F478703

General Info

Members Datasets Scaffolds Average Seq Length
743 352 723 122

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0199304|Ga0495686_0199304_100_531
Length 143
Sequence MCRLGRSAQGPVEKPGQATGLSMEELLLEYLPILIFIGLAAVLGSVLVAVPLLIAPSKPDPEKLSAYECGFPAFGDARMKFDVRFYLVAILFIIFDLEVAFLFPWAITLGDTGVFAFWSMMAFLGVLTVGFIYEWKKGALEWE

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2643221629 Devosia sp. Root105 Isolate Unclassified
5 2643221662 Devosia sp. Root413D1 Isolate Unclassified
6 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
7 2842694124 Methylopila sp. R-72369 Isolate Unclassified
8 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
9 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
10 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
11 2902330777 Methylobacterium sp. 2A Isolate Unclassified
12 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
13 2909042592 Labrys sp. LIt4 Isolate Nodule
14 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
15 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
16 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
17 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
18 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
102 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
310 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
331 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
334 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
335 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
339 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
351 641522639 Methylobacterium sp. 4-46 Isolate Nodule
352 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 1.88
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0.4
Rhizoplane 2.56
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031580 3300001979 Bacteria 1705
2 JGI25165J46597_1000003 3300003214 Bacteria 694080
3 JGI25153J46596_10000466 3300003215 Bacteria 25873
4 Ga0058862_12843542 3300004803 Unclassified 845
5 Ga0070658_10006762 3300005327 Bacteria 9281
6 Ga0070658_10027665 3300005327 Bacteria 4549
7 Ga0070658_10064135 3300005327 Bacteria 2996
8 Ga0070658_10153901 3300005327 Bacteria 1927
9 Ga0070658_10771702 3300005327 Bacteria 835
10 Ga0070658_11573163 3300005327 Bacteria 570
11 Ga0070676_10036937 3300005328 Bacteria 2815
12 Ga0070676_10426680 3300005328 Bacteria 928
13 Ga0070683_100089181 3300005329 Bacteria 2894
14 Ga0070670_100631867 3300005331 Bacteria 960
15 Ga0068869_100031662 3300005334 Bacteria 3721
16 Ga0068869_100051960 3300005334 Bacteria 2975
17 Ga0068869_100605648 3300005334 Bacteria 926
18 Ga0070666_10012585 3300005335 Bacteria 5342
19 Ga0070666_10122423 3300005335 Bacteria 1804
20 Ga0068868_100062032 3300005338 Bacteria 2962
21 Ga0068868_100169734 3300005338 Bacteria 1806
22 Ga0068868_100611535 3300005338 Bacteria 966
23 Ga0068868_101558809 3300005338 Bacteria 620
24 Ga0068868_101580075 3300005338 Bacteria 616
25 Ga0070660_100025903 3300005339 Bacteria 4362
26 Ga0070660_100265338 3300005339 Bacteria 1403
27 Ga0070689_100425155 3300005340 Bacteria 1127
28 Ga0070691_10239573 3300005341 Bacteria 969
29 Ga0070661_100356565 3300005344 Bacteria 1148
30 Ga0070661_100403928 3300005344 Bacteria 1080
31 Ga0070661_100724066 3300005344 Bacteria 812
32 Ga0070668_100555709 3300005347 Bacteria 1000
33 Ga0070668_101440033 3300005347 Bacteria 629
34 Ga0070669_100831247 3300005353 Bacteria 786
35 Ga0070675_100833052 3300005354 Bacteria 844
36 Ga0070675_101429804 3300005354 Bacteria 638
37 Ga0070675_102025577 3300005354 Bacteria 531
38 Ga0070671_100112922 3300005355 Bacteria 2283
39 Ga0070671_100119966 3300005355 Bacteria 2212
40 Ga0070671_100644702 3300005355 Bacteria 917
41 Ga0070671_100838247 3300005355 Bacteria 802
42 Ga0070671_101251801 3300005355 Bacteria 654
43 Ga0070674_100339651 3300005356 Bacteria 1209
44 Ga0070674_100384288 3300005356 Bacteria 1143
45 Ga0070674_100736085 3300005356 Bacteria 846
46 Ga0070673_100014920 3300005364 Bacteria 5437
47 Ga0070673_100152263 3300005364 Bacteria 1960
48 Ga0070673_100545769 3300005364 Bacteria 1052
49 Ga0070673_100727339 3300005364 Bacteria 913
50 Ga0070659_100019822 3300005366 Bacteria 5105
51 Ga0070667_100548381 3300005367 Bacteria 1062
52 Ga0070714_100557379 3300005435 Bacteria 1098
53 Ga0070714_101584568 3300005435 Bacteria 640
54 Ga0070713_100598101 3300005436 Bacteria 1048
55 Ga0070710_11545418 3300005437 Bacteria 500
56 Ga0070701_10930445 3300005438 Bacteria 602
57 Ga0070711_100458579 3300005439 Bacteria 1045
58 Ga0070700_101443544 3300005441 Bacteria 583
59 Ga0070694_101230478 3300005444 Bacteria 628
60 Ga0070708_100696733 3300005445 Bacteria 956
61 Ga0070678_100008807 3300005456 Bacteria 6067
62 Ga0070678_100027342 3300005456 Bacteria 3872
63 Ga0070678_100146986 3300005456 Bacteria 1893
64 Ga0070678_100396678 3300005456 Bacteria 1197
65 Ga0070678_100450097 3300005456 Bacteria 1128
66 Ga0070662_100613439 3300005457 Bacteria 916
67 Ga0070681_10113225 3300005458 Bacteria 2652
68 Ga0070681_10225086 3300005458 Bacteria 1790
69 Ga0070681_10258469 3300005458 Bacteria 1653
70 Ga0068867_100185526 3300005459 Bacteria 1656
71 Ga0068867_100411179 3300005459 Bacteria 1143
72 Ga0068867_100663055 3300005459 Bacteria 917
73 Ga0070685_10130177 3300005466 Bacteria 1573
74 Ga0070685_10473299 3300005466 Bacteria 882
75 Ga0070706_100570149 3300005467 Bacteria 1053
76 Ga0070679_100385320 3300005530 Bacteria 1348
77 Ga0070679_101107194 3300005530 Bacteria 737
78 Ga0070684_100063794 3300005535 Bacteria 3230
79 Ga0068853_100609167 3300005539 Bacteria 1037
80 Ga0068853_100774801 3300005539 Bacteria 917
81 Ga0068853_100803930 3300005539 Bacteria 901
82 Ga0070672_100739438 3300005543 Bacteria 863
83 Ga0070695_100067425 3300005545 Bacteria 2334
84 Ga0070696_100012732 3300005546 Bacteria 5649
85 Ga0070696_100066678 3300005546 Bacteria 2525
86 Ga0070693_100326366 3300005547 Bacteria 1043
87 Ga0070665_100000377 3300005548 Bacteria 66234
88 Ga0070665_100031419 3300005548 Bacteria 5345
89 Ga0070665_100561842 3300005548 Bacteria 1153
90 Ga0070665_100939019 3300005548 Bacteria 877
91 Ga0070704_100034903 3300005549 Bacteria 3415
92 Ga0068855_100139889 3300005563 Bacteria 2760
93 Ga0068855_100229654 3300005563 Bacteria 2079
94 Ga0068855_100870162 3300005563 Bacteria 954
95 Ga0068855_100930950 3300005563 Bacteria 916
96 Ga0070664_100255968 3300005564 Bacteria 1575
97 Ga0068857_100197011 3300005577 Bacteria 1835
98 Ga0068857_100320837 3300005577 Bacteria 1431
99 Ga0068857_100880813 3300005577 Bacteria 858
100 Ga0068854_100317130 3300005578 Bacteria 1266
101 Ga0068854_100631331 3300005578 Bacteria 918
102 Ga0068854_101308650 3300005578 Bacteria 653
103 Ga0068856_100285398 3300005614 Bacteria 1667
104 Ga0068856_100358190 3300005614 Bacteria 1477
105 Ga0070702_100399023 3300005615 Bacteria 983
106 Ga0070702_100402483 3300005615 Bacteria 980
107 Ga0070702_100871093 3300005615 Bacteria 703
108 Ga0068852_100198042 3300005616 Bacteria 1900
109 Ga0068852_100755757 3300005616 Bacteria 985
110 Ga0068859_100241259 3300005617 Bacteria 1896
111 Ga0068864_100219031 3300005618 Bacteria 1755
112 Ga0068866_10154976 3300005718 Bacteria 1330
113 Ga0068866_10274005 3300005718 Bacteria 1042
114 Ga0068861_101108744 3300005719 Bacteria 761
115 Ga0068861_101402057 3300005719 Bacteria 683
116 Ga0068870_10328909 3300005840 Bacteria 974
117 Ga0068863_100050041 3300005841 Bacteria 3962
118 Ga0068863_100371455 3300005841 Bacteria 1396
119 Ga0068863_101807961 3300005841 Bacteria 621
120 Ga0068858_100057444 3300005842 Bacteria 3596
121 Ga0068860_100294865 3300005843 Bacteria 1587
122 Ga0068860_100617451 3300005843 Bacteria 1090
123 Ga0068860_100846710 3300005843 Bacteria 929
124 Ga0068860_101680740 3300005843 Bacteria 657
125 Ga0068862_100200824 3300005844 Bacteria 1798
126 Ga0068862_101295600 3300005844 Bacteria 730
127 Ga0081540_1000205 3300005983 Bacteria 61689
128 Ga0075364_10045490 3300006051 Bacteria 2857
129 Ga0070712_100062640 3300006175 Bacteria 2631
130 Ga0075367_10116750 3300006178 Bacteria 1642
131 Ga0075367_10134580 3300006178 Bacteria 1529
132 Ga0097621_100009066 3300006237 Bacteria 7209
133 Ga0097621_100062488 3300006237 Bacteria 3057
134 Ga0097621_100072773 3300006237 Bacteria 2844
135 Ga0097621_100091216 3300006237 Bacteria 2550
136 Ga0097621_100170206 3300006237 Bacteria 1877
137 Ga0097621_100295270 3300006237 Bacteria 1430
138 Ga0097621_100562573 3300006237 Bacteria 1039
139 Ga0097621_100762088 3300006237 Bacteria 894
140 Ga0097621_102208653 3300006237 Bacteria 526
141 Ga0068871_100003001 3300006358 Bacteria 11579
142 Ga0068871_100041132 3300006358 Bacteria 3705
143 Ga0068871_100049228 3300006358 Bacteria 3406
144 Ga0068871_100056443 3300006358 Bacteria 3192
145 Ga0068871_100113445 3300006358 Bacteria 2282
146 Ga0068871_100140742 3300006358 Bacteria 2051
147 Ga0068871_100151086 3300006358 Bacteria 1981
148 Ga0068871_100666783 3300006358 Bacteria 951
149 Ga0075429_100004626 3300006880 Bacteria 11835
150 Ga0068865_100005270 3300006881 Bacteria 7820
151 Ga0068865_100099769 3300006881 Bacteria 2123
152 Ga0068865_100232949 3300006881 Bacteria 1446
153 Ga0097620_100241269 3300006931 Bacteria 1896
154 Ga0105240_10007049 3300009093 Bacteria 16391
155 Ga0105240_10042137 3300009093 Bacteria 5820
156 Ga0105240_10467879 3300009093 Bacteria 1407
157 Ga0105240_10583969 3300009093 Bacteria 1232
158 Ga0105240_10690502 3300009093 Bacteria 1115
159 Ga0105240_10813144 3300009093 Bacteria 1012
160 Ga0105245_10563910 3300009098 Bacteria 1162
161 Ga0105245_11035888 3300009098 Bacteria 866
162 Ga0105245_11811942 3300009098 Bacteria 663
163 Ga0105247_11161610 3300009101 Bacteria 612
164 Ga0114129_10019435 3300009147 Bacteria 9672
165 Ga0105243_10009445 3300009148 Bacteria 7431
166 Ga0105243_10139405 3300009148 Bacteria 2067
167 Ga0105243_10564307 3300009148 Bacteria 1090
168 Ga0105243_11831897 3300009148 Bacteria 638
169 Ga0105243_12104632 3300009148 Bacteria 600
170 Ga0105241_10090260 3300009174 Bacteria 2416
171 Ga0105241_10621210 3300009174 Bacteria 978
172 Ga0105241_10786911 3300009174 Bacteria 875
173 Ga0105241_12159981 3300009174 Bacteria 551
174 Ga0105242_10007194 3300009176 Bacteria 8584
175 Ga0105242_10008474 3300009176 Bacteria 7897
176 Ga0105242_10155999 3300009176 Bacteria 1994
177 Ga0105242_10170667 3300009176 Bacteria 1912
178 Ga0105242_10825289 3300009176 Bacteria 920
179 Ga0105242_11305792 3300009176 Bacteria 749
180 Ga0105242_11386908 3300009176 Bacteria 730
181 Ga0105242_12250612 3300009176 Bacteria 591
182 Ga0105248_10037444 3300009177 Bacteria 5427
183 Ga0105248_10117451 3300009177 Bacteria 3000
184 Ga0105248_11534200 3300009177 Bacteria 754
185 Ga0105237_10067577 3300009545 Bacteria 3568
186 Ga0105237_10093949 3300009545 Bacteria 2988
187 Ga0105237_10173036 3300009545 Bacteria 2159
188 Ga0105237_10243423 3300009545 Bacteria 1800
189 Ga0105237_10655266 3300009545 Bacteria 1057
190 Ga0105238_10406100 3300009551 Bacteria 1356
191 Ga0105238_10594474 3300009551 Bacteria 1114
192 Ga0105238_11623997 3300009551 Bacteria 677
193 Ga0105238_12530499 3300009551 Bacteria 549
194 Ga0105249_10009654 3300009553 Bacteria 8456
195 Ga0105249_10808087 3300009553 Bacteria 1002
196 Ga0105148_109339 3300009978 Bacteria 739
197 Ga0105028_100930 3300009993 Bacteria 3087
198 Ga0105239_10133642 3300010375 Bacteria 2761
199 Ga0105239_10315734 3300010375 Bacteria 1762
200 Ga0105239_10333868 3300010375 Bacteria 1710
201 Ga0105239_10934987 3300010375 Bacteria 995
202 Ga0105239_11097277 3300010375 Bacteria 916
203 Ga0105246_10026077 3300011119 Bacteria 3814
204 Ga0105246_10117058 3300011119 Bacteria 1968
205 Ga0105246_10603178 3300011119 Bacteria 949
206 Ga0157373_10348522 3300013100 Bacteria 1056
207 Ga0157373_10411083 3300013100 Bacteria 970
208 Ga0157373_10640363 3300013100 Bacteria 776
209 Ga0157373_10725236 3300013100 Bacteria 729
210 Ga0157373_10963001 3300013100 Bacteria 635
211 Ga0157370_10044464 3300013104 Bacteria 4268
212 Ga0157370_10376156 3300013104 Bacteria 1308
213 Ga0157369_10202414 3300013105 Bacteria 2083
214 Ga0157369_10216271 3300013105 Bacteria 2007
215 Ga0157374_10154379 3300013296 Bacteria 2233
216 Ga0157374_10599568 3300013296 Bacteria 1111
217 Ga0157374_10721804 3300013296 Bacteria 1010
218 Ga0157378_10027149 3300013297 Bacteria 5051
219 Ga0157378_10191007 3300013297 Bacteria 1931
220 Ga0157378_10399326 3300013297 Bacteria 1354
221 Ga0157378_10482734 3300013297 Bacteria 1235
222 Ga0157378_10532737 3300013297 Bacteria 1177
223 Ga0157378_10772059 3300013297 Bacteria 985
224 Ga0157378_11446277 3300013297 Bacteria 731
225 Ga0163162_10037679 3300013306 Bacteria 4826
226 Ga0163162_10502992 3300013306 Bacteria 1342
227 Ga0163162_11116554 3300013306 Bacteria 893
228 Ga0163162_11338825 3300013306 Bacteria 814
229 Ga0163162_12372709 3300013306 Bacteria 610
230 Ga0157372_10126860 3300013307 Bacteria 2934
231 Ga0157372_12087128 3300013307 Bacteria 651
232 Ga0157375_10720366 3300013308 Bacteria 1150
233 Ga0157375_11155580 3300013308 Bacteria 907
234 Ga0157375_11941443 3300013308 Bacteria 699
235 Ga0157375_11972143 3300013308 Bacteria 694
236 Ga0157375_12752162 3300013308 Bacteria 588
237 Ga0163163_10000491 3300014325 Bacteria 35805
238 Ga0163163_10548764 3300014325 Bacteria 1218
239 Ga0163163_12894005 3300014325 Bacteria 536
240 Ga0157380_11421511 3300014326 Bacteria 745
241 Ga0157377_10540259 3300014745 Bacteria 821
242 Ga0157379_10037573 3300014968 Bacteria 4318
243 Ga0157379_10062631 3300014968 Bacteria 3326
244 Ga0157379_10078369 3300014968 Bacteria 2959
245 Ga0157379_11876925 3300014968 Bacteria 590
246 Ga0157376_10014841 3300014969 Bacteria 5863
247 Ga0157376_10371772 3300014969 Bacteria 1374
248 Ga0157376_10519062 3300014969 Bacteria 1174
249 Ga0163161_10645300 3300017792 Bacteria 877
250 Ga0206355_1210900 3300020076 Eukaryota 1000
251 Ga0206350_10075980 3300020080 Eukaryota 912
252 Ga0213874_10010862 3300021377 Bacteria 2291
253 Ga0213874_10018562 3300021377 Bacteria 1881
254 Ga0213871_10216264 3300021441 Bacteria 601
255 Ga0224712_10177435 3300022467 Bacteria 958
256 Ga0209563_118080 3300025230 Bacteria 833
257 Ga0207427_104324 3300025231 Bacteria 2445
258 Ga0209233_1000015 3300025261 Bacteria 980563
259 Ga0209455_1013367 3300025272 Bacteria 1909
260 Ga0209758_1000013 3300025297 Bacteria 873003
261 Ga0207642_10217920 3300025899 Bacteria 1065
262 Ga0207642_10292620 3300025899 Bacteria 941
263 Ga0207642_10304755 3300025899 Bacteria 925
264 Ga0207710_10201397 3300025900 Bacteria 983
265 Ga0207645_10003004 3300025907 Bacteria 13034
266 Ga0207645_10119125 3300025907 Bacteria 1713
267 Ga0207643_10090745 3300025908 Bacteria 1781
268 Ga0207643_10331058 3300025908 Bacteria 953
269 Ga0207643_10607876 3300025908 Bacteria 704
270 Ga0207705_10020579 3300025909 Bacteria 4711
271 Ga0207705_10098319 3300025909 Bacteria 2150
272 Ga0207705_10413766 3300025909 Bacteria 1043
273 Ga0207705_10573863 3300025909 Bacteria 877
274 Ga0207705_10686248 3300025909 Bacteria 796
275 Ga0207684_10796322 3300025910 Bacteria 799
276 Ga0207654_10048312 3300025911 Bacteria 2435
277 Ga0207654_10592483 3300025911 Bacteria 790
278 Ga0207654_10595488 3300025911 Bacteria 788
279 Ga0207654_10719908 3300025911 Bacteria 718
280 Ga0207707_10248987 3300025912 Bacteria 1544
281 Ga0207707_10519529 3300025912 Bacteria 1014
282 Ga0207707_10548205 3300025912 Bacteria 983
283 Ga0207695_10538508 3300025913 Bacteria 1049
284 Ga0207695_10841025 3300025913 Bacteria 798
285 Ga0207695_10874433 3300025913 Bacteria 778
286 Ga0207671_10214680 3300025914 Bacteria 1506
287 Ga0207693_10425375 3300025915 Bacteria 1038
288 Ga0207693_11164100 3300025915 Bacteria 583
289 Ga0207663_11471634 3300025916 Bacteria 548
290 Ga0207660_10413469 3300025917 Bacteria 1087
291 Ga0207660_10808507 3300025917 Bacteria 765
292 Ga0207662_10616523 3300025918 Bacteria 756
293 Ga0207657_10042479 3300025919 Bacteria 4011
294 Ga0207657_10124492 3300025919 Bacteria 2118
295 Ga0207657_10272755 3300025919 Bacteria 1344
296 Ga0207657_10486208 3300025919 Bacteria 967
297 Ga0207649_11073600 3300025920 Bacteria 635
298 Ga0207649_11429036 3300025920 Bacteria 547
299 Ga0207652_10201022 3300025921 Bacteria 1793
300 Ga0207652_10253755 3300025921 Bacteria 1586
301 Ga0207681_11109693 3300025923 Bacteria 664
302 Ga0207694_10163831 3300025924 Bacteria 1797
303 Ga0207694_10174938 3300025924 Bacteria 1739
304 Ga0207694_10175068 3300025924 Bacteria 1739
305 Ga0207694_10178854 3300025924 Bacteria 1720
306 Ga0207694_10419033 3300025924 Bacteria 1115
307 Ga0207650_10308105 3300025925 Bacteria 1295
308 Ga0207650_10476343 3300025925 Bacteria 1041
309 Ga0207650_10560029 3300025925 Bacteria 959
310 Ga0207659_11119211 3300025926 Bacteria 677
311 Ga0207687_10187066 3300025927 Bacteria 1609
312 Ga0207687_10672471 3300025927 Bacteria 877
313 Ga0207687_10815368 3300025927 Bacteria 796
314 Ga0207644_10210438 3300025931 Bacteria 1537
315 Ga0207644_10276952 3300025931 Bacteria 1346
316 Ga0207644_10793003 3300025931 Bacteria 792
317 Ga0207644_11107522 3300025931 Bacteria 665
318 Ga0207644_11220708 3300025931 Bacteria 632
319 Ga0207690_10340979 3300025932 Bacteria 1183
320 Ga0207690_10380054 3300025932 Bacteria 1122
321 Ga0207690_10725611 3300025932 Bacteria 818
322 Ga0207686_10022782 3300025934 Bacteria 3609
323 Ga0207686_10147789 3300025934 Bacteria 1632
324 Ga0207686_10466369 3300025934 Bacteria 974
325 Ga0207709_10035973 3300025935 Bacteria 2932
326 Ga0207709_10136610 3300025935 Bacteria 1679
327 Ga0207670_10288462 3300025936 Bacteria 1281
328 Ga0207669_10412133 3300025937 Bacteria 1061
329 Ga0207669_10747290 3300025937 Bacteria 807
330 Ga0207704_10019753 3300025938 Bacteria 3547
331 Ga0207704_10064811 3300025938 Bacteria 2285
332 Ga0207704_10158813 3300025938 Bacteria 1606
333 Ga0207704_10822407 3300025938 Bacteria 777
334 Ga0207704_11846130 3300025938 Bacteria 520
335 Ga0207691_10126233 3300025940 Bacteria 2263
336 Ga0207711_10019519 3300025941 Bacteria 5642
337 Ga0207689_10024757 3300025942 Bacteria 5032
338 Ga0207689_10077600 3300025942 Bacteria 2730
339 Ga0207689_10195184 3300025942 Bacteria 1671
340 Ga0207689_10294490 3300025942 Bacteria 1344
341 Ga0207689_10801200 3300025942 Bacteria 795
342 Ga0207661_10481164 3300025944 Bacteria 1133
343 Ga0207679_10914844 3300025945 Bacteria 803
344 Ga0207667_10071670 3300025949 Bacteria 3602
345 Ga0207667_10246640 3300025949 Bacteria 1827
346 Ga0207667_10441256 3300025949 Bacteria 1323
347 Ga0207667_10626635 3300025949 Bacteria 1083
348 Ga0207667_10816911 3300025949 Bacteria 928
349 Ga0207667_11270137 3300025949 Bacteria 714
350 Ga0207651_10540750 3300025960 Bacteria 1012
351 Ga0207651_11947679 3300025960 Bacteria 528
352 Ga0207712_10048552 3300025961 Bacteria 2953
353 Ga0207712_10348833 3300025961 Bacteria 1230
354 Ga0207668_10702134 3300025972 Bacteria 889
355 Ga0207640_10261887 3300025981 Bacteria 1348
356 Ga0207640_10732565 3300025981 Bacteria 851
357 Ga0207640_10995687 3300025981 Bacteria 737
358 Ga0207658_10340416 3300025986 Bacteria 1303
359 Ga0207677_10886672 3300026023 Bacteria 803
360 Ga0207677_11964559 3300026023 Bacteria 544
361 Ga0207703_10090432 3300026035 Bacteria 2573
362 Ga0207639_10383353 3300026041 Bacteria 1263
363 Ga0207639_10667485 3300026041 Bacteria 963
364 Ga0207639_11344134 3300026041 Bacteria 671
365 Ga0207678_10636500 3300026067 Bacteria 936
366 Ga0207678_10677124 3300026067 Bacteria 907
367 Ga0207702_10267177 3300026078 Bacteria 1612
368 Ga0207702_10400325 3300026078 Bacteria 1324
369 Ga0207702_10850731 3300026078 Bacteria 903
370 Ga0207702_11158794 3300026078 Bacteria 767
371 Ga0207641_10031995 3300026088 Bacteria 4365
372 Ga0207641_11090129 3300026088 Bacteria 797
373 Ga0207648_10034161 3300026089 Bacteria 4484
374 Ga0207648_10034253 3300026089 Bacteria 4477
375 Ga0207648_10906949 3300026089 Bacteria 823
376 Ga0207648_11053719 3300026089 Bacteria 762
377 Ga0207676_11682612 3300026095 Bacteria 633
378 Ga0207676_11885917 3300026095 Bacteria 596
379 Ga0207674_10117367 3300026116 Bacteria 2631
380 Ga0207674_10462892 3300026116 Bacteria 1225
381 Ga0207674_10846167 3300026116 Bacteria 882
382 Ga0207674_11144211 3300026116 Bacteria 748
383 Ga0207675_101179940 3300026118 Bacteria 786
384 Ga0207675_102065079 3300026118 Bacteria 587
385 Ga0207683_10026414 3300026121 Bacteria 5010
386 Ga0207683_10030002 3300026121 Bacteria 4710
387 Ga0207683_10162911 3300026121 Bacteria 2017
388 Ga0207683_10576933 3300026121 Bacteria 1040
389 Ga0207683_10779530 3300026121 Bacteria 887
390 Ga0207683_11039319 3300026121 Bacteria 760
391 Ga0207698_10229526 3300026142 Bacteria 1684
392 Ga0207698_11922732 3300026142 Bacteria 606
393 Ga0268266_10392286 3300028379 Bacteria 1311
394 Ga0268266_10685065 3300028379 Bacteria 987
395 Ga0268265_10638737 3300028380 Bacteria 1022
396 Ga0268265_11072674 3300028380 Bacteria 799
397 Ga0268264_10876763 3300028381 Bacteria 900
398 Ga0265318_10001257 3300028577 Bacteria 15341
399 Ga0265338_10486327 3300028800 Bacteria 870
400 Ga0265338_10715930 3300028800 Bacteria 690
401 Ga0265324_10001784 3300029957 Bacteria 11754
402 Ga0265324_10254405 3300029957 Bacteria 597
403 Ga0265330_10053979 3300031235 Bacteria 1757
404 Ga0265330_10165280 3300031235 Bacteria 939
405 Ga0265330_10362549 3300031235 Bacteria 612
406 Ga0265332_10007275 3300031238 Bacteria 5008
407 Ga0265332_10176988 3300031238 Bacteria 889
408 Ga0265328_10103375 3300031239 Bacteria 1056
409 Ga0265328_10195220 3300031239 Bacteria 768
410 Ga0265325_10002319 3300031241 Bacteria 12918
411 Ga0265325_10039093 3300031241 Bacteria 2500
412 Ga0265325_10107400 3300031241 Bacteria 1360
413 Ga0265329_10073585 3300031242 Bacteria 1081
414 Ga0265340_10179016 3300031247 Bacteria 959
415 Ga0265339_10005265 3300031249 Bacteria 8630
416 Ga0265339_10049879 3300031249 Bacteria 2290
417 Ga0265339_10085331 3300031249 Bacteria 1662
418 Ga0265331_10000066 3300031250 Bacteria 163571
419 Ga0265331_10135656 3300031250 Bacteria 1121
420 Ga0265331_10210177 3300031250 Bacteria 876
421 Ga0265316_10056849 3300031344 Bacteria 3053
422 Ga0265316_10399001 3300031344 Bacteria 991
423 Ga0265316_10414262 3300031344 Bacteria 969
424 Ga0265316_10844982 3300031344 Bacteria 641
425 Ga0307513_11012325 3300031456 Bacteria 541
426 Ga0307509_10664965 3300031507 Bacteria 710
427 Ga0265313_10003662 3300031595 Bacteria 12297
428 Ga0265313_10008701 3300031595 Bacteria 6708
429 Ga0265313_10017912 3300031595 Bacteria 4000
430 Ga0265314_10000125 3300031711 Bacteria 118671
431 Ga0265314_10015417 3300031711 Bacteria 6067
432 Ga0265314_10063862 3300031711 Bacteria 2496
433 Ga0265314_10101807 3300031711 Bacteria 1845
434 Ga0265314_10468408 3300031711 Bacteria 668
435 Ga0265342_10142787 3300031712 Bacteria 1335
436 Ga0265342_10257693 3300031712 Bacteria 929
437 Ga0265342_10309157 3300031712 Bacteria 831
438 Ga0316576_10097823 3300031727 Bacteria 2191
439 Ga0316578_10036022 3300031728 Bacteria 2847
440 Ga0307516_10063104 3300031730 Bacteria 3588
441 Ga0307405_11200022 3300031731 Bacteria 656
442 Ga0307406_10562495 3300031901 Bacteria 935
443 Ga0307409_102474495 3300031995 Bacteria 548
444 Ga0307416_100751936 3300032002 Bacteria 1068
445 Ga0307411_10248580 3300032005 Bacteria 1397
446 Ga0316585_10254928 3300032137 Bacteria 582
447 Ga0316593_10032416 3300032168 Bacteria 1707
448 Ga0316593_10157933 3300032168 Bacteria 827
449 Ga0316593_10223314 3300032168 Bacteria 700
450 Ga0316593_10255282 3300032168 Bacteria 657
451 Ga0307510_10247674 3300033180 Bacteria 1272
452 Ga0307510_10268418 3300033180 Bacteria 1184
453 Ga0316587_1034131 3300033529 Bacteria 906
454 Ga0373939_0176091 3300035114 Bacteria 795
455 Ga0373953_0349090 3300035117 Bacteria 648
456 Ga0373955_0275466 3300035172 Bacteria 1012
457 Ga0316574_0202438 3300035398 Bacteria 1275
458 Ga0373931_0581748 3300035691 Bacteria 730
459 Ga0373933_0851632 3300035724 Bacteria 600
460 Ga0373937_0067460 3300036401 Bacteria 3296
461 Ga0373937_0145830 3300036401 Bacteria 2216
462 Ga0316582_0040931 3300036647 Bacteria 2894
463 Ga0316584_0000187 3300036712 Bacteria 30114
464 Ga0316584_0123400 3300036712 Bacteria 1935
465 Ga0395899_0380977 3300037312 Bacteria 937
466 Ga0395900_0040247 3300037418 Bacteria 4817
467 Ga0395905_0017082 3300037471 Bacteria 6890
468 Ga0395905_1520550 3300037471 Bacteria 574
469 Ga0395905_1887499 3300037471 Bacteria 504
470 Ga0395901_1043192 3300038443 Bacteria 791
471 Ga0436365_0437804 3300039437 Bacteria 1242
472 Ga0436360_0181532 3300039438 Bacteria 2321
473 Ga0436360_0464388 3300039438 Bacteria 645
474 Ga0436360_1035776 3300039438 Bacteria 4465
475 Ga0436360_1308938 3300039438 Bacteria 1394
476 Ga0436361_1147293 3300039447 Bacteria 1029
477 Ga0436363_0072239 3300039450 Bacteria 1409
478 Ga0436363_0370956 3300039450 Bacteria 5153
479 Ga0436363_1493646 3300039450 Bacteria 614
480 Ga0436363_1576522 3300039450 Bacteria 636
481 Ga0436362_0226131 3300039453 Bacteria 706
482 Ga0436362_0755406 3300039453 Bacteria 628
483 Ga0439465_0260153 3300041413 Bacteria 643
484 Ga0451789_0426280 3300041443 Bacteria 527
485 Ga0451793_1912129 3300041452 Bacteria 1106
486 Ga0451853_2188647 3300041512 Bacteria 578
487 Ga0466969_0032441 3300044656 Bacteria 2655
488 Ga0466972_0005552 3300044658 Bacteria 6318
489 Ga0466965_0013493 3300044683 Bacteria 3856
490 Ga0466966_0029784 3300044684 Bacteria 3549
491 Ga0466961_0034201 3300044693 Bacteria 3263
492 Ga0466963_0049226 3300044694 Bacteria 2787
493 Ga0466963_0339405 3300044694 Bacteria 1058
494 Ga0466964_0356825 3300044706 Bacteria 753
495 Ga0453684_0006154 3300044712 Bacteria 23083
496 Ga0453684_0010839 3300044712 Bacteria 15449
497 Ga0453684_1862699 3300044712 Unclassified 610
498 Ga0466959_0032290 3300045049 Bacteria 3875
499 Ga0466967_0552571 3300045976 Bacteria 1133
500 Ga0495584_0429651 3300046491 Bacteria 672
501 Ga0495583_0381251 3300046506 Bacteria 555
502 Ga0495606_0376267 3300046507 Bacteria 746
503 Ga0495648_0404954 3300046524 Bacteria 609
504 Ga0495652_0650608 3300046529 Bacteria 714
505 Ga0495652_0758145 3300046529 Bacteria 649
506 Ga0495587_0141879 3300046536 Bacteria 1371
507 Ga0495587_0826541 3300046536 Bacteria 505
508 Ga0495598_0260408 3300046537 Bacteria 645
509 Ga0495609_0061548 3300046538 Bacteria 1658
510 Ga0495621_0183290 3300046539 Bacteria 836
511 Ga0495645_0529773 3300046543 Bacteria 733
512 Ga0495622_0002413 3300046557 Bacteria 9081
513 Ga0495625_0117728 3300046660 Bacteria 1811
514 Ga0495657_0643311 3300046675 Bacteria 612
515 Ga0495599_0422479 3300046678 Bacteria 792
516 Ga0495623_0298600 3300046679 Bacteria 891
517 Ga0495658_0384503 3300046683 Bacteria 894
518 Ga0495669_0305792 3300046684 Bacteria 767
519 Ga0495669_0436480 3300046684 Bacteria 636
520 Ga0495624_0572118 3300046690 Bacteria 674
521 Ga0495671_0410750 3300046692 Bacteria 648
522 Ga0495649_0205481 3300046694 Bacteria 1022
523 Ga0495589_0471785 3300046794 Bacteria 574
524 Ga0495600_0393921 3300046809 Bacteria 863
525 Ga0495674_0072391 3300047319 Bacteria 2973
526 Ga0495675_0427202 3300047444 Bacteria 769
527 Ga0495681_0328824 3300047470 Bacteria 585
528 Ga0495686_0199304 3300047472 Bacteria 1150
529 Ga0496100_0393869 3300048903 Bacteria 1054
530 Ga0496101_0528839 3300048904 Bacteria 932
531 Ga0496101_0620582 3300048904 Bacteria 855
532 Ga0496104_0159085 3300048907 Bacteria 2167
533 Ga0496104_0258418 3300048907 Bacteria 1655
534 Ga0496106_0251736 3300048909 Bacteria 1412
535 Ga0496106_1066746 3300048909 Bacteria 634
536 Ga0496107_0841040 3300048910 Bacteria 671
537 Ga0496108_1113509 3300048911 Bacteria 670
538 Ga0496109_0107185 3300048912 Bacteria 2595
539 Ga0496109_0257522 3300048912 Bacteria 1643
540 Ga0496110_0083171 3300048913 Bacteria 2855
541 Ga0496111_0166415 3300048914 Bacteria 1637
542 Ga0496113_0083234 3300048916 Bacteria 2455
543 Ga0496113_0803199 3300048916 Bacteria 747
544 Ga0496115_0360664 3300048918 Bacteria 1184
545 Ga0496115_0397658 3300048918 Bacteria 1118
546 Ga0496117_0570678 3300048920 Bacteria 535
547 Ga0496124_0000206 3300048927 Bacteria 116591
548 Ga0496126_0124615 3300048929 Bacteria 2231
549 Ga0496126_0632921 3300048929 Bacteria 839
550 Ga0501335_050008 3300049551 Bacteria 508
551 Ga0501031_0055737 3300049568 Bacteria 2576
552 Ga0501032_0028469 3300049569 Bacteria 3839
553 Ga0501032_0191710 3300049569 Bacteria 1336
554 Ga0501032_0673496 3300049569 Bacteria 656
555 Ga0501033_0005971 3300049570 Bacteria 9558
556 Ga0501033_0033498 3300049570 Bacteria 3856
557 Ga0501033_0098453 3300049570 Bacteria 2136
558 Ga0501033_0099741 3300049570 Bacteria 2120
559 Ga0501033_0156275 3300049570 Bacteria 1643
560 Ga0501033_0194501 3300049570 Bacteria 1450
561 Ga0501033_0389886 3300049570 Bacteria 972
562 Ga0501033_0419602 3300049570 Bacteria 932
563 Ga0501033_0486685 3300049570 Bacteria 854
564 Ga0501033_0660730 3300049570 Bacteria 713
565 Ga0501033_1126035 3300049570 Bacteria 521
566 Ga0501034_0000001 3300049571 Bacteria 2184493
567 Ga0501034_0007641 3300049571 Bacteria 11499
568 Ga0501034_0022877 3300049571 Bacteria 6367
569 Ga0501034_0025819 3300049571 Bacteria 5983
570 Ga0501034_0065576 3300049571 Bacteria 3644
571 Ga0501034_0137305 3300049571 Bacteria 2426
572 Ga0501034_0149015 3300049571 Bacteria 2316
573 Ga0501034_0197895 3300049571 Bacteria 1969
574 Ga0501034_0408115 3300049571 Bacteria 1281
575 Ga0501034_0560524 3300049571 Bacteria 1051
576 Ga0501034_1331686 3300049571 Bacteria 594
577 Ga0501036_0000599 3300049572 Bacteria 26132
578 Ga0501036_0011755 3300049572 Bacteria 7253
579 Ga0501036_0096558 3300049572 Bacteria 2498
580 Ga0501036_0127636 3300049572 Bacteria 2148
581 Ga0501036_0474276 3300049572 Bacteria 1042
582 Ga0501036_0557681 3300049572 Bacteria 952
583 Ga0501036_1020219 3300049572 Bacteria 677
584 Ga0501036_1028072 3300049572 Bacteria 674
585 Ga0501037_0009260 3300049573 Bacteria 7219
586 Ga0501037_0306682 3300049573 Bacteria 1101
587 Ga0501037_0558818 3300049573 Bacteria 772
588 Ga0501038_0015209 3300049574 Bacteria 6997
589 Ga0501038_0159627 3300049574 Bacteria 1833
590 Ga0501038_0220162 3300049574 Bacteria 1515
591 Ga0501038_1235484 3300049574 Bacteria 541
592 Ga0501039_0000020 3300049575 Bacteria 162656
593 Ga0501039_0090768 3300049575 Bacteria 2381
594 Ga0501039_0217253 3300049575 Bacteria 1503
595 Ga0501039_0461240 3300049575 Bacteria 998
596 Ga0501040_0517947 3300049576 Bacteria 860
597 Ga0501041_0171467 3300049577 Bacteria 1358
598 Ga0501042_0291156 3300049578 Bacteria 1179
599 Ga0501042_0891354 3300049578 Bacteria 648
600 Ga0501043_0040103 3300049579 Bacteria 3680
601 Ga0501043_0277810 3300049579 Bacteria 1284
602 Ga0501043_0337953 3300049579 Bacteria 1146
603 Ga0501043_0520561 3300049579 Bacteria 886
604 Ga0501043_0825251 3300049579 Bacteria 669
605 Ga0501043_1072902 3300049579 Bacteria 570
606 Ga0501046_0002229 3300049580 Bacteria 18281
607 Ga0501046_0052222 3300049580 Bacteria 3222
608 Ga0501046_0183796 3300049580 Bacteria 1562
609 Ga0501046_0187613 3300049580 Bacteria 1544
610 Ga0501046_0193427 3300049580 Bacteria 1516
611 Ga0501047_0000257 3300049581 Bacteria 62079
612 Ga0501047_0022850 3300049581 Bacteria 6004
613 Ga0501047_0024473 3300049581 Bacteria 5794
614 Ga0501047_0029451 3300049581 Bacteria 5293
615 Ga0501047_0106894 3300049581 Bacteria 2679
616 Ga0501047_0132561 3300049581 Bacteria 2372
617 Ga0501047_0255560 3300049581 Bacteria 1600
618 Ga0501047_0310146 3300049581 Bacteria 1418
619 Ga0501047_0372572 3300049581 Bacteria 1263
620 Ga0501047_0627217 3300049581 Bacteria 895
621 Ga0501047_0828851 3300049581 Bacteria 739
622 Ga0501048_0000588 3300049582 Bacteria 25774
623 Ga0501048_0003231 3300049582 Bacteria 12423
624 Ga0501048_0330690 3300049582 Bacteria 1086
625 Ga0501068_0096297 3300049584 Bacteria 1831
626 Ga0501069_0026474 3300049585 Bacteria 3176
627 Ga0501069_0052122 3300049585 Bacteria 2278
628 Ga0501070_0017840 3300049586 Bacteria 5959
629 Ga0501070_0053047 3300049586 Bacteria 3364
630 Ga0501070_0156181 3300049586 Bacteria 1881
631 Ga0501070_0620642 3300049586 Bacteria 861
632 Ga0501070_0952393 3300049586 Bacteria 667
633 Ga0501071_1432467 3300049587 Bacteria 533
634 Ga0501072_0538791 3300049588 Bacteria 922
635 Ga0501073_0007903 3300049589 Bacteria 7891
636 Ga0501073_0174001 3300049589 Bacteria 1490
637 Ga0501073_0190178 3300049589 Bacteria 1420
638 Ga0501073_0536781 3300049589 Bacteria 808
639 Ga0501074_0006918 3300049590 Bacteria 8188
640 Ga0501074_0012043 3300049590 Bacteria 6282
641 Ga0501074_0581738 3300049590 Bacteria 792
642 Ga0501076_1224553 3300049592 Bacteria 618
643 Ga0501076_1714651 3300049592 Bacteria 515
644 Ga0501249_165636 3300049679 Bacteria 564
645 Ga0501219_024403 3300049703 Bacteria 542
646 Ga0501079_0052216 3300049741 Bacteria 3155
647 Ga0501080_0000183 3300049742 Bacteria 45555
648 Ga0501080_0209359 3300049742 Bacteria 1787
649 Ga0501080_0899322 3300049742 Bacteria 772
650 Ga0501080_1605307 3300049742 Bacteria 551
651 Ga0501080_1668884 3300049742 Bacteria 538
652 Ga0501083_0007725 3300049744 Bacteria 7624
653 Ga0501083_0012732 3300049744 Bacteria 5882
654 Ga0501083_0076257 3300049744 Bacteria 2225
655 Ga0501083_0100623 3300049744 Bacteria 1906
656 Ga0501083_0390055 3300049744 Bacteria 906
657 Ga0501083_0529756 3300049744 Bacteria 767
658 Ga0501035_0013093 3300049822 Bacteria 7655
659 Ga0501035_0037027 3300049822 Bacteria 4420
660 Ga0501035_0059854 3300049822 Bacteria 3392
661 Ga0501035_0116655 3300049822 Bacteria 2336
662 Ga0501035_0118870 3300049822 Bacteria 2312
663 Ga0501035_0137265 3300049822 Bacteria 2128
664 Ga0501035_0245579 3300049822 Bacteria 1521
665 Ga0501035_0287046 3300049822 Bacteria 1389
666 Ga0501035_1225882 3300049822 Bacteria 581
667 Ga0501044_0001700 3300049823 Bacteria 25816
668 Ga0501044_0005286 3300049823 Bacteria 14356
669 Ga0501044_0037841 3300049823 Bacteria 5041
670 Ga0501044_0077196 3300049823 Bacteria 3379
671 Ga0501044_0122579 3300049823 Bacteria 2599
672 Ga0501044_0156054 3300049823 Bacteria 2262
673 Ga0501044_0186812 3300049823 Bacteria 2037
674 Ga0501044_0267456 3300049823 Bacteria 1646
675 Ga0501044_0443089 3300049823 Bacteria 1206
676 Ga0501044_0641829 3300049823 Bacteria 951
677 Ga0501044_0807877 3300049823 Bacteria 817
678 Ga0501044_1409192 3300049823 Bacteria 562
679 Ga0501045_0473472 3300049824 Bacteria 931
680 nmdc:mga03n38_21522_c1 3300050490 Bacteria 2167
681 nmdc:mga03n38_490481_c1 3300050490 Bacteria 688
682 nmdc:mga06z11_74517_c1 3300050494 Bacteria 1805
683 nmdc:mga04h51_3910_c1 3300050495 Bacteria 3664
684 nmdc:mga07m45_255690_c1 3300050496 Bacteria 1019
685 nmdc:mga05p37_41697_c1 3300050507 Bacteria 5637
686 nmdc:mga09592_31860_c1 3300050508 Bacteria 4395
687 nmdc:mga0qj67_8249_c1 3300050509 Bacteria 7723
688 nmdc:mga06r32_1832829_c1 3300050510 Bacteria 542
689 Ga0500635_0175456 3300053080 Bacteria 826
690 Ga0495619_0034703 3300053085 Bacteria 3280
691 Ga0500643_000003 3300053087 Bacteria 876659
692 Ga0500646_0054934 3300053090 Bacteria 1158
693 Ga0500646_0311446 3300053090 Bacteria 567
694 Ga0500641_0298351 3300053096 Bacteria 662
695 Ga0500556_0035718 3300053104 Bacteria 1719
696 Ga0500593_138306 3300053117 Bacteria 962
697 Ga0500595_000793 3300053119 Bacteria 18365
698 Ga0500595_022389 3300053119 Bacteria 2239
699 Ga0500595_073621 3300053119 Bacteria 1010
700 Ga0500595_084132 3300053119 Bacteria 928
701 Ga0500595_131264 3300053119 Bacteria 705
702 Ga0500608_305605 3300053122 Bacteria 587
703 Ga0500614_111246 3300053123 Bacteria 799
704 Ga0500655_129826 3300053133 Bacteria 538
705 Ga0500559_0162219 3300053136 Bacteria 1050
706 Ga0500559_0188504 3300053136 Bacteria 972
707 Ga0500568_0023085 3300053139 Bacteria 2650
708 Ga0500568_0070303 3300053139 Bacteria 1341
709 Ga0500573_0000008 3300053140 Bacteria 237795
710 Ga0500600_0002542 3300053149 Bacteria 10288
711 Ga0500604_0000195 3300053151 Bacteria 17351
712 Ga0500639_129880 3300053163 Bacteria 1195
713 Ga0500645_063977 3300053730 Bacteria 1061
714 Ga0501084_0012879 3300054114 Bacteria 6927
715 Ga0501084_0473492 3300054114 Bacteria 1059
716 Ga0587077_112908 3300059493 Bacteria 668
717 Ga0587101_005090 3300059623 Bacteria 1441
718 Ga0587062_009839 3300059639 Bacteria 1174
719 Ga0587076_045441 3300059645 Bacteria 837
720 Ga0501082_0040697 3300060353 Bacteria 4008
721 Ga0501082_0498399 3300060353 Bacteria 1064
722 Ga0466962_0063065 3300061719 Bacteria 1769
723 Ga0530510_1580002 3300061734 Bacteria 504

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0000206 Ga0496124_0000206_74967_75365 104
2 3300009093 Ga0105240_10007049 Ga0105240_1000704913 107
3 3300009545 Ga0105237_10093949 Ga0105237_100939492 107
4 3300010375 Ga0105239_10315734 Ga0105239_103157342 107
5 3300037471 Ga0395905_0017082 Ga0395905_0017082_5703_6074 114
6 3300049551 Ga0501335_050008 Ga0501335_050008_29_400 114
7 iso_pu_bacteria 2511231027 2511390628 117
8 iso_pu_bacteria 2545555834 2545679384 117
9 iso_pu_bacteria 2595698237 2596375143 117
10 iso_pu_bacteria 2643221629 2644167519 117
11 iso_pu_bacteria 2643221662 2644347282 117
12 iso_pu_bacteria 2837678835 2837680167 117
13 iso_pu_bacteria 2842694124 2842696897 117
14 iso_pu_bacteria 2842871566 2842872841 117
15 iso_pu_bacteria 2889306138 2889311774 117
16 iso_pu_bacteria 2894817345 2894818422 117
17 iso_pu_bacteria 2902330777 2902335352 117
18 iso_pu_bacteria 2902405164 2902409445 117
19 iso_pu_bacteria 2909042592 2909048083 117
20 iso_pu_bacteria 2928125067 2928126493 117
21 iso_pu_bacteria 2928521798 2928524301 117
22 iso_pu_bacteria 2954011201 2954015423 117
23 iso_pu_bacteria 3002141150 3002143548 117
24 iso_pu_bacteria 3003665799 3003670821 117
25 iso_pu_bacteria 641522639 641644531 117
26 iso_pu_bacteria 8045864390 8045865185 117
27 3300005344 Ga0070661_100403928 Ga0070661_1004039282 118
28 3300005445 Ga0070708_100696733 Ga0070708_1006967331 118
29 3300006880 Ga0075429_100004626 Ga0075429_1000046267 118
30 3300009147 Ga0114129_10019435 Ga0114129_1001943512 118
31 3300013100 Ga0157373_10411083 Ga0157373_104110832 118
32 3300013100 Ga0157373_10963001 Ga0157373_109630011 118
33 3300014968 Ga0157379_11876925 Ga0157379_118769252 118
34 3300020080 Ga0206350_10075980 Ga0206350_100759801 118
35 3300022467 Ga0224712_10177435 Ga0224712_101774353 118
36 3300025920 Ga0207649_11429036 Ga0207649_114290361 118
37 3300025927 Ga0207687_10187066 Ga0207687_101870664 118
38 3300025938 Ga0207704_11846130 Ga0207704_118461301 118
39 3300025949 Ga0207667_10071670 Ga0207667_100716705 118
40 3300031727 Ga0316576_10097823 Ga0316576_100978233 118
41 3300031728 Ga0316578_10036022 Ga0316578_100360222 118
42 3300032137 Ga0316585_10254928 Ga0316585_102549282 118
43 3300032168 Ga0316593_10157933 Ga0316593_101579331 118
44 3300032168 Ga0316593_10223314 Ga0316593_102233142 118
45 3300032168 Ga0316593_10255282 Ga0316593_102552821 118
46 3300033529 Ga0316587_1034131 Ga0316587_10341311 118
47 3300035398 Ga0316574_0202438 Ga0316574_0202438_82_438 118
48 3300036712 Ga0316584_0000187 Ga0316584_0000187_14819_15175 118
49 3300039438 Ga0436360_1035776 Ga0436360_1035776_454_810 118
50 3300039450 Ga0436363_1493646 Ga0436363_1493646_96_464 118
51 3300044712 Ga0453684_0006154 Ga0453684_0006154_8111_8467 118
52 3300048916 Ga0496113_0083234 Ga0496113_0083234_1564_1932 118
53 3300049679 Ga0501249_165636 Ga0501249_165636_169_525 118
54 3300049703 Ga0501219_024403 Ga0501219_024403_77_433 118
55 3300050507 nmdc:mga05p37_41697_c1 nmdc:mga05p37_41697_c1_2679_3035 118
56 3300050508 nmdc:mga09592_31860_c1 nmdc:mga09592_31860_c1_126_482 118
57 3300050509 nmdc:mga0qj67_8249_c1 nmdc:mga0qj67_8249_c1_2679_3035 118
58 3300050510 nmdc:mga06r32_1832829_c1 nmdc:mga06r32_1832829_c1_164_532 118
59 3300053119 Ga0500595_073621 Ga0500595_073621_544_900 118
60 3300004803 Ga0058862_12843542 Ga0058862_128435422 119
61 3300005841 Ga0068863_100371455 Ga0068863_1003714553 119
62 3300006051 Ga0075364_10045490 Ga0075364_100454902 119
63 3300013308 Ga0157375_12752162 Ga0157375_127521621 119
64 3300020076 Ga0206355_1210900 Ga0206355_12109004 119
65 3300025931 Ga0207644_10793003 Ga0207644_107930031 119
66 3300039437 Ga0436365_0437804 Ga0436365_0437804_618_977 119
67 3300044656 Ga0466969_0032441 Ga0466969_0032441_1182_1541 119
68 3300044658 Ga0466972_0005552 Ga0466972_0005552_5422_5781 119
69 3300044683 Ga0466965_0013493 Ga0466965_0013493_3286_3645 119
70 3300044684 Ga0466966_0029784 Ga0466966_0029784_161_520 119
71 3300044693 Ga0466961_0034201 Ga0466961_0034201_1301_1660 119
72 3300044694 Ga0466963_0049226 Ga0466963_0049226_2166_2525 119
73 3300045049 Ga0466959_0032290 Ga0466959_0032290_882_1241 119
74 3300049581 Ga0501047_0029451 Ga0501047_0029451_1545_1904 119
75 3300049822 Ga0501035_0116655 Ga0501035_0116655_1740_2099 119
76 3300049823 Ga0501044_0001700 Ga0501044_0001700_4570_4929 119
77 3300049823 Ga0501044_0807877 Ga0501044_0807877_202_561 119
78 3300053149 Ga0500600_0002542 Ga0500600_0002542_9206_9565 119
79 3300061719 Ga0466962_0063065 Ga0466962_0063065_251_610 119
80 3300026041 Ga0207639_11344134 Ga0207639_113441342 120
81 3300028379 Ga0268266_10392286 Ga0268266_103922861 120
82 3300049570 Ga0501033_0033498 Ga0501033_0033498_2866_3231 120
83 3300001979 JGI24740J21852_10031580 JGI24740J21852_100315801 121
84 3300003214 JGI25165J46597_1000003 JGI25165J46597_10000031 121
85 3300003215 JGI25153J46596_10000466 JGI25153J46596_100004668 121
86 3300005327 Ga0070658_10006762 Ga0070658_100067629 121
87 3300005327 Ga0070658_10027665 Ga0070658_100276658 121
88 3300005327 Ga0070658_10064135 Ga0070658_100641357 121
89 3300005327 Ga0070658_10153901 Ga0070658_101539015 121
90 3300005327 Ga0070658_10771702 Ga0070658_107717022 121
91 3300005327 Ga0070658_11573163 Ga0070658_115731631 121
92 3300005328 Ga0070676_10036937 Ga0070676_100369374 121
93 3300005328 Ga0070676_10426680 Ga0070676_104266802 121
94 3300005329 Ga0070683_100089181 Ga0070683_1000891814 121
95 3300005331 Ga0070670_100631867 Ga0070670_1006318672 121
96 3300005334 Ga0068869_100031662 Ga0068869_1000316622 121
97 3300005334 Ga0068869_100051960 Ga0068869_1000519603 121
98 3300005334 Ga0068869_100605648 Ga0068869_1006056482 121
99 3300005335 Ga0070666_10012585 Ga0070666_100125855 121
100 3300005335 Ga0070666_10122423 Ga0070666_101224233 121
101 3300005338 Ga0068868_100062032 Ga0068868_1000620323 121
102 3300005338 Ga0068868_100169734 Ga0068868_1001697344 121
103 3300005338 Ga0068868_100611535 Ga0068868_1006115352 121
104 3300005338 Ga0068868_101558809 Ga0068868_1015588092 121
105 3300005338 Ga0068868_101580075 Ga0068868_1015800751 121
106 3300005339 Ga0070660_100025903 Ga0070660_1000259032 121
107 3300005339 Ga0070660_100265338 Ga0070660_1002653382 121
108 3300005340 Ga0070689_100425155 Ga0070689_1004251552 121
109 3300005341 Ga0070691_10239573 Ga0070691_102395732 121
110 3300005344 Ga0070661_100356565 Ga0070661_1003565652 121
111 3300005344 Ga0070661_100724066 Ga0070661_1007240662 121
112 3300005347 Ga0070668_100555709 Ga0070668_1005557092 121
113 3300005347 Ga0070668_101440033 Ga0070668_1014400331 121
114 3300005353 Ga0070669_100831247 Ga0070669_1008312472 121
115 3300005354 Ga0070675_100833052 Ga0070675_1008330521 121
116 3300005354 Ga0070675_101429804 Ga0070675_1014298041 121
117 3300005354 Ga0070675_102025577 Ga0070675_1020255771 121
118 3300005355 Ga0070671_100112922 Ga0070671_1001129221 121
119 3300005355 Ga0070671_100119966 Ga0070671_1001199665 121
120 3300005355 Ga0070671_100644702 Ga0070671_1006447022 121
121 3300005355 Ga0070671_100838247 Ga0070671_1008382471 121
122 3300005355 Ga0070671_101251801 Ga0070671_1012518011 121
123 3300005356 Ga0070674_100339651 Ga0070674_1003396512 121
124 3300005356 Ga0070674_100384288 Ga0070674_1003842882 121
125 3300005356 Ga0070674_100736085 Ga0070674_1007360851 121
126 3300005364 Ga0070673_100014920 Ga0070673_1000149209 121
127 3300005364 Ga0070673_100152263 Ga0070673_1001522632 121
128 3300005364 Ga0070673_100545769 Ga0070673_1005457691 121
129 3300005364 Ga0070673_100727339 Ga0070673_1007273392 121
130 3300005366 Ga0070659_100019822 Ga0070659_1000198227 121
131 3300005367 Ga0070667_100548381 Ga0070667_1005483812 121
132 3300005435 Ga0070714_100557379 Ga0070714_1005573792 121
133 3300005435 Ga0070714_101584568 Ga0070714_1015845682 121
134 3300005436 Ga0070713_100598101 Ga0070713_1005981012 121
135 3300005437 Ga0070710_11545418 Ga0070710_115454181 121
136 3300005438 Ga0070701_10930445 Ga0070701_109304452 121
137 3300005439 Ga0070711_100458579 Ga0070711_1004585793 121
138 3300005441 Ga0070700_101443544 Ga0070700_1014435441 121
139 3300005444 Ga0070694_101230478 Ga0070694_1012304781 121
140 3300005456 Ga0070678_100008807 Ga0070678_1000088073 121
141 3300005456 Ga0070678_100027342 Ga0070678_1000273425 121
142 3300005456 Ga0070678_100146986 Ga0070678_1001469862 121
143 3300005456 Ga0070678_100396678 Ga0070678_1003966782 121
144 3300005456 Ga0070678_100450097 Ga0070678_1004500972 121
145 3300005457 Ga0070662_100613439 Ga0070662_1006134392 121
146 3300005458 Ga0070681_10113225 Ga0070681_101132254 121
147 3300005458 Ga0070681_10225086 Ga0070681_102250863 121
148 3300005458 Ga0070681_10258469 Ga0070681_102584692 121
149 3300005459 Ga0068867_100185526 Ga0068867_1001855263 121
150 3300005459 Ga0068867_100411179 Ga0068867_1004111792 121
151 3300005459 Ga0068867_100663055 Ga0068867_1006630551 121
152 3300005466 Ga0070685_10130177 Ga0070685_101301771 121
153 3300005466 Ga0070685_10473299 Ga0070685_104732992 121
154 3300005467 Ga0070706_100570149 Ga0070706_1005701491 121
155 3300005530 Ga0070679_100385320 Ga0070679_1003853202 121
156 3300005530 Ga0070679_101107194 Ga0070679_1011071941 121
157 3300005535 Ga0070684_100063794 Ga0070684_1000637941 121
158 3300005539 Ga0068853_100609167 Ga0068853_1006091672 121
159 3300005539 Ga0068853_100774801 Ga0068853_1007748012 121
160 3300005539 Ga0068853_100803930 Ga0068853_1008039302 121
161 3300005543 Ga0070672_100739438 Ga0070672_1007394381 121
162 3300005545 Ga0070695_100067425 Ga0070695_1000674252 121
163 3300005546 Ga0070696_100012732 Ga0070696_1000127322 121
164 3300005546 Ga0070696_100066678 Ga0070696_1000666782 121
165 3300005547 Ga0070693_100326366 Ga0070693_1003263662 121
166 3300005548 Ga0070665_100000377 Ga0070665_10000037713 121
167 3300005548 Ga0070665_100031419 Ga0070665_1000314194 121
168 3300005548 Ga0070665_100561842 Ga0070665_1005618423 121
169 3300005548 Ga0070665_100939019 Ga0070665_1009390192 121
170 3300005549 Ga0070704_100034903 Ga0070704_1000349035 121
171 3300005563 Ga0068855_100139889 Ga0068855_1001398894 121
172 3300005563 Ga0068855_100229654 Ga0068855_1002296542 121
173 3300005563 Ga0068855_100870162 Ga0068855_1008701622 121
174 3300005563 Ga0068855_100930950 Ga0068855_1009309502 121
175 3300005564 Ga0070664_100255968 Ga0070664_1002559683 121
176 3300005577 Ga0068857_100197011 Ga0068857_1001970112 121
177 3300005577 Ga0068857_100320837 Ga0068857_1003208373 121
178 3300005577 Ga0068857_100880813 Ga0068857_1008808131 121
179 3300005578 Ga0068854_100317130 Ga0068854_1003171302 121
180 3300005578 Ga0068854_100631331 Ga0068854_1006313312 121
181 3300005578 Ga0068854_101308650 Ga0068854_1013086502 121
182 3300005614 Ga0068856_100285398 Ga0068856_1002853983 121
183 3300005614 Ga0068856_100358190 Ga0068856_1003581902 121
184 3300005615 Ga0070702_100399023 Ga0070702_1003990232 121
185 3300005615 Ga0070702_100402483 Ga0070702_1004024831 121
186 3300005615 Ga0070702_100871093 Ga0070702_1008710931 121
187 3300005616 Ga0068852_100198042 Ga0068852_1001980422 121
188 3300005616 Ga0068852_100755757 Ga0068852_1007557572 121
189 3300005617 Ga0068859_100241259 Ga0068859_1002412593 121
190 3300005618 Ga0068864_100219031 Ga0068864_1002190312 121
191 3300005718 Ga0068866_10154976 Ga0068866_101549763 121
192 3300005718 Ga0068866_10274005 Ga0068866_102740052 121
193 3300005719 Ga0068861_101108744 Ga0068861_1011087441 121
194 3300005719 Ga0068861_101402057 Ga0068861_1014020571 121
195 3300005840 Ga0068870_10328909 Ga0068870_103289092 121
196 3300005841 Ga0068863_100050041 Ga0068863_1000500414 121
197 3300005841 Ga0068863_101807961 Ga0068863_1018079612 121
198 3300005842 Ga0068858_100057444 Ga0068858_1000574442 121
199 3300005843 Ga0068860_100294865 Ga0068860_1002948653 121
200 3300005843 Ga0068860_100617451 Ga0068860_1006174512 121
201 3300005843 Ga0068860_100846710 Ga0068860_1008467101 121
202 3300005843 Ga0068860_101680740 Ga0068860_1016807402 121
203 3300005844 Ga0068862_100200824 Ga0068862_1002008242 121
204 3300005844 Ga0068862_101295600 Ga0068862_1012956001 121
205 3300005983 Ga0081540_1000205 Ga0081540_100020526 121
206 3300006175 Ga0070712_100062640 Ga0070712_1000626403 121
207 3300006178 Ga0075367_10116750 Ga0075367_101167502 121
208 3300006178 Ga0075367_10134580 Ga0075367_101345801 121
209 3300006237 Ga0097621_100009066 Ga0097621_1000090664 121
210 3300006237 Ga0097621_100062488 Ga0097621_1000624883 121
211 3300006237 Ga0097621_100072773 Ga0097621_1000727733 121
212 3300006237 Ga0097621_100091216 Ga0097621_1000912161 121
213 3300006237 Ga0097621_100170206 Ga0097621_1001702061 121
214 3300006237 Ga0097621_100295270 Ga0097621_1002952702 121
215 3300006237 Ga0097621_100562573 Ga0097621_1005625731 121
216 3300006237 Ga0097621_100762088 Ga0097621_1007620882 121
217 3300006237 Ga0097621_102208653 Ga0097621_1022086532 121
218 3300006358 Ga0068871_100003001 Ga0068871_1000030011 121
219 3300006358 Ga0068871_100041132 Ga0068871_1000411323 121
220 3300006358 Ga0068871_100049228 Ga0068871_1000492285 121
221 3300006358 Ga0068871_100056443 Ga0068871_1000564434 121
222 3300006358 Ga0068871_100113445 Ga0068871_1001134454 121
223 3300006358 Ga0068871_100140742 Ga0068871_1001407422 121
224 3300006358 Ga0068871_100151086 Ga0068871_1001510864 121
225 3300006358 Ga0068871_100666783 Ga0068871_1006667831 121
226 3300006881 Ga0068865_100005270 Ga0068865_1000052709 121
227 3300006881 Ga0068865_100099769 Ga0068865_1000997693 121
228 3300006881 Ga0068865_100232949 Ga0068865_1002329491 121
229 3300006931 Ga0097620_100241269 Ga0097620_1002412693 121
230 3300009093 Ga0105240_10042137 Ga0105240_100421376 121
231 3300009093 Ga0105240_10467879 Ga0105240_104678793 121
232 3300009093 Ga0105240_10583969 Ga0105240_105839692 121
233 3300009093 Ga0105240_10690502 Ga0105240_106905022 121
234 3300009093 Ga0105240_10813144 Ga0105240_108131442 121
235 3300009098 Ga0105245_10563910 Ga0105245_105639102 121
236 3300009098 Ga0105245_11035888 Ga0105245_110358882 121
237 3300009098 Ga0105245_11811942 Ga0105245_118119422 121
238 3300009101 Ga0105247_11161610 Ga0105247_111616102 121
239 3300009148 Ga0105243_10009445 Ga0105243_1000944510 121
240 3300009148 Ga0105243_10139405 Ga0105243_101394053 121
241 3300009148 Ga0105243_10564307 Ga0105243_105643071 121
242 3300009148 Ga0105243_11831897 Ga0105243_118318972 121
243 3300009148 Ga0105243_12104632 Ga0105243_121046321 121
244 3300009174 Ga0105241_10090260 Ga0105241_100902604 121
245 3300009174 Ga0105241_10621210 Ga0105241_106212102 121
246 3300009174 Ga0105241_10786911 Ga0105241_107869111 121
247 3300009174 Ga0105241_12159981 Ga0105241_121599811 121
248 3300009176 Ga0105242_10007194 Ga0105242_1000719412 121
249 3300009176 Ga0105242_10008474 Ga0105242_100084748 121
250 3300009176 Ga0105242_10155999 Ga0105242_101559992 121
251 3300009176 Ga0105242_10170667 Ga0105242_101706671 121
252 3300009176 Ga0105242_10825289 Ga0105242_108252892 121
253 3300009176 Ga0105242_11305792 Ga0105242_113057922 121
254 3300009176 Ga0105242_11386908 Ga0105242_113869082 121
255 3300009176 Ga0105242_12250612 Ga0105242_122506121 121
256 3300009177 Ga0105248_10037444 Ga0105248_100374442 121
257 3300009177 Ga0105248_10117451 Ga0105248_101174512 121
258 3300009177 Ga0105248_11534200 Ga0105248_115342002 121
259 3300009545 Ga0105237_10067577 Ga0105237_100675774 121
260 3300009545 Ga0105237_10173036 Ga0105237_101730363 121
261 3300009545 Ga0105237_10243423 Ga0105237_102434232 121
262 3300009545 Ga0105237_10655266 Ga0105237_106552662 121
263 3300009551 Ga0105238_10406100 Ga0105238_104061001 121
264 3300009551 Ga0105238_10594474 Ga0105238_105944742 121
265 3300009551 Ga0105238_11623997 Ga0105238_116239972 121
266 3300009551 Ga0105238_12530499 Ga0105238_125304992 121
267 3300009553 Ga0105249_10009654 Ga0105249_100096548 121
268 3300009553 Ga0105249_10808087 Ga0105249_108080872 121
269 3300009978 Ga0105148_109339 Ga0105148_1093392 121
270 3300009993 Ga0105028_100930 Ga0105028_1009305 121
271 3300010375 Ga0105239_10133642 Ga0105239_101336421 121
272 3300010375 Ga0105239_10333868 Ga0105239_103338682 121
273 3300010375 Ga0105239_10934987 Ga0105239_109349872 121
274 3300010375 Ga0105239_11097277 Ga0105239_110972772 121
275 3300011119 Ga0105246_10026077 Ga0105246_100260777 121
276 3300011119 Ga0105246_10117058 Ga0105246_101170582 121
277 3300011119 Ga0105246_10603178 Ga0105246_106031781 121
278 3300013100 Ga0157373_10348522 Ga0157373_103485223 121
279 3300013100 Ga0157373_10640363 Ga0157373_106403632 121
280 3300013100 Ga0157373_10725236 Ga0157373_107252361 121
281 3300013104 Ga0157370_10044464 Ga0157370_100444645 121
282 3300013104 Ga0157370_10376156 Ga0157370_103761561 121
283 3300013105 Ga0157369_10202414 Ga0157369_102024142 121
284 3300013105 Ga0157369_10216271 Ga0157369_102162713 121
285 3300013296 Ga0157374_10154379 Ga0157374_101543794 121
286 3300013296 Ga0157374_10599568 Ga0157374_105995682 121
287 3300013296 Ga0157374_10721804 Ga0157374_107218041 121
288 3300013297 Ga0157378_10027149 Ga0157378_100271494 121
289 3300013297 Ga0157378_10191007 Ga0157378_101910074 121
290 3300013297 Ga0157378_10399326 Ga0157378_103993263 121
291 3300013297 Ga0157378_10482734 Ga0157378_104827343 121
292 3300013297 Ga0157378_10532737 Ga0157378_105327372 121
293 3300013297 Ga0157378_10772059 Ga0157378_107720592 121
294 3300013297 Ga0157378_11446277 Ga0157378_114462771 121
295 3300013306 Ga0163162_10037679 Ga0163162_100376797 121
296 3300013306 Ga0163162_10502992 Ga0163162_105029922 121
297 3300013306 Ga0163162_11116554 Ga0163162_111165542 121
298 3300013306 Ga0163162_11338825 Ga0163162_113388252 121
299 3300013306 Ga0163162_12372709 Ga0163162_123727091 121
300 3300013307 Ga0157372_10126860 Ga0157372_101268602 121
301 3300013307 Ga0157372_12087128 Ga0157372_120871282 121
302 3300013308 Ga0157375_10720366 Ga0157375_107203663 121
303 3300013308 Ga0157375_11155580 Ga0157375_111555801 121
304 3300013308 Ga0157375_11941443 Ga0157375_119414432 121
305 3300013308 Ga0157375_11972143 Ga0157375_119721432 121
306 3300014325 Ga0163163_10000491 Ga0163163_1000049111 121
307 3300014325 Ga0163163_10548764 Ga0163163_105487641 121
308 3300014325 Ga0163163_12894005 Ga0163163_128940051 121
309 3300014326 Ga0157380_11421511 Ga0157380_114215112 121
310 3300014745 Ga0157377_10540259 Ga0157377_105402592 121
311 3300014968 Ga0157379_10037573 Ga0157379_100375736 121
312 3300014968 Ga0157379_10062631 Ga0157379_100626318 121
313 3300014968 Ga0157379_10078369 Ga0157379_100783693 121
314 3300014969 Ga0157376_10014841 Ga0157376_100148417 121
315 3300014969 Ga0157376_10371772 Ga0157376_103717723 121
316 3300014969 Ga0157376_10519062 Ga0157376_105190622 121
317 3300017792 Ga0163161_10645300 Ga0163161_106453002 121
318 3300021377 Ga0213874_10010862 Ga0213874_100108623 121
319 3300021377 Ga0213874_10018562 Ga0213874_100185623 121
320 3300021441 Ga0213871_10216264 Ga0213871_102162641 121
321 3300025230 Ga0209563_118080 Ga0209563_1180802 121
322 3300025231 Ga0207427_104324 Ga0207427_1043246 121
323 3300025261 Ga0209233_1000015 Ga0209233_1000015778 121
324 3300025272 Ga0209455_1013367 Ga0209455_10133673 121
325 3300025297 Ga0209758_1000013 Ga0209758_1000013342 121
326 3300025899 Ga0207642_10217920 Ga0207642_102179202 121
327 3300025899 Ga0207642_10292620 Ga0207642_102926202 121
328 3300025899 Ga0207642_10304755 Ga0207642_103047552 121
329 3300025900 Ga0207710_10201397 Ga0207710_102013971 121
330 3300025907 Ga0207645_10003004 Ga0207645_100030043 121
331 3300025907 Ga0207645_10119125 Ga0207645_101191252 121
332 3300025908 Ga0207643_10090745 Ga0207643_100907451 121
333 3300025908 Ga0207643_10331058 Ga0207643_103310582 121
334 3300025908 Ga0207643_10607876 Ga0207643_106078761 121
335 3300025909 Ga0207705_10020579 Ga0207705_100205792 121
336 3300025909 Ga0207705_10098319 Ga0207705_100983194 121
337 3300025909 Ga0207705_10413766 Ga0207705_104137662 121
338 3300025909 Ga0207705_10573863 Ga0207705_105738632 121
339 3300025909 Ga0207705_10686248 Ga0207705_106862481 121
340 3300025910 Ga0207684_10796322 Ga0207684_107963221 121
341 3300025911 Ga0207654_10048312 Ga0207654_100483124 121
342 3300025911 Ga0207654_10592483 Ga0207654_105924832 121
343 3300025911 Ga0207654_10595488 Ga0207654_105954881 121
344 3300025911 Ga0207654_10719908 Ga0207654_107199082 121
345 3300025912 Ga0207707_10248987 Ga0207707_102489872 121
346 3300025912 Ga0207707_10519529 Ga0207707_105195291 121
347 3300025912 Ga0207707_10548205 Ga0207707_105482052 121
348 3300025913 Ga0207695_10538508 Ga0207695_105385082 121
349 3300025913 Ga0207695_10841025 Ga0207695_108410252 121
350 3300025913 Ga0207695_10874433 Ga0207695_108744331 121
351 3300025914 Ga0207671_10214680 Ga0207671_102146802 121
352 3300025915 Ga0207693_10425375 Ga0207693_104253752 121
353 3300025915 Ga0207693_11164100 Ga0207693_111641001 121
354 3300025916 Ga0207663_11471634 Ga0207663_114716341 121
355 3300025917 Ga0207660_10413469 Ga0207660_104134692 121
356 3300025917 Ga0207660_10808507 Ga0207660_108085071 121
357 3300025918 Ga0207662_10616523 Ga0207662_106165231 121
358 3300025919 Ga0207657_10042479 Ga0207657_100424794 121
359 3300025919 Ga0207657_10124492 Ga0207657_101244923 121
360 3300025919 Ga0207657_10272755 Ga0207657_102727553 121
361 3300025919 Ga0207657_10486208 Ga0207657_104862081 121
362 3300025920 Ga0207649_11073600 Ga0207649_110736002 121
363 3300025921 Ga0207652_10201022 Ga0207652_102010221 121
364 3300025921 Ga0207652_10253755 Ga0207652_102537552 121
365 3300025923 Ga0207681_11109693 Ga0207681_111096931 121
366 3300025924 Ga0207694_10163831 Ga0207694_101638312 121
367 3300025924 Ga0207694_10174938 Ga0207694_101749382 121
368 3300025924 Ga0207694_10175068 Ga0207694_101750683 121
369 3300025924 Ga0207694_10178854 Ga0207694_101788543 121
370 3300025924 Ga0207694_10419033 Ga0207694_104190331 121
371 3300025925 Ga0207650_10308105 Ga0207650_103081052 121
372 3300025925 Ga0207650_10476343 Ga0207650_104763432 121
373 3300025925 Ga0207650_10560029 Ga0207650_105600292 121
374 3300025926 Ga0207659_11119211 Ga0207659_111192111 121
375 3300025927 Ga0207687_10672471 Ga0207687_106724712 121
376 3300025927 Ga0207687_10815368 Ga0207687_108153681 121
377 3300025931 Ga0207644_10210438 Ga0207644_102104381 121
378 3300025931 Ga0207644_10276952 Ga0207644_102769522 121
379 3300025931 Ga0207644_11107522 Ga0207644_111075222 121
380 3300025931 Ga0207644_11220708 Ga0207644_112207081 121
381 3300025932 Ga0207690_10340979 Ga0207690_103409793 121
382 3300025932 Ga0207690_10380054 Ga0207690_103800542 121
383 3300025932 Ga0207690_10725611 Ga0207690_107256111 121
384 3300025934 Ga0207686_10022782 Ga0207686_100227825 121
385 3300025934 Ga0207686_10147789 Ga0207686_101477893 121
386 3300025934 Ga0207686_10466369 Ga0207686_104663692 121
387 3300025935 Ga0207709_10035973 Ga0207709_100359734 121
388 3300025935 Ga0207709_10136610 Ga0207709_101366102 121
389 3300025936 Ga0207670_10288462 Ga0207670_102884622 121
390 3300025937 Ga0207669_10412133 Ga0207669_104121332 121
391 3300025937 Ga0207669_10747290 Ga0207669_107472902 121
392 3300025938 Ga0207704_10019753 Ga0207704_100197536 121
393 3300025938 Ga0207704_10064811 Ga0207704_100648111 121
394 3300025938 Ga0207704_10158813 Ga0207704_101588133 121
395 3300025938 Ga0207704_10822407 Ga0207704_108224071 121
396 3300025940 Ga0207691_10126233 Ga0207691_101262331 121
397 3300025941 Ga0207711_10019519 Ga0207711_100195192 121
398 3300025942 Ga0207689_10024757 Ga0207689_100247575 121
399 3300025942 Ga0207689_10077600 Ga0207689_100776004 121
400 3300025942 Ga0207689_10195184 Ga0207689_101951842 121
401 3300025942 Ga0207689_10294490 Ga0207689_102944902 121
402 3300025942 Ga0207689_10801200 Ga0207689_108012002 121
403 3300025944 Ga0207661_10481164 Ga0207661_104811643 121
404 3300025945 Ga0207679_10914844 Ga0207679_109148441 121
405 3300025949 Ga0207667_10246640 Ga0207667_102466403 121
406 3300025949 Ga0207667_10441256 Ga0207667_104412562 121
407 3300025949 Ga0207667_10626635 Ga0207667_106266351 121
408 3300025949 Ga0207667_10816911 Ga0207667_108169112 121
409 3300025949 Ga0207667_11270137 Ga0207667_112701371 121
410 3300025960 Ga0207651_10540750 Ga0207651_105407502 121
411 3300025960 Ga0207651_11947679 Ga0207651_119476792 121
412 3300025961 Ga0207712_10048552 Ga0207712_100485521 121
413 3300025961 Ga0207712_10348833 Ga0207712_103488333 121
414 3300025972 Ga0207668_10702134 Ga0207668_107021341 121
415 3300025981 Ga0207640_10261887 Ga0207640_102618872 121
416 3300025981 Ga0207640_10732565 Ga0207640_107325651 121
417 3300025981 Ga0207640_10995687 Ga0207640_109956871 121
418 3300025986 Ga0207658_10340416 Ga0207658_103404162 121
419 3300026023 Ga0207677_10886672 Ga0207677_108866721 121
420 3300026023 Ga0207677_11964559 Ga0207677_119645591 121
421 3300026035 Ga0207703_10090432 Ga0207703_100904322 121
422 3300026041 Ga0207639_10383353 Ga0207639_103833532 121
423 3300026041 Ga0207639_10667485 Ga0207639_106674852 121
424 3300026067 Ga0207678_10636500 Ga0207678_106365002 121
425 3300026067 Ga0207678_10677124 Ga0207678_106771242 121
426 3300026078 Ga0207702_10267177 Ga0207702_102671772 121
427 3300026078 Ga0207702_10400325 Ga0207702_104003252 121
428 3300026078 Ga0207702_10850731 Ga0207702_108507312 121
429 3300026078 Ga0207702_11158794 Ga0207702_111587941 121
430 3300026088 Ga0207641_10031995 Ga0207641_100319953 121
431 3300026088 Ga0207641_11090129 Ga0207641_110901292 121
432 3300026089 Ga0207648_10034161 Ga0207648_100341613 121
433 3300026089 Ga0207648_10034253 Ga0207648_100342534 121
434 3300026089 Ga0207648_10906949 Ga0207648_109069491 121
435 3300026089 Ga0207648_11053719 Ga0207648_110537191 121
436 3300026095 Ga0207676_11682612 Ga0207676_116826121 121
437 3300026095 Ga0207676_11885917 Ga0207676_118859172 121
438 3300026116 Ga0207674_10117367 Ga0207674_101173674 121
439 3300026116 Ga0207674_10462892 Ga0207674_104628922 121
440 3300026116 Ga0207674_10846167 Ga0207674_108461672 121
441 3300026116 Ga0207674_11144211 Ga0207674_111442111 121
442 3300026118 Ga0207675_101179940 Ga0207675_1011799401 121
443 3300026118 Ga0207675_102065079 Ga0207675_1020650791 121
444 3300026121 Ga0207683_10026414 Ga0207683_100264145 121
445 3300026121 Ga0207683_10030002 Ga0207683_100300023 121
446 3300026121 Ga0207683_10162911 Ga0207683_101629113 121
447 3300026121 Ga0207683_10576933 Ga0207683_105769332 121
448 3300026121 Ga0207683_10779530 Ga0207683_107795301 121
449 3300026121 Ga0207683_11039319 Ga0207683_110393191 121
450 3300026142 Ga0207698_10229526 Ga0207698_102295262 121
451 3300026142 Ga0207698_11922732 Ga0207698_119227322 121
452 3300028379 Ga0268266_10685065 Ga0268266_106850651 121
453 3300028380 Ga0268265_10638737 Ga0268265_106387372 121
454 3300028380 Ga0268265_11072674 Ga0268265_110726741 121
455 3300028381 Ga0268264_10876763 Ga0268264_108767632 121
456 3300028577 Ga0265318_10001257 Ga0265318_1000125715 121
457 3300028800 Ga0265338_10486327 Ga0265338_104863272 121
458 3300028800 Ga0265338_10715930 Ga0265338_107159301 121
459 3300029957 Ga0265324_10001784 Ga0265324_100017841 121
460 3300029957 Ga0265324_10254405 Ga0265324_102544051 121
461 3300031235 Ga0265330_10053979 Ga0265330_100539793 121
462 3300031235 Ga0265330_10165280 Ga0265330_101652801 121
463 3300031235 Ga0265330_10362549 Ga0265330_103625491 121
464 3300031238 Ga0265332_10007275 Ga0265332_100072756 121
465 3300031238 Ga0265332_10176988 Ga0265332_101769882 121
466 3300031239 Ga0265328_10103375 Ga0265328_101033751 121
467 3300031239 Ga0265328_10195220 Ga0265328_101952202 121
468 3300031241 Ga0265325_10002319 Ga0265325_100023193 121
469 3300031241 Ga0265325_10039093 Ga0265325_100390934 121
470 3300031241 Ga0265325_10107400 Ga0265325_101074003 121
471 3300031242 Ga0265329_10073585 Ga0265329_100735853 121
472 3300031247 Ga0265340_10179016 Ga0265340_101790162 121
473 3300031249 Ga0265339_10005265 Ga0265339_1000526512 121
474 3300031249 Ga0265339_10049879 Ga0265339_100498793 121
475 3300031249 Ga0265339_10085331 Ga0265339_100853312 121
476 3300031250 Ga0265331_10000066 Ga0265331_1000006672 121
477 3300031250 Ga0265331_10135656 Ga0265331_101356562 121
478 3300031250 Ga0265331_10210177 Ga0265331_102101771 121
479 3300031344 Ga0265316_10056849 Ga0265316_100568493 121
480 3300031344 Ga0265316_10399001 Ga0265316_103990012 121
481 3300031344 Ga0265316_10414262 Ga0265316_104142622 121
482 3300031344 Ga0265316_10844982 Ga0265316_108449821 121
483 3300031456 Ga0307513_11012325 Ga0307513_110123251 121
484 3300031507 Ga0307509_10664965 Ga0307509_106649651 121
485 3300031595 Ga0265313_10003662 Ga0265313_1000366213 121
486 3300031595 Ga0265313_10008701 Ga0265313_100087018 121
487 3300031595 Ga0265313_10017912 Ga0265313_100179125 121
488 3300031711 Ga0265314_10000125 Ga0265314_1000012513 121
489 3300031711 Ga0265314_10015417 Ga0265314_100154178 121
490 3300031711 Ga0265314_10063862 Ga0265314_100638624 121
491 3300031711 Ga0265314_10101807 Ga0265314_101018072 121
492 3300031711 Ga0265314_10468408 Ga0265314_104684082 121
493 3300031712 Ga0265342_10142787 Ga0265342_101427873 121
494 3300031712 Ga0265342_10257693 Ga0265342_102576932 121
495 3300031712 Ga0265342_10309157 Ga0265342_103091571 121
496 3300031730 Ga0307516_10063104 Ga0307516_100631042 121
497 3300031731 Ga0307405_11200022 Ga0307405_112000222 121
498 3300031901 Ga0307406_10562495 Ga0307406_105624951 121
499 3300031995 Ga0307409_102474495 Ga0307409_1024744951 121
500 3300032002 Ga0307416_100751936 Ga0307416_1007519363 121
501 3300032005 Ga0307411_10248580 Ga0307411_102485802 121
502 3300032168 Ga0316593_10032416 Ga0316593_100324161 121
503 3300033180 Ga0307510_10247674 Ga0307510_102476742 121
504 3300033180 Ga0307510_10268418 Ga0307510_102684181 121
505 3300035114 Ga0373939_0176091 Ga0373939_0176091_33_398 121
506 3300035117 Ga0373953_0349090 Ga0373953_0349090_98_463 121
507 3300035172 Ga0373955_0275466 Ga0373955_0275466_76_441 121
508 3300035691 Ga0373931_0581748 Ga0373931_0581748_24_395 121
509 3300035724 Ga0373933_0851632 Ga0373933_0851632_31_396 121
510 3300036401 Ga0373937_0067460 Ga0373937_0067460_311_676 121
511 3300036401 Ga0373937_0145830 Ga0373937_0145830_1435_1800 121
512 3300036647 Ga0316582_0040931 Ga0316582_0040931_2465_2830 121
513 3300036712 Ga0316584_0123400 Ga0316584_0123400_370_735 121
514 3300037312 Ga0395899_0380977 Ga0395899_0380977_163_528 121
515 3300037418 Ga0395900_0040247 Ga0395900_0040247_4051_4416 121
516 3300037471 Ga0395905_1520550 Ga0395905_1520550_198_563 121
517 3300037471 Ga0395905_1887499 Ga0395905_1887499_88_453 121
518 3300038443 Ga0395901_1043192 Ga0395901_1043192_264_629 121
519 3300039438 Ga0436360_0181532 Ga0436360_0181532_353_718 121
520 3300039438 Ga0436360_0464388 Ga0436360_0464388_233_610 121
521 3300039438 Ga0436360_1308938 Ga0436360_1308938_129_494 121
522 3300039447 Ga0436361_1147293 Ga0436361_1147293_63_428 121
523 3300039450 Ga0436363_0072239 Ga0436363_0072239_410_775 121
524 3300039450 Ga0436363_0370956 Ga0436363_0370956_3397_3762 121
525 3300039450 Ga0436363_1576522 Ga0436363_1576522_178_543 121
526 3300039453 Ga0436362_0226131 Ga0436362_0226131_37_402 121
527 3300039453 Ga0436362_0755406 Ga0436362_0755406_118_483 121
528 3300041413 Ga0439465_0260153 Ga0439465_0260153_184_549 121
529 3300041443 Ga0451789_0426280 Ga0451789_0426280_36_401 121
530 3300041452 Ga0451793_1912129 Ga0451793_1912129_485_859 121
531 3300041512 Ga0451853_2188647 Ga0451853_2188647_187_567 121
532 3300044694 Ga0466963_0339405 Ga0466963_0339405_446_823 121
533 3300044706 Ga0466964_0356825 Ga0466964_0356825_191_568 121
534 3300044712 Ga0453684_0010839 Ga0453684_0010839_12507_12875 121
535 3300044712 Ga0453684_1862699 Ga0453684_1862699_43_414 121
536 3300045976 Ga0466967_0552571 Ga0466967_0552571_399_776 121
537 3300046491 Ga0495584_0429651 Ga0495584_0429651_51_416 121
538 3300046506 Ga0495583_0381251 Ga0495583_0381251_151_525 121
539 3300046507 Ga0495606_0376267 Ga0495606_0376267_369_734 121
540 3300046524 Ga0495648_0404954 Ga0495648_0404954_199_573 121
541 3300046529 Ga0495652_0650608 Ga0495652_0650608_12_377 121
542 3300046529 Ga0495652_0758145 Ga0495652_0758145_249_614 121
543 3300046536 Ga0495587_0141879 Ga0495587_0141879_302_667 121
544 3300046536 Ga0495587_0826541 Ga0495587_0826541_62_436 121
545 3300046537 Ga0495598_0260408 Ga0495598_0260408_260_634 121
546 3300046538 Ga0495609_0061548 Ga0495609_0061548_78_458 121
547 3300046539 Ga0495621_0183290 Ga0495621_0183290_430_795 121
548 3300046543 Ga0495645_0529773 Ga0495645_0529773_143_508 121
549 3300046557 Ga0495622_0002413 Ga0495622_0002413_5024_5398 121
550 3300046660 Ga0495625_0117728 Ga0495625_0117728_1132_1497 121
551 3300046675 Ga0495657_0643311 Ga0495657_0643311_68_433 121
552 3300046678 Ga0495599_0422479 Ga0495599_0422479_169_576 121
553 3300046679 Ga0495623_0298600 Ga0495623_0298600_365_772 121
554 3300046683 Ga0495658_0384503 Ga0495658_0384503_338_712 121
555 3300046684 Ga0495669_0305792 Ga0495669_0305792_19_384 121
556 3300046684 Ga0495669_0436480 Ga0495669_0436480_20_385 121
557 3300046690 Ga0495624_0572118 Ga0495624_0572118_199_573 121
558 3300046692 Ga0495671_0410750 Ga0495671_0410750_258_629 121
559 3300046694 Ga0495649_0205481 Ga0495649_0205481_261_635 121
560 3300046794 Ga0495589_0471785 Ga0495589_0471785_147_512 121
561 3300046809 Ga0495600_0393921 Ga0495600_0393921_476_841 121
562 3300047319 Ga0495674_0072391 Ga0495674_0072391_1518_1925 121
563 3300047444 Ga0495675_0427202 Ga0495675_0427202_198_563 121
564 3300047470 Ga0495681_0328824 Ga0495681_0328824_183_548 121
565 3300047472 Ga0495686_0199304 Ga0495686_0199304_100_531 121
566 3300048903 Ga0496100_0393869 Ga0496100_0393869_666_1031 121
567 3300048904 Ga0496101_0528839 Ga0496101_0528839_312_677 121
568 3300048904 Ga0496101_0620582 Ga0496101_0620582_233_598 121
569 3300048907 Ga0496104_0159085 Ga0496104_0159085_1633_1998 121
570 3300048907 Ga0496104_0258418 Ga0496104_0258418_673_1038 121
571 3300048909 Ga0496106_0251736 Ga0496106_0251736_896_1261 121
572 3300048909 Ga0496106_1066746 Ga0496106_1066746_232_597 121
573 3300048910 Ga0496107_0841040 Ga0496107_0841040_241_615 121
574 3300048911 Ga0496108_1113509 Ga0496108_1113509_12_377 121
575 3300048912 Ga0496109_0107185 Ga0496109_0107185_1609_1974 121
576 3300048912 Ga0496109_0257522 Ga0496109_0257522_107_472 121
577 3300048913 Ga0496110_0083171 Ga0496110_0083171_634_999 121
578 3300048914 Ga0496111_0166415 Ga0496111_0166415_630_995 121
579 3300048916 Ga0496113_0803199 Ga0496113_0803199_17_382 121
580 3300048918 Ga0496115_0360664 Ga0496115_0360664_363_728 121
581 3300048918 Ga0496115_0397658 Ga0496115_0397658_148_513 121
582 3300048920 Ga0496117_0570678 Ga0496117_0570678_61_426 121
583 3300048929 Ga0496126_0124615 Ga0496126_0124615_1394_1759 121
584 3300048929 Ga0496126_0632921 Ga0496126_0632921_92_457 121
585 3300049568 Ga0501031_0055737 Ga0501031_0055737_275_640 121
586 3300049569 Ga0501032_0028469 Ga0501032_0028469_3252_3617 121
587 3300049569 Ga0501032_0191710 Ga0501032_0191710_382_747 121
588 3300049569 Ga0501032_0673496 Ga0501032_0673496_197_562 121
589 3300049570 Ga0501033_0005971 Ga0501033_0005971_1076_1441 121
590 3300049570 Ga0501033_0098453 Ga0501033_0098453_707_1072 121
591 3300049570 Ga0501033_0099741 Ga0501033_0099741_1624_1989 121
592 3300049570 Ga0501033_0156275 Ga0501033_0156275_439_804 121
593 3300049570 Ga0501033_0194501 Ga0501033_0194501_505_870 121
594 3300049570 Ga0501033_0389886 Ga0501033_0389886_511_885 121
595 3300049570 Ga0501033_0419602 Ga0501033_0419602_406_771 121
596 3300049570 Ga0501033_0486685 Ga0501033_0486685_462_827 121
597 3300049570 Ga0501033_0660730 Ga0501033_0660730_159_530 121
598 3300049570 Ga0501033_1126035 Ga0501033_1126035_12_377 121
599 3300049571 Ga0501034_0000001 Ga0501034_0000001_1741310_1741681 121
600 3300049571 Ga0501034_0007641 Ga0501034_0007641_7989_8354 121
601 3300049571 Ga0501034_0022877 Ga0501034_0022877_3183_3548 121
602 3300049571 Ga0501034_0025819 Ga0501034_0025819_2822_3187 121
603 3300049571 Ga0501034_0065576 Ga0501034_0065576_1780_2145 121
604 3300049571 Ga0501034_0137305 Ga0501034_0137305_1212_1577 121
605 3300049571 Ga0501034_0149015 Ga0501034_0149015_1030_1395 121
606 3300049571 Ga0501034_0197895 Ga0501034_0197895_362_727 121
607 3300049571 Ga0501034_0408115 Ga0501034_0408115_210_575 121
608 3300049571 Ga0501034_0560524 Ga0501034_0560524_376_756 121
609 3300049571 Ga0501034_1331686 Ga0501034_1331686_23_388 121
610 3300049572 Ga0501036_0000599 Ga0501036_0000599_9217_9582 121
611 3300049572 Ga0501036_0011755 Ga0501036_0011755_4767_5132 121
612 3300049572 Ga0501036_0096558 Ga0501036_0096558_1877_2242 121
613 3300049572 Ga0501036_0127636 Ga0501036_0127636_1137_1502 121
614 3300049572 Ga0501036_0474276 Ga0501036_0474276_128_493 121
615 3300049572 Ga0501036_0557681 Ga0501036_0557681_463_828 121
616 3300049572 Ga0501036_1020219 Ga0501036_1020219_185_550 121
617 3300049572 Ga0501036_1028072 Ga0501036_1028072_242_607 121
618 3300049573 Ga0501037_0009260 Ga0501037_0009260_1008_1373 121
619 3300049573 Ga0501037_0306682 Ga0501037_0306682_532_897 121
620 3300049573 Ga0501037_0558818 Ga0501037_0558818_94_468 121
621 3300049574 Ga0501038_0015209 Ga0501038_0015209_1667_2032 121
622 3300049574 Ga0501038_0159627 Ga0501038_0159627_359_724 121
623 3300049574 Ga0501038_0220162 Ga0501038_0220162_793_1158 121
624 3300049574 Ga0501038_1235484 Ga0501038_1235484_156_521 121
625 3300049575 Ga0501039_0000020 Ga0501039_0000020_113839_114210 121
626 3300049575 Ga0501039_0090768 Ga0501039_0090768_251_616 121
627 3300049575 Ga0501039_0217253 Ga0501039_0217253_1093_1458 121
628 3300049575 Ga0501039_0461240 Ga0501039_0461240_104_469 121
629 3300049576 Ga0501040_0517947 Ga0501040_0517947_342_707 121
630 3300049577 Ga0501041_0171467 Ga0501041_0171467_766_1131 121
631 3300049578 Ga0501042_0291156 Ga0501042_0291156_614_979 121
632 3300049578 Ga0501042_0891354 Ga0501042_0891354_244_609 121
633 3300049579 Ga0501043_0040103 Ga0501043_0040103_990_1355 121
634 3300049579 Ga0501043_0277810 Ga0501043_0277810_396_761 121
635 3300049579 Ga0501043_0337953 Ga0501043_0337953_621_986 121
636 3300049579 Ga0501043_0520561 Ga0501043_0520561_498_863 121
637 3300049579 Ga0501043_0825251 Ga0501043_0825251_176_541 121
638 3300049579 Ga0501043_1072902 Ga0501043_1072902_11_385 121
639 3300049580 Ga0501046_0002229 Ga0501046_0002229_1571_1936 121
640 3300049580 Ga0501046_0052222 Ga0501046_0052222_603_968 121
641 3300049580 Ga0501046_0183796 Ga0501046_0183796_421_786 121
642 3300049580 Ga0501046_0187613 Ga0501046_0187613_1151_1516 121
643 3300049580 Ga0501046_0193427 Ga0501046_0193427_244_609 121
644 3300049581 Ga0501047_0000257 Ga0501047_0000257_47503_47868 121
645 3300049581 Ga0501047_0022850 Ga0501047_0022850_4458_4823 121
646 3300049581 Ga0501047_0024473 Ga0501047_0024473_3560_3925 121
647 3300049581 Ga0501047_0106894 Ga0501047_0106894_1900_2265 121
648 3300049581 Ga0501047_0132561 Ga0501047_0132561_393_767 121
649 3300049581 Ga0501047_0255560 Ga0501047_0255560_627_992 121
650 3300049581 Ga0501047_0310146 Ga0501047_0310146_853_1218 121
651 3300049581 Ga0501047_0372572 Ga0501047_0372572_700_1065 121
652 3300049581 Ga0501047_0627217 Ga0501047_0627217_66_431 121
653 3300049581 Ga0501047_0828851 Ga0501047_0828851_174_548 121
654 3300049582 Ga0501048_0000588 Ga0501048_0000588_21125_21490 121
655 3300049582 Ga0501048_0003231 Ga0501048_0003231_4650_5015 121
656 3300049582 Ga0501048_0330690 Ga0501048_0330690_668_1033 121
657 3300049584 Ga0501068_0096297 Ga0501068_0096297_288_653 121
658 3300049585 Ga0501069_0026474 Ga0501069_0026474_594_959 121
659 3300049585 Ga0501069_0052122 Ga0501069_0052122_372_737 121
660 3300049586 Ga0501070_0017840 Ga0501070_0017840_1670_2035 121
661 3300049586 Ga0501070_0053047 Ga0501070_0053047_2708_3073 121
662 3300049586 Ga0501070_0156181 Ga0501070_0156181_903_1268 121
663 3300049586 Ga0501070_0620642 Ga0501070_0620642_394_759 121
664 3300049586 Ga0501070_0952393 Ga0501070_0952393_57_422 121
665 3300049587 Ga0501071_1432467 Ga0501071_1432467_40_405 121
666 3300049588 Ga0501072_0538791 Ga0501072_0538791_331_696 121
667 3300049589 Ga0501073_0007903 Ga0501073_0007903_1667_2032 121
668 3300049589 Ga0501073_0174001 Ga0501073_0174001_129_494 121
669 3300049589 Ga0501073_0190178 Ga0501073_0190178_59_424 121
670 3300049589 Ga0501073_0536781 Ga0501073_0536781_360_725 121
671 3300049590 Ga0501074_0006918 Ga0501074_0006918_3173_3538 121
672 3300049590 Ga0501074_0012043 Ga0501074_0012043_3841_4206 121
673 3300049590 Ga0501074_0581738 Ga0501074_0581738_333_698 121
674 3300049592 Ga0501076_1224553 Ga0501076_1224553_35_400 121
675 3300049592 Ga0501076_1714651 Ga0501076_1714651_84_449 121
676 3300049741 Ga0501079_0052216 Ga0501079_0052216_1184_1549 121
677 3300049742 Ga0501080_0000183 Ga0501080_0000183_32881_33246 121
678 3300049742 Ga0501080_0209359 Ga0501080_0209359_913_1278 121
679 3300049742 Ga0501080_0899322 Ga0501080_0899322_364_729 121
680 3300049742 Ga0501080_1605307 Ga0501080_1605307_124_489 121
681 3300049742 Ga0501080_1668884 Ga0501080_1668884_30_395 121
682 3300049744 Ga0501083_0007725 Ga0501083_0007725_4920_5285 121
683 3300049744 Ga0501083_0012732 Ga0501083_0012732_3601_3966 121
684 3300049744 Ga0501083_0076257 Ga0501083_0076257_923_1300 121
685 3300049744 Ga0501083_0100623 Ga0501083_0100623_22_387 121
686 3300049744 Ga0501083_0390055 Ga0501083_0390055_80_445 121
687 3300049744 Ga0501083_0529756 Ga0501083_0529756_272_637 121
688 3300049822 Ga0501035_0013093 Ga0501035_0013093_356_730 121
689 3300049822 Ga0501035_0037027 Ga0501035_0037027_3700_4065 121
690 3300049822 Ga0501035_0059854 Ga0501035_0059854_187_552 121
691 3300049822 Ga0501035_0118870 Ga0501035_0118870_896_1261 121
692 3300049822 Ga0501035_0137265 Ga0501035_0137265_1355_1720 121
693 3300049822 Ga0501035_0245579 Ga0501035_0245579_176_541 121
694 3300049822 Ga0501035_0287046 Ga0501035_0287046_947_1321 121
695 3300049822 Ga0501035_1225882 Ga0501035_1225882_115_480 121
696 3300049823 Ga0501044_0005286 Ga0501044_0005286_13160_13525 121
697 3300049823 Ga0501044_0037841 Ga0501044_0037841_4568_4933 121
698 3300049823 Ga0501044_0077196 Ga0501044_0077196_1748_2113 121
699 3300049823 Ga0501044_0122579 Ga0501044_0122579_1009_1374 121
700 3300049823 Ga0501044_0156054 Ga0501044_0156054_503_877 121
701 3300049823 Ga0501044_0186812 Ga0501044_0186812_1274_1639 121
702 3300049823 Ga0501044_0267456 Ga0501044_0267456_1269_1634 121
703 3300049823 Ga0501044_0443089 Ga0501044_0443089_451_816 121
704 3300049823 Ga0501044_0641829 Ga0501044_0641829_147_512 121
705 3300049823 Ga0501044_1409192 Ga0501044_1409192_89_463 121
706 3300049824 Ga0501045_0473472 Ga0501045_0473472_174_539 121
707 3300050490 nmdc:mga03n38_21522_c1 nmdc:mga03n38_21522_c1_802_1167 121
708 3300050490 nmdc:mga03n38_490481_c1 nmdc:mga03n38_490481_c1_245_610 121
709 3300050494 nmdc:mga06z11_74517_c1 nmdc:mga06z11_74517_c1_363_773 121
710 3300050495 nmdc:mga04h51_3910_c1 nmdc:mga04h51_3910_c1_833_1243 121
711 3300050496 nmdc:mga07m45_255690_c1 nmdc:mga07m45_255690_c1_567_932 121
712 3300053080 Ga0500635_0175456 Ga0500635_0175456_309_683 121
713 3300053085 Ga0495619_0034703 Ga0495619_0034703_901_1266 121
714 3300053087 Ga0500643_000003 Ga0500643_000003_539700_540065 121
715 3300053090 Ga0500646_0054934 Ga0500646_0054934_51_416 121
716 3300053090 Ga0500646_0311446 Ga0500646_0311446_45_410 121
717 3300053096 Ga0500641_0298351 Ga0500641_0298351_44_409 121
718 3300053104 Ga0500556_0035718 Ga0500556_0035718_1208_1579 121
719 3300053117 Ga0500593_138306 Ga0500593_138306_251_616 121
720 3300053119 Ga0500595_000793 Ga0500595_000793_13736_14101 121
721 3300053119 Ga0500595_022389 Ga0500595_022389_89_463 121
722 3300053119 Ga0500595_084132 Ga0500595_084132_178_585 121
723 3300053119 Ga0500595_131264 Ga0500595_131264_144_530 121
724 3300053122 Ga0500608_305605 Ga0500608_305605_210_575 121
725 3300053123 Ga0500614_111246 Ga0500614_111246_93_458 121
726 3300053133 Ga0500655_129826 Ga0500655_129826_62_427 121
727 3300053136 Ga0500559_0162219 Ga0500559_0162219_312_686 121
728 3300053136 Ga0500559_0188504 Ga0500559_0188504_207_584 121
729 3300053139 Ga0500568_0023085 Ga0500568_0023085_687_1052 121
730 3300053139 Ga0500568_0070303 Ga0500568_0070303_961_1326 121
731 3300053140 Ga0500573_0000008 Ga0500573_0000008_203129_203494 121
732 3300053151 Ga0500604_0000195 Ga0500604_0000195_1412_1777 121
733 3300053163 Ga0500639_129880 Ga0500639_129880_474_851 121
734 3300053730 Ga0500645_063977 Ga0500645_063977_335_700 121
735 3300054114 Ga0501084_0012879 Ga0501084_0012879_4337_4702 121
736 3300054114 Ga0501084_0473492 Ga0501084_0473492_660_1025 121
737 3300059493 Ga0587077_112908 Ga0587077_112908_164_529 121
738 3300059623 Ga0587101_005090 Ga0587101_005090_913_1278 121
739 3300059639 Ga0587062_009839 Ga0587062_009839_586_951 121
740 3300059645 Ga0587076_045441 Ga0587076_045441_317_682 121
741 3300060353 Ga0501082_0040697 Ga0501082_0040697_2321_2686 121
742 3300060353 Ga0501082_0498399 Ga0501082_0498399_256_633 121
743 3300061734 Ga0530510_1580002 Ga0530510_1580002_30_395 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

44

142

0.98

Feature Viewer

pLDDT pTM Quality
77.81 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map