | 3300009176 | Ga0105242_11386908 | Ga0105242_113869082 | 121 |
| 255 | 3300009176 | Ga0105242_12250612 | Ga0105242_122506121 | 121 |
| 256 | 3300009177 | Ga0105248_10037444 | Ga0105248_100374442 | 121 |
| 257 | 3300009177 | Ga0105248_10117451 | Ga0105248_101174512 | 121 |
| 258 | 3300009177 | Ga0105248_11534200 | Ga0105248_115342002 | 121 |
| 259 | 3300009545 | Ga0105237_10067577 | Ga0105237_100675774 | 121 |
| 260 | 3300009545 | Ga0105237_10173036 | Ga0105237_101730363 | 121 |
| 261 | 3300009545 | Ga0105237_10243423 | Ga0105237_102434232 | 121 |
| 262 | 3300009545 | Ga0105237_10655266 | Ga0105237_106552662 | 121 |
| 263 | 3300009551 | Ga0105238_10406100 | Ga0105238_104061001 | 121 |
| 264 | 3300009551 | Ga0105238_10594474 | Ga0105238_105944742 | 121 |
| 265 | 3300009551 | Ga0105238_11623997 | Ga0105238_116239972 | 121 |
| 266 | 3300009551 | Ga0105238_12530499 | Ga0105238_125304992 | 121 |
| 267 | 3300009553 | Ga0105249_10009654 | Ga0105249_100096548 | 121 |
| 268 | 3300009553 | Ga0105249_10808087 | Ga0105249_108080872 | 121 |
| 269 | 3300009978 | Ga0105148_109339 | Ga0105148_1093392 | 121 |
| 270 | 3300009993 | Ga0105028_100930 | Ga0105028_1009305 | 121 |
| 271 | 3300010375 | Ga0105239_10133642 | Ga0105239_101336421 | 121 |
| 272 | 3300010375 | Ga0105239_10333868 | Ga0105239_103338682 | 121 |
| 273 | 3300010375 | Ga0105239_10934987 | Ga0105239_109349872 | 121 |
| 274 | 3300010375 | Ga0105239_11097277 | Ga0105239_110972772 | 121 |
| 275 | 3300011119 | Ga0105246_10026077 | Ga0105246_100260777 | 121 |
| 276 | 3300011119 | Ga0105246_10117058 | Ga0105246_101170582 | 121 |
| 277 | 3300011119 | Ga0105246_10603178 | Ga0105246_106031781 | 121 |
| 278 | 3300013100 | Ga0157373_10348522 | Ga0157373_103485223 | 121 |
| 279 | 3300013100 | Ga0157373_10640363 | Ga0157373_106403632 | 121 |
| 280 | 3300013100 | Ga0157373_10725236 | Ga0157373_107252361 | 121 |
| 281 | 3300013104 | Ga0157370_10044464 | Ga0157370_100444645 | 121 |
| 282 | 3300013104 | Ga0157370_10376156 | Ga0157370_103761561 | 121 |
| 283 | 3300013105 | Ga0157369_10202414 | Ga0157369_102024142 | 121 |
| 284 | 3300013105 | Ga0157369_10216271 | Ga0157369_102162713 | 121 |
| 285 | 3300013296 | Ga0157374_10154379 | Ga0157374_101543794 | 121 |
| 286 | 3300013296 | Ga0157374_10599568 | Ga0157374_105995682 | 121 |
| 287 | 3300013296 | Ga0157374_10721804 | Ga0157374_107218041 | 121 |
| 288 | 3300013297 | Ga0157378_10027149 | Ga0157378_100271494 | 121 |
| 289 | 3300013297 | Ga0157378_10191007 | Ga0157378_101910074 | 121 |
| 290 | 3300013297 | Ga0157378_10399326 | Ga0157378_103993263 | 121 |
| 291 | 3300013297 | Ga0157378_10482734 | Ga0157378_104827343 | 121 |
| 292 | 3300013297 | Ga0157378_10532737 | Ga0157378_105327372 | 121 |
| 293 | 3300013297 | Ga0157378_10772059 | Ga0157378_107720592 | 121 |
| 294 | 3300013297 | Ga0157378_11446277 | Ga0157378_114462771 | 121 |
| 295 | 3300013306 | Ga0163162_10037679 | Ga0163162_100376797 | 121 |
| 296 | 3300013306 | Ga0163162_10502992 | Ga0163162_105029922 | 121 |
| 297 | 3300013306 | Ga0163162_11116554 | Ga0163162_111165542 | 121 |
| 298 | 3300013306 | Ga0163162_11338825 | Ga0163162_113388252 | 121 |
| 299 | 3300013306 | Ga0163162_12372709 | Ga0163162_123727091 | 121 |
| 300 | 3300013307 | Ga0157372_10126860 | Ga0157372_101268602 | 121 |
| 301 | 3300013307 | Ga0157372_12087128 | Ga0157372_120871282 | 121 |
| 302 | 3300013308 | Ga0157375_10720366 | Ga0157375_107203663 | 121 |
| 303 | 3300013308 | Ga0157375_11155580 | Ga0157375_111555801 | 121 |
| 304 | 3300013308 | Ga0157375_11941443 | Ga0157375_119414432 | 121 |
| 305 | 3300013308 | Ga0157375_11972143 | Ga0157375_119721432 | 121 |
| 306 | 3300014325 | Ga0163163_10000491 | Ga0163163_1000049111 | 121 |
| 307 | 3300014325 | Ga0163163_10548764 | Ga0163163_105487641 | 121 |
| 308 | 3300014325 | Ga0163163_12894005 | Ga0163163_128940051 | 121 |
| 309 | 3300014326 | Ga0157380_11421511 | Ga0157380_114215112 | 121 |
| 310 | 3300014745 | Ga0157377_10540259 | Ga0157377_105402592 | 121 |
| 311 | 3300014968 | Ga0157379_10037573 | Ga0157379_100375736 | 121 |
| 312 | 3300014968 | Ga0157379_10062631 | Ga0157379_100626318 | 121 |
| 313 | 3300014968 | Ga0157379_10078369 | Ga0157379_100783693 | 121 |
| 314 | 3300014969 | Ga0157376_10014841 | Ga0157376_100148417 | 121 |
| 315 | 3300014969 | Ga0157376_10371772 | Ga0157376_103717723 | 121 |
| 316 | 3300014969 | Ga0157376_10519062 | Ga0157376_105190622 | 121 |
| 317 | 3300017792 | Ga0163161_10645300 | Ga0163161_106453002 | 121 |
| 318 | 3300021377 | Ga0213874_10010862 | Ga0213874_100108623 | 121 |
| 319 | 3300021377 | Ga0213874_10018562 | Ga0213874_100185623 | 121 |
| 320 | 3300021441 | Ga0213871_10216264 | Ga0213871_102162641 | 121 |
| 321 | 3300025230 | Ga0209563_118080 | Ga0209563_1180802 | 121 |
| 322 | 3300025231 | Ga0207427_104324 | Ga0207427_1043246 | 121 |
| 323 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015778 | 121 |
| 324 | 3300025272 | Ga0209455_1013367 | Ga0209455_10133673 | 121 |
| 325 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013342 | 121 |
| 326 | 3300025899 | Ga0207642_10217920 | Ga0207642_102179202 | 121 |
| 327 | 3300025899 | Ga0207642_10292620 | Ga0207642_102926202 | 121 |
| 328 | 3300025899 | Ga0207642_10304755 | Ga0207642_103047552 | 121 |
| 329 | 3300025900 | Ga0207710_10201397 | Ga0207710_102013971 | 121 |
| 330 | 3300025907 | Ga0207645_10003004 | Ga0207645_100030043 | 121 |
| 331 | 3300025907 | Ga0207645_10119125 | Ga0207645_101191252 | 121 |
| 332 | 3300025908 | Ga0207643_10090745 | Ga0207643_100907451 | 121 |
| 333 | 3300025908 | Ga0207643_10331058 | Ga0207643_103310582 | 121 |
| 334 | 3300025908 | Ga0207643_10607876 | Ga0207643_106078761 | 121 |
| 335 | 3300025909 | Ga0207705_10020579 | Ga0207705_100205792 | 121 |
| 336 | 3300025909 | Ga0207705_10098319 | Ga0207705_100983194 | 121 |
| 337 | 3300025909 | Ga0207705_10413766 | Ga0207705_104137662 | 121 |
| 338 | 3300025909 | Ga0207705_10573863 | Ga0207705_105738632 | 121 |
| 339 | 3300025909 | Ga0207705_10686248 | Ga0207705_106862481 | 121 |
| 340 | 3300025910 | Ga0207684_10796322 | Ga0207684_107963221 | 121 |
| 341 | 3300025911 | Ga0207654_10048312 | Ga0207654_100483124 | 121 |
| 342 | 3300025911 | Ga0207654_10592483 | Ga0207654_105924832 | 121 |
| 343 | 3300025911 | Ga0207654_10595488 | Ga0207654_105954881 | 121 |
| 344 | 3300025911 | Ga0207654_10719908 | Ga0207654_107199082 | 121 |
| 345 | 3300025912 | Ga0207707_10248987 | Ga0207707_102489872 | 121 |
| 346 | 3300025912 | Ga0207707_10519529 | Ga0207707_105195291 | 121 |
| 347 | 3300025912 | Ga0207707_10548205 | Ga0207707_105482052 | 121 |
| 348 | 3300025913 | Ga0207695_10538508 | Ga0207695_105385082 | 121 |
| 349 | 3300025913 | Ga0207695_10841025 | Ga0207695_108410252 | 121 |
| 350 | 3300025913 | Ga0207695_10874433 | Ga0207695_108744331 | 121 |
| 351 | 3300025914 | Ga0207671_10214680 | Ga0207671_102146802 | 121 |
| 352 | 3300025915 | Ga0207693_10425375 | Ga0207693_104253752 | 121 |
| 353 | 3300025915 | Ga0207693_11164100 | Ga0207693_111641001 | 121 |
| 354 | 3300025916 | Ga0207663_11471634 | Ga0207663_114716341 | 121 |
| 355 | 3300025917 | Ga0207660_10413469 | Ga0207660_104134692 | 121 |
| 356 | 3300025917 | Ga0207660_10808507 | Ga0207660_108085071 | 121 |
| 357 | 3300025918 | Ga0207662_10616523 | Ga0207662_106165231 | 121 |
| 358 | 3300025919 | Ga0207657_10042479 | Ga0207657_100424794 | 121 |
| 359 | 3300025919 | Ga0207657_10124492 | Ga0207657_101244923 | 121 |
| 360 | 3300025919 | Ga0207657_10272755 | Ga0207657_102727553 | 121 |
| 361 | 3300025919 | Ga0207657_10486208 | Ga0207657_104862081 | 121 |
| 362 | 3300025920 | Ga0207649_11073600 | Ga0207649_110736002 | 121 |
| 363 | 3300025921 | Ga0207652_10201022 | Ga0207652_102010221 | 121 |
| 364 | 3300025921 | Ga0207652_10253755 | Ga0207652_102537552 | 121 |
| 365 | 3300025923 | Ga0207681_11109693 | Ga0207681_111096931 | 121 |
| 366 | 3300025924 | Ga0207694_10163831 | Ga0207694_101638312 | 121 |
| 367 | 3300025924 | Ga0207694_10174938 | Ga0207694_101749382 | 121 |
| 368 | 3300025924 | Ga0207694_10175068 | Ga0207694_101750683 | 121 |
| 369 | 3300025924 | Ga0207694_10178854 | Ga0207694_101788543 | 121 |
| 370 | 3300025924 | Ga0207694_10419033 | Ga0207694_104190331 | 121 |
| 371 | 3300025925 | Ga0207650_10308105 | Ga0207650_103081052 | 121 |
| 372 | 3300025925 | Ga0207650_10476343 | Ga0207650_104763432 | 121 |
| 373 | 3300025925 | Ga0207650_10560029 | Ga0207650_105600292 | 121 |
| 374 | 3300025926 | Ga0207659_11119211 | Ga0207659_111192111 | 121 |
| 375 | 3300025927 | Ga0207687_10672471 | Ga0207687_106724712 | 121 |
| 376 | 3300025927 | Ga0207687_10815368 | Ga0207687_108153681 | 121 |
| 377 | 3300025931 | Ga0207644_10210438 | Ga0207644_102104381 | 121 |
| 378 | 3300025931 | Ga0207644_10276952 | Ga0207644_102769522 | 121 |
| 379 | 3300025931 | Ga0207644_11107522 | Ga0207644_111075222 | 121 |
| 380 | 3300025931 | Ga0207644_11220708 | Ga0207644_112207081 | 121 |
| 381 | 3300025932 | Ga0207690_10340979 | Ga0207690_103409793 | 121 |
| 382 | 3300025932 | Ga0207690_10380054 | Ga0207690_103800542 | 121 |
| 383 | 3300025932 | Ga0207690_10725611 | Ga0207690_107256111 | 121 |
| 384 | 3300025934 | Ga0207686_10022782 | Ga0207686_100227825 | 121 |
| 385 | 3300025934 | Ga0207686_10147789 | Ga0207686_101477893 | 121 |
| 386 | 3300025934 | Ga0207686_10466369 | Ga0207686_104663692 | 121 |
| 387 | 3300025935 | Ga0207709_10035973 | Ga0207709_100359734 | 121 |
| 388 | 3300025935 | Ga0207709_10136610 | Ga0207709_101366102 | 121 |
| 389 | 3300025936 | Ga0207670_10288462 | Ga0207670_102884622 | 121 |
| 390 | 3300025937 | Ga0207669_10412133 | Ga0207669_104121332 | 121 |
| 391 | 3300025937 | Ga0207669_10747290 | Ga0207669_107472902 | 121 |
| 392 | 3300025938 | Ga0207704_10019753 | Ga0207704_100197536 | 121 |
| 393 | 3300025938 | Ga0207704_10064811 | Ga0207704_100648111 | 121 |
| 394 | 3300025938 | Ga0207704_10158813 | Ga0207704_101588133 | 121 |
| 395 | 3300025938 | Ga0207704_10822407 | Ga0207704_108224071 | 121 |
| 396 | 3300025940 | Ga0207691_10126233 | Ga0207691_101262331 | 121 |
| 397 | 3300025941 | Ga0207711_10019519 | Ga0207711_100195192 | 121 |
| 398 | 3300025942 | Ga0207689_10024757 | Ga0207689_100247575 | 121 |
| 399 | 3300025942 | Ga0207689_10077600 | Ga0207689_100776004 | 121 |
| 400 | 3300025942 | Ga0207689_10195184 | Ga0207689_101951842 | 121 |
| 401 | 3300025942 | Ga0207689_10294490 | Ga0207689_102944902 | 121 |
| 402 | 3300025942 | Ga0207689_10801200 | Ga0207689_108012002 | 121 |
| 403 | 3300025944 | Ga0207661_10481164 | Ga0207661_104811643 | 121 |
| 404 | 3300025945 | Ga0207679_10914844 | Ga0207679_109148441 | 121 |
| 405 | 3300025949 | Ga0207667_10246640 | Ga0207667_102466403 | 121 |
| 406 | 3300025949 | Ga0207667_10441256 | Ga0207667_104412562 | 121 |
| 407 | 3300025949 | Ga0207667_10626635 | Ga0207667_106266351 | 121 |
| 408 | 3300025949 | Ga0207667_10816911 | Ga0207667_108169112 | 121 |
| 409 | 3300025949 | Ga0207667_11270137 | Ga0207667_112701371 | 121 |
| 410 | 3300025960 | Ga0207651_10540750 | Ga0207651_105407502 | 121 |
| 411 | 3300025960 | Ga0207651_11947679 | Ga0207651_119476792 | 121 |
| 412 | 3300025961 | Ga0207712_10048552 | Ga0207712_100485521 | 121 |
| 413 | 3300025961 | Ga0207712_10348833 | Ga0207712_103488333 | 121 |
| 414 | 3300025972 | Ga0207668_10702134 | Ga0207668_107021341 | 121 |
| 415 | 3300025981 | Ga0207640_10261887 | Ga0207640_102618872 | 121 |
| 416 | 3300025981 | Ga0207640_10732565 | Ga0207640_107325651 | 121 |
| 417 | 3300025981 | Ga0207640_10995687 | Ga0207640_109956871 | 121 |
| 418 | 3300025986 | Ga0207658_10340416 | Ga0207658_103404162 | 121 |
| 419 | 3300026023 | Ga0207677_10886672 | Ga0207677_108866721 | 121 |
| 420 | 3300026023 | Ga0207677_11964559 | Ga0207677_119645591 | 121 |
| 421 | 3300026035 | Ga0207703_10090432 | Ga0207703_100904322 | 121 |
| 422 | 3300026041 | Ga0207639_10383353 | Ga0207639_103833532 | 121 |
| 423 | 3300026041 | Ga0207639_10667485 | Ga0207639_106674852 | 121 |
| 424 | 3300026067 | Ga0207678_10636500 | Ga0207678_106365002 | 121 |
| 425 | 3300026067 | Ga0207678_10677124 | Ga0207678_106771242 | 121 |
| 426 | 3300026078 | Ga0207702_10267177 | Ga0207702_102671772 | 121 |
| 427 | 3300026078 | Ga0207702_10400325 | Ga0207702_104003252 | 121 |
| 428 | 3300026078 | Ga0207702_10850731 | Ga0207702_108507312 | 121 |
| 429 | 3300026078 | Ga0207702_11158794 | Ga0207702_111587941 | 121 |
| 430 | 3300026088 | Ga0207641_10031995 | Ga0207641_100319953 | 121 |
| 431 | 3300026088 | Ga0207641_11090129 | Ga0207641_110901292 | 121 |
| 432 | 3300026089 | Ga0207648_10034161 | Ga0207648_100341613 | 121 |
| 433 | 3300026089 | Ga0207648_10034253 | Ga0207648_100342534 | 121 |
| 434 | 3300026089 | Ga0207648_10906949 | Ga0207648_109069491 | 121 |
| 435 | 3300026089 | Ga0207648_11053719 | Ga0207648_110537191 | 121 |
| 436 | 3300026095 | Ga0207676_11682612 | Ga0207676_116826121 | 121 |
| 437 | 3300026095 | Ga0207676_11885917 | Ga0207676_118859172 | 121 |
| 438 | 3300026116 | Ga0207674_10117367 | Ga0207674_101173674 | 121 |
| 439 | 3300026116 | Ga0207674_10462892 | Ga0207674_104628922 | 121 |
| 440 | 3300026116 | Ga0207674_10846167 | Ga0207674_108461672 | 121 |
| 441 | 3300026116 | Ga0207674_11144211 | Ga0207674_111442111 | 121 |
| 442 | 3300026118 | Ga0207675_101179940 | Ga0207675_1011799401 | 121 |
| 443 | 3300026118 | Ga0207675_102065079 | Ga0207675_1020650791 | 121 |
| 444 | 3300026121 | Ga0207683_10026414 | Ga0207683_100264145 | 121 |
| 445 | 3300026121 | Ga0207683_10030002 | Ga0207683_100300023 | 121 |
| 446 | 3300026121 | Ga0207683_10162911 | Ga0207683_101629113 | 121 |
| 447 | 3300026121 | Ga0207683_10576933 | Ga0207683_105769332 | 121 |
| 448 | 3300026121 | Ga0207683_10779530 | Ga0207683_107795301 | 121 |
| 449 | 3300026121 | Ga0207683_11039319 | Ga0207683_110393191 | 121 |
| 450 | 3300026142 | Ga0207698_10229526 | Ga0207698_102295262 | 121 |
| 451 | 3300026142 | Ga0207698_11922732 | Ga0207698_119227322 | 121 |
| 452 | 3300028379 | Ga0268266_10685065 | Ga0268266_106850651 | 121 |
| 453 | 3300028380 | Ga0268265_10638737 | Ga0268265_106387372 | 121 |
| 454 | 3300028380 | Ga0268265_11072674 | Ga0268265_110726741 | 121 |
| 455 | 3300028381 | Ga0268264_10876763 | Ga0268264_108767632 | 121 |
| 456 | 3300028577 | Ga0265318_10001257 | Ga0265318_1000125715 | 121 |
| 457 | 3300028800 | Ga0265338_10486327 | Ga0265338_104863272 | 121 |
| 458 | 3300028800 | Ga0265338_10715930 | Ga0265338_107159301 | 121 |
| 459 | 3300029957 | Ga0265324_10001784 | Ga0265324_100017841 | 121 |
| 460 | 3300029957 | Ga0265324_10254405 | Ga0265324_102544051 | 121 |
| 461 | 3300031235 | Ga0265330_10053979 | Ga0265330_100539793 | 121 |
| 462 | 3300031235 | Ga0265330_10165280 | Ga0265330_101652801 | 121 |
| 463 | 3300031235 | Ga0265330_10362549 | Ga0265330_103625491 | 121 |
| 464 | 3300031238 | Ga0265332_10007275 | Ga0265332_100072756 | 121 |
| 465 | 3300031238 | Ga0265332_10176988 | Ga0265332_101769882 | 121 |
| 466 | 3300031239 | Ga0265328_10103375 | Ga0265328_101033751 | 121 |
| 467 | 3300031239 | Ga0265328_10195220 | Ga0265328_101952202 | 121 |
| 468 | 3300031241 | Ga0265325_10002319 | Ga0265325_100023193 | 121 |
| 469 | 3300031241 | Ga0265325_10039093 | Ga0265325_100390934 | 121 |
| 470 | 3300031241 | Ga0265325_10107400 | Ga0265325_101074003 | 121 |
| 471 | 3300031242 | Ga0265329_10073585 | Ga0265329_100735853 | 121 |
| 472 | 3300031247 | Ga0265340_10179016 | Ga0265340_101790162 | 121 |
| 473 | 3300031249 | Ga0265339_10005265 | Ga0265339_1000526512 | 121 |
| 474 | 3300031249 | Ga0265339_10049879 | Ga0265339_100498793 | 121 |
| 475 | 3300031249 | Ga0265339_10085331 | Ga0265339_100853312 | 121 |
| 476 | 3300031250 | Ga0265331_10000066 | Ga0265331_1000006672 | 121 |
| 477 | 3300031250 | Ga0265331_10135656 | Ga0265331_101356562 | 121 |
| 478 | 3300031250 | Ga0265331_10210177 | Ga0265331_102101771 | 121 |
| 479 | 3300031344 | Ga0265316_10056849 | Ga0265316_100568493 | 121 |
| 480 | 3300031344 | Ga0265316_10399001 | Ga0265316_103990012 | 121 |
| 481 | 3300031344 | Ga0265316_10414262 | Ga0265316_104142622 | 121 |
| 482 | 3300031344 | Ga0265316_10844982 | Ga0265316_108449821 | 121 |
| 483 | 3300031456 | Ga0307513_11012325 | Ga0307513_110123251 | 121 |
| 484 | 3300031507 | Ga0307509_10664965 | Ga0307509_106649651 | 121 |
| 485 | 3300031595 | Ga0265313_10003662 | Ga0265313_1000366213 | 121 |
| 486 | 3300031595 | Ga0265313_10008701 | Ga0265313_100087018 | 121 |
| 487 | 3300031595 | Ga0265313_10017912 | Ga0265313_100179125 | 121 |
| 488 | 3300031711 | Ga0265314_10000125 | Ga0265314_1000012513 | 121 |
| 489 | 3300031711 | Ga0265314_10015417 | Ga0265314_100154178 | 121 |
| 490 | 3300031711 | Ga0265314_10063862 | Ga0265314_100638624 | 121 |
| 491 | 3300031711 | Ga0265314_10101807 | Ga0265314_101018072 | 121 |
| 492 | 3300031711 | Ga0265314_10468408 | Ga0265314_104684082 | 121 |
| 493 | 3300031712 | Ga0265342_10142787 | Ga0265342_101427873 | 121 |
| 494 | 3300031712 | Ga0265342_10257693 | Ga0265342_102576932 | 121 |
| 495 | 3300031712 | Ga0265342_10309157 | Ga0265342_103091571 | 121 |
| 496 | 3300031730 | Ga0307516_10063104 | Ga0307516_100631042 | 121 |
| 497 | 3300031731 | Ga0307405_11200022 | Ga0307405_112000222 | 121 |
| 498 | 3300031901 | Ga0307406_10562495 | Ga0307406_105624951 | 121 |
| 499 | 3300031995 | Ga0307409_102474495 | Ga0307409_1024744951 | 121 |
| 500 | 3300032002 | Ga0307416_100751936 | Ga0307416_1007519363 | 121 |
| 501 | 3300032005 | Ga0307411_10248580 | Ga0307411_102485802 | 121 |
| 502 | 3300032168 | Ga0316593_10032416 | Ga0316593_100324161 | 121 |
| 503 | 3300033180 | Ga0307510_10247674 | Ga0307510_102476742 | 121 |
| 504 | 3300033180 | Ga0307510_10268418 | Ga0307510_102684181 | 121 |
| 505 | 3300035114 | Ga0373939_0176091 | Ga0373939_0176091_33_398 | 121 |
| 506 | 3300035117 | Ga0373953_0349090 | Ga0373953_0349090_98_463 | 121 |
| 507 | 3300035172 | Ga0373955_0275466 | Ga0373955_0275466_76_441 | 121 |
| 508 | 3300035691 | Ga0373931_0581748 | Ga0373931_0581748_24_395 | 121 |
| 509 | 3300035724 | Ga0373933_0851632 | Ga0373933_0851632_31_396 | 121 |
| 510 | 3300036401 | Ga0373937_0067460 | Ga0373937_0067460_311_676 | 121 |
| 511 | 3300036401 | Ga0373937_0145830 | Ga0373937_0145830_1435_1800 | 121 |
| 512 | 3300036647 | Ga0316582_0040931 | Ga0316582_0040931_2465_2830 | 121 |
| 513 | 3300036712 | Ga0316584_0123400 | Ga0316584_0123400_370_735 | 121 |
| 514 | 3300037312 | Ga0395899_0380977 | Ga0395899_0380977_163_528 | 121 |
| 515 | 3300037418 | Ga0395900_0040247 | Ga0395900_0040247_4051_4416 | 121 |
| 516 | 3300037471 | Ga0395905_1520550 | Ga0395905_1520550_198_563 | 121 |
| 517 | 3300037471 | Ga0395905_1887499 | Ga0395905_1887499_88_453 | 121 |
| 518 | 3300038443 | Ga0395901_1043192 | Ga0395901_1043192_264_629 | 121 |
| 519 | 3300039438 | Ga0436360_0181532 | Ga0436360_0181532_353_718 | 121 |
| 520 | 3300039438 | Ga0436360_0464388 | Ga0436360_0464388_233_610 | 121 |
| 521 | 3300039438 | Ga0436360_1308938 | Ga0436360_1308938_129_494 | 121 |
| 522 | 3300039447 | Ga0436361_1147293 | Ga0436361_1147293_63_428 | 121 |
| 523 | 3300039450 | Ga0436363_0072239 | Ga0436363_0072239_410_775 | 121 |
| 524 | 3300039450 | Ga0436363_0370956 | Ga0436363_0370956_3397_3762 | 121 |
| 525 | 3300039450 | Ga0436363_1576522 | Ga0436363_1576522_178_543 | 121 |
| 526 | 3300039453 | Ga0436362_0226131 | Ga0436362_0226131_37_402 | 121 |
| 527 | 3300039453 | Ga0436362_0755406 | Ga0436362_0755406_118_483 | 121 |
| 528 | 3300041413 | Ga0439465_0260153 | Ga0439465_0260153_184_549 | 121 |
| 529 | 3300041443 | Ga0451789_0426280 | Ga0451789_0426280_36_401 | 121 |
| 530 | 3300041452 | Ga0451793_1912129 | Ga0451793_1912129_485_859 | 121 |
| 531 | 3300041512 | Ga0451853_2188647 | Ga0451853_2188647_187_567 | 121 |
| 532 | 3300044694 | Ga0466963_0339405 | Ga0466963_0339405_446_823 | 121 |
| 533 | 3300044706 | Ga0466964_0356825 | Ga0466964_0356825_191_568 | 121 |
| 534 | 3300044712 | Ga0453684_0010839 | Ga0453684_0010839_12507_12875 | 121 |
| 535 | 3300044712 | Ga0453684_1862699 | Ga0453684_1862699_43_414 | 121 |
| 536 | 3300045976 | Ga0466967_0552571 | Ga0466967_0552571_399_776 | 121 |
| 537 | 3300046491 | Ga0495584_0429651 | Ga0495584_0429651_51_416 | 121 |
| 538 | 3300046506 | Ga0495583_0381251 | Ga0495583_0381251_151_525 | 121 |
| 539 | 3300046507 | Ga0495606_0376267 | Ga0495606_0376267_369_734 | 121 |
| 540 | 3300046524 | Ga0495648_0404954 | Ga0495648_0404954_199_573 | 121 |
| 541 | 3300046529 | Ga0495652_0650608 | Ga0495652_0650608_12_377 | 121 |
| 542 | 3300046529 | Ga0495652_0758145 | Ga0495652_0758145_249_614 | 121 |
| 543 | 3300046536 | Ga0495587_0141879 | Ga0495587_0141879_302_667 | 121 |
| 544 | 3300046536 | Ga0495587_0826541 | Ga0495587_0826541_62_436 | 121 |
| 545 | 3300046537 | Ga0495598_0260408 | Ga0495598_0260408_260_634 | 121 |
| 546 | 3300046538 | Ga0495609_0061548 | Ga0495609_0061548_78_458 | 121 |
| 547 | 3300046539 | Ga0495621_0183290 | Ga0495621_0183290_430_795 | 121 |
| 548 | 3300046543 | Ga0495645_0529773 | Ga0495645_0529773_143_508 | 121 |
| 549 | 3300046557 | Ga0495622_0002413 | Ga0495622_0002413_5024_5398 | 121 |
| 550 | 3300046660 | Ga0495625_0117728 | Ga0495625_0117728_1132_1497 | 121 |
| 551 | 3300046675 | Ga0495657_0643311 | Ga0495657_0643311_68_433 | 121 |
| 552 | 3300046678 | Ga0495599_0422479 | Ga0495599_0422479_169_576 | 121 |
| 553 | 3300046679 | Ga0495623_0298600 | Ga0495623_0298600_365_772 | 121 |
| 554 | 3300046683 | Ga0495658_0384503 | Ga0495658_0384503_338_712 | 121 |
| 555 | 3300046684 | Ga0495669_0305792 | Ga0495669_0305792_19_384 | 121 |
| 556 | 3300046684 | Ga0495669_0436480 | Ga0495669_0436480_20_385 | 121 |
| 557 | 3300046690 | Ga0495624_0572118 | Ga0495624_0572118_199_573 | 121 |
| 558 | 3300046692 | Ga0495671_0410750 | Ga0495671_0410750_258_629 | 121 |
| 559 | 3300046694 | Ga0495649_0205481 | Ga0495649_0205481_261_635 | 121 |
| 560 | 3300046794 | Ga0495589_0471785 | Ga0495589_0471785_147_512 | 121 |
| 561 | 3300046809 | Ga0495600_0393921 | Ga0495600_0393921_476_841 | 121 |
| 562 | 3300047319 | Ga0495674_0072391 | Ga0495674_0072391_1518_1925 | 121 |
| 563 | 3300047444 | Ga0495675_0427202 | Ga0495675_0427202_198_563 | 121 |
| 564 | 3300047470 | Ga0495681_0328824 | Ga0495681_0328824_183_548 | 121 |
| 565 | 3300047472 | Ga0495686_0199304 | Ga0495686_0199304_100_531 | 121 |
| 566 | 3300048903 | Ga0496100_0393869 | Ga0496100_0393869_666_1031 | 121 |
| 567 | 3300048904 | Ga0496101_0528839 | Ga0496101_0528839_312_677 | 121 |
| 568 | 3300048904 | Ga0496101_0620582 | Ga0496101_0620582_233_598 | 121 |
| 569 | 3300048907 | Ga0496104_0159085 | Ga0496104_0159085_1633_1998 | 121 |
| 570 | 3300048907 | Ga0496104_0258418 | Ga0496104_0258418_673_1038 | 121 |
| 571 | 3300048909 | Ga0496106_0251736 | Ga0496106_0251736_896_1261 | 121 |
| 572 | 3300048909 | Ga0496106_1066746 | Ga0496106_1066746_232_597 | 121 |
| 573 | 3300048910 | Ga0496107_0841040 | Ga0496107_0841040_241_615 | 121 |
| 574 | 3300048911 | Ga0496108_1113509 | Ga0496108_1113509_12_377 | 121 |
| 575 | 3300048912 | Ga0496109_0107185 | Ga0496109_0107185_1609_1974 | 121 |
| 576 | 3300048912 | Ga0496109_0257522 | Ga0496109_0257522_107_472 | 121 |
| 577 | 3300048913 | Ga0496110_0083171 | Ga0496110_0083171_634_999 | 121 |
| 578 | 3300048914 | Ga0496111_0166415 | Ga0496111_0166415_630_995 | 121 |
| 579 | 3300048916 | Ga0496113_0803199 | Ga0496113_0803199_17_382 | 121 |
| 580 | 3300048918 | Ga0496115_0360664 | Ga0496115_0360664_363_728 | 121 |
| 581 | 3300048918 | Ga0496115_0397658 | Ga0496115_0397658_148_513 | 121 |
| 582 | 3300048920 | Ga0496117_0570678 | Ga0496117_0570678_61_426 | 121 |
| 583 | 3300048929 | Ga0496126_0124615 | Ga0496126_0124615_1394_1759 | 121 |
| 584 | 3300048929 | Ga0496126_0632921 | Ga0496126_0632921_92_457 | 121 |
| 585 | 3300049568 | Ga0501031_0055737 | Ga0501031_0055737_275_640 | 121 |
| 586 | 3300049569 | Ga0501032_0028469 | Ga0501032_0028469_3252_3617 | 121 |
| 587 | 3300049569 | Ga0501032_0191710 | Ga0501032_0191710_382_747 | 121 |
| 588 | 3300049569 | Ga0501032_0673496 | Ga0501032_0673496_197_562 | 121 |
| 589 | 3300049570 | Ga0501033_0005971 | Ga0501033_0005971_1076_1441 | 121 |
| 590 | 3300049570 | Ga0501033_0098453 | Ga0501033_0098453_707_1072 | 121 |
| 591 | 3300049570 | Ga0501033_0099741 | Ga0501033_0099741_1624_1989 | 121 |
| 592 | 3300049570 | Ga0501033_0156275 | Ga0501033_0156275_439_804 | 121 |
| 593 | 3300049570 | Ga0501033_0194501 | Ga0501033_0194501_505_870 | 121 |
| 594 | 3300049570 | Ga0501033_0389886 | Ga0501033_0389886_511_885 | 121 |
| 595 | 3300049570 | Ga0501033_0419602 | Ga0501033_0419602_406_771 | 121 |
| 596 | 3300049570 | Ga0501033_0486685 | Ga0501033_0486685_462_827 | 121 |
| 597 | 3300049570 | Ga0501033_0660730 | Ga0501033_0660730_159_530 | 121 |
| 598 | 3300049570 | Ga0501033_1126035 | Ga0501033_1126035_12_377 | 121 |
| 599 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_1741310_1741681 | 121 |
| 600 | 3300049571 | Ga0501034_0007641 | Ga0501034_0007641_7989_8354 | 121 |
| 601 | 3300049571 | Ga0501034_0022877 | Ga0501034_0022877_3183_3548 | 121 |
| 602 | 3300049571 | Ga0501034_0025819 | Ga0501034_0025819_2822_3187 | 121 |
| 603 | 3300049571 | Ga0501034_0065576 | Ga0501034_0065576_1780_2145 | 121 |
| 604 | 3300049571 | Ga0501034_0137305 | Ga0501034_0137305_1212_1577 | 121 |
| 605 | 3300049571 | Ga0501034_0149015 | Ga0501034_0149015_1030_1395 | 121 |
| 606 | 3300049571 | Ga0501034_0197895 | Ga0501034_0197895_362_727 | 121 |
| 607 | 3300049571 | Ga0501034_0408115 | Ga0501034_0408115_210_575 | 121 |
| 608 | 3300049571 | Ga0501034_0560524 | Ga0501034_0560524_376_756 | 121 |
| 609 | 3300049571 | Ga0501034_1331686 | Ga0501034_1331686_23_388 | 121 |
| 610 | 3300049572 | Ga0501036_0000599 | Ga0501036_0000599_9217_9582 | 121 |
| 611 | 3300049572 | Ga0501036_0011755 | Ga0501036_0011755_4767_5132 | 121 |
| 612 | 3300049572 | Ga0501036_0096558 | Ga0501036_0096558_1877_2242 | 121 |
| 613 | 3300049572 | Ga0501036_0127636 | Ga0501036_0127636_1137_1502 | 121 |
| 614 | 3300049572 | Ga0501036_0474276 | Ga0501036_0474276_128_493 | 121 |
| 615 | 3300049572 | Ga0501036_0557681 | Ga0501036_0557681_463_828 | 121 |
| 616 | 3300049572 | Ga0501036_1020219 | Ga0501036_1020219_185_550 | 121 |
| 617 | 3300049572 | Ga0501036_1028072 | Ga0501036_1028072_242_607 | 121 |
| 618 | 3300049573 | Ga0501037_0009260 | Ga0501037_0009260_1008_1373 | 121 |
| 619 | 3300049573 | Ga0501037_0306682 | Ga0501037_0306682_532_897 | 121 |
| 620 | 3300049573 | Ga0501037_0558818 | Ga0501037_0558818_94_468 | 121 |
| 621 | 3300049574 | Ga0501038_0015209 | Ga0501038_0015209_1667_2032 | 121 |
| 622 | 3300049574 | Ga0501038_0159627 | Ga0501038_0159627_359_724 | 121 |
| 623 | 3300049574 | Ga0501038_0220162 | Ga0501038_0220162_793_1158 | 121 |
| 624 | 3300049574 | Ga0501038_1235484 | Ga0501038_1235484_156_521 | 121 |
| 625 | 3300049575 | Ga0501039_0000020 | Ga0501039_0000020_113839_114210 | 121 |
| 626 | 3300049575 | Ga0501039_0090768 | Ga0501039_0090768_251_616 | 121 |
| 627 | 3300049575 | Ga0501039_0217253 | Ga0501039_0217253_1093_1458 | 121 |
| 628 | 3300049575 | Ga0501039_0461240 | Ga0501039_0461240_104_469 | 121 |
| 629 | 3300049576 | Ga0501040_0517947 | Ga0501040_0517947_342_707 | 121 |
| 630 | 3300049577 | Ga0501041_0171467 | Ga0501041_0171467_766_1131 | 121 |
| 631 | 3300049578 | Ga0501042_0291156 | Ga0501042_0291156_614_979 | 121 |
| 632 | 3300049578 | Ga0501042_0891354 | Ga0501042_0891354_244_609 | 121 |
| 633 | 3300049579 | Ga0501043_0040103 | Ga0501043_0040103_990_1355 | 121 |
| 634 | 3300049579 | Ga0501043_0277810 | Ga0501043_0277810_396_761 | 121 |
| 635 | 3300049579 | Ga0501043_0337953 | Ga0501043_0337953_621_986 | 121 |
| 636 | 3300049579 | Ga0501043_0520561 | Ga0501043_0520561_498_863 | 121 |
| 637 | 3300049579 | Ga0501043_0825251 | Ga0501043_0825251_176_541 | 121 |
| 638 | 3300049579 | Ga0501043_1072902 | Ga0501043_1072902_11_385 | 121 |
| 639 | 3300049580 | Ga0501046_0002229 | Ga0501046_0002229_1571_1936 | 121 |
| 640 | 3300049580 | Ga0501046_0052222 | Ga0501046_0052222_603_968 | 121 |
| 641 | 3300049580 | Ga0501046_0183796 | Ga0501046_0183796_421_786 | 121 |
| 642 | 3300049580 | Ga0501046_0187613 | Ga0501046_0187613_1151_1516 | 121 |
| 643 | 3300049580 | Ga0501046_0193427 | Ga0501046_0193427_244_609 | 121 |
| 644 | 3300049581 | Ga0501047_0000257 | Ga0501047_0000257_47503_47868 | 121 |
| 645 | 3300049581 | Ga0501047_0022850 | Ga0501047_0022850_4458_4823 | 121 |
| 646 | 3300049581 | Ga0501047_0024473 | Ga0501047_0024473_3560_3925 | 121 |
| 647 | 3300049581 | Ga0501047_0106894 | Ga0501047_0106894_1900_2265 | 121 |
| 648 | 3300049581 | Ga0501047_0132561 | Ga0501047_0132561_393_767 | 121 |
| 649 | 3300049581 | Ga0501047_0255560 | Ga0501047_0255560_627_992 | 121 |
| 650 | 3300049581 | Ga0501047_0310146 | Ga0501047_0310146_853_1218 | 121 |
| 651 | 3300049581 | Ga0501047_0372572 | Ga0501047_0372572_700_1065 | 121 |
| 652 | 3300049581 | Ga0501047_0627217 | Ga0501047_0627217_66_431 | 121 |
| 653 | 3300049581 | Ga0501047_0828851 | Ga0501047_0828851_174_548 | 121 |
| 654 | 3300049582 | Ga0501048_0000588 | Ga0501048_0000588_21125_21490 | 121 |
| 655 | 3300049582 | Ga0501048_0003231 | Ga0501048_0003231_4650_5015 | 121 |
| 656 | 3300049582 | Ga0501048_0330690 | Ga0501048_0330690_668_1033 | 121 |
| 657 | 3300049584 | Ga0501068_0096297 | Ga0501068_0096297_288_653 | 121 |
| 658 | 3300049585 | Ga0501069_0026474 | Ga0501069_0026474_594_959 | 121 |
| 659 | 3300049585 | Ga0501069_0052122 | Ga0501069_0052122_372_737 | 121 |
| 660 | 3300049586 | Ga0501070_0017840 | Ga0501070_0017840_1670_2035 | 121 |
| 661 | 3300049586 | Ga0501070_0053047 | Ga0501070_0053047_2708_3073 | 121 |
| 662 | 3300049586 | Ga0501070_0156181 | Ga0501070_0156181_903_1268 | 121 |
| 663 | 3300049586 | Ga0501070_0620642 | Ga0501070_0620642_394_759 | 121 |
| 664 | 3300049586 | Ga0501070_0952393 | Ga0501070_0952393_57_422 | 121 |
| 665 | 3300049587 | Ga0501071_1432467 | Ga0501071_1432467_40_405 | 121 |
| 666 | 3300049588 | Ga0501072_0538791 | Ga0501072_0538791_331_696 | 121 |
| 667 | 3300049589 | Ga0501073_0007903 | Ga0501073_0007903_1667_2032 | 121 |
| 668 | 3300049589 | Ga0501073_0174001 | Ga0501073_0174001_129_494 | 121 |
| 669 | 3300049589 | Ga0501073_0190178 | Ga0501073_0190178_59_424 | 121 |
| 670 | 3300049589 | Ga0501073_0536781 | Ga0501073_0536781_360_725 | 121 |
| 671 | 3300049590 | Ga0501074_0006918 | Ga0501074_0006918_3173_3538 | 121 |
| 672 | 3300049590 | Ga0501074_0012043 | Ga0501074_0012043_3841_4206 | 121 |
| 673 | 3300049590 | Ga0501074_0581738 | Ga0501074_0581738_333_698 | 121 |
| 674 | 3300049592 | Ga0501076_1224553 | Ga0501076_1224553_35_400 | 121 |
| 675 | 3300049592 | Ga0501076_1714651 | Ga0501076_1714651_84_449 | 121 |
| 676 | 3300049741 | Ga0501079_0052216 | Ga0501079_0052216_1184_1549 | 121 |
| 677 | 3300049742 | Ga0501080_0000183 | Ga0501080_0000183_32881_33246 | 121 |
| 678 | 3300049742 | Ga0501080_0209359 | Ga0501080_0209359_913_1278 | 121 |
| 679 | 3300049742 | Ga0501080_0899322 | Ga0501080_0899322_364_729 | 121 |
| 680 | 3300049742 | Ga0501080_1605307 | Ga0501080_1605307_124_489 | 121 |
| 681 | 3300049742 | Ga0501080_1668884 | Ga0501080_1668884_30_395 | 121 |
| 682 | 3300049744 | Ga0501083_0007725 | Ga0501083_0007725_4920_5285 | 121 |
| 683 | 3300049744 | Ga0501083_0012732 | Ga0501083_0012732_3601_3966 | 121 |
| 684 | 3300049744 | Ga0501083_0076257 | Ga0501083_0076257_923_1300 | 121 |
| 685 | 3300049744 | Ga0501083_0100623 | Ga0501083_0100623_22_387 | 121 |
| 686 | 3300049744 | Ga0501083_0390055 | Ga0501083_0390055_80_445 | 121 |
| 687 | 3300049744 | Ga0501083_0529756 | Ga0501083_0529756_272_637 | 121 |
| 688 | 3300049822 | Ga0501035_0013093 | Ga0501035_0013093_356_730 | 121 |
| 689 | 3300049822 | Ga0501035_0037027 | Ga0501035_0037027_3700_4065 | 121 |
| 690 | 3300049822 | Ga0501035_0059854 | Ga0501035_0059854_187_552 | 121 |
| 691 | 3300049822 | Ga0501035_0118870 | Ga0501035_0118870_896_1261 | 121 |
| 692 | 3300049822 | Ga0501035_0137265 | Ga0501035_0137265_1355_1720 | 121 |
| 693 | 3300049822 | Ga0501035_0245579 | Ga0501035_0245579_176_541 | 121 |
| 694 | 3300049822 | Ga0501035_0287046 | Ga0501035_0287046_947_1321 | 121 |
| 695 | 3300049822 | Ga0501035_1225882 | Ga0501035_1225882_115_480 | 121 |
| 696 | 3300049823 | Ga0501044_0005286 | Ga0501044_0005286_13160_13525 | 121 |
| 697 | 3300049823 | Ga0501044_0037841 | Ga0501044_0037841_4568_4933 | 121 |
| 698 | 3300049823 | Ga0501044_0077196 | Ga0501044_0077196_1748_2113 | 121 |
| 699 | 3300049823 | Ga0501044_0122579 | Ga0501044_0122579_1009_1374 | 121 |
| 700 | 3300049823 | Ga0501044_0156054 | Ga0501044_0156054_503_877 | 121 |
| 701 | 3300049823 | Ga0501044_0186812 | Ga0501044_0186812_1274_1639 | 121 |
| 702 | 3300049823 | Ga0501044_0267456 | Ga0501044_0267456_1269_1634 | 121 |
| 703 | 3300049823 | Ga0501044_0443089 | Ga0501044_0443089_451_816 | 121 |
| 704 | 3300049823 | Ga0501044_0641829 | Ga0501044_0641829_147_512 | 121 |
| 705 | 3300049823 | Ga0501044_1409192 | Ga0501044_1409192_89_463 | 121 |
| 706 | 3300049824 | Ga0501045_0473472 | Ga0501045_0473472_174_539 | 121 |
| 707 | 3300050490 | nmdc:mga03n38_21522_c1 | nmdc:mga03n38_21522_c1_802_1167 | 121 |
| 708 | 3300050490 | nmdc:mga03n38_490481_c1 | nmdc:mga03n38_490481_c1_245_610 | 121 |
| 709 | 3300050494 | nmdc:mga06z11_74517_c1 | nmdc:mga06z11_74517_c1_363_773 | 121 |
| 710 | 3300050495 | nmdc:mga04h51_3910_c1 | nmdc:mga04h51_3910_c1_833_1243 | 121 |
| 711 | 3300050496 | nmdc:mga07m45_255690_c1 | nmdc:mga07m45_255690_c1_567_932 | 121 |
| 712 | 3300053080 | Ga0500635_0175456 | Ga0500635_0175456_309_683 | 121 |
| 713 | 3300053085 | Ga0495619_0034703 | Ga0495619_0034703_901_1266 | 121 |
| 714 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_539700_540065 | 121 |
| 715 | 3300053090 | Ga0500646_0054934 | Ga0500646_0054934_51_416 | 121 |
| 716 | 3300053090 | Ga0500646_0311446 | Ga0500646_0311446_45_410 | 121 |
| 717 | 3300053096 | Ga0500641_0298351 | Ga0500641_0298351_44_409 | 121 |
| 718 | 3300053104 | Ga0500556_0035718 | Ga0500556_0035718_1208_1579 | 121 |
| 719 | 3300053117 | Ga0500593_138306 | Ga0500593_138306_251_616 | 121 |
| 720 | 3300053119 | Ga0500595_000793 | Ga0500595_000793_13736_14101 | 121 |
| 721 | 3300053119 | Ga0500595_022389 | Ga0500595_022389_89_463 | 121 |
| 722 | 3300053119 | Ga0500595_084132 | Ga0500595_084132_178_585 | 121 |
| 723 | 3300053119 | Ga0500595_131264 | Ga0500595_131264_144_530 | 121 |
| 724 | 3300053122 | Ga0500608_305605 | Ga0500608_305605_210_575 | 121 |
| 725 | 3300053123 | Ga0500614_111246 | Ga0500614_111246_93_458 | 121 |
| 726 | 3300053133 | Ga0500655_129826 | Ga0500655_129826_62_427 | 121 |
| 727 | 3300053136 | Ga0500559_0162219 | Ga0500559_0162219_312_686 | 121 |
| 728 | 3300053136 | Ga0500559_0188504 | Ga0500559_0188504_207_584 | 121 |
| 729 | 3300053139 | Ga0500568_0023085 | Ga0500568_0023085_687_1052 | 121 |
| 730 | 3300053139 | Ga0500568_0070303 | Ga0500568_0070303_961_1326 | 121 |
| 731 | 3300053140 | Ga0500573_0000008 | Ga0500573_0000008_203129_203494 | 121 |
| 732 | 3300053151 | Ga0500604_0000195 | Ga0500604_0000195_1412_1777 | 121 |
| 733 | 3300053163 | Ga0500639_129880 | Ga0500639_129880_474_851 | 121 |
| 734 | 3300053730 | Ga0500645_063977 | Ga0500645_063977_335_700 | 121 |
| 735 | 3300054114 | Ga0501084_0012879 | Ga0501084_0012879_4337_4702 | 121 |
| 736 | 3300054114 | Ga0501084_0473492 | Ga0501084_0473492_660_1025 | 121 |
| 737 | 3300059493 | Ga0587077_112908 | Ga0587077_112908_164_529 | 121 |
| 738 | 3300059623 | Ga0587101_005090 | Ga0587101_005090_913_1278 | 121 |
| 739 | 3300059639 | Ga0587062_009839 | Ga0587062_009839_586_951 | 121 |
| 740 | 3300059645 | Ga0587076_045441 | Ga0587076_045441_317_682 | 121 |
| 741 | 3300060353 | Ga0501082_0040697 | Ga0501082_0040697_2321_2686 | 121 |
| 742 | 3300060353 | Ga0501082_0498399 | Ga0501082_0498399_256_633 | 121 |
| 743 | 3300061734 | Ga0530510_1580002 | Ga0530510_1580002_30_395 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar