F478639
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 378 | 729 | 571 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_10005193|Ga0207660_100051934 |
| Length | 641 |
| Sequence | VPPKRQIRVGSQWMYARDAQRALEEALRVAEAERAEHEHQIPFIRKYVFSTDHKWIGIQYAITALTFLLLGFSMMLLMRFQLAFPGESMAKIPVIGGMLVKLLGASNAPGGVMLPEFYNQLGAMHGTVMVFLAIVPLAVGAFGNYVVPLQIGAPDMAFPKLNMMSYWCYLPGGFLMLSSFFFPGGSANSGWTSYPPLSIIATQGQTIWILGMVLLITSSLLGSVNFIVTIFQLRAKGLTFMRLPFFVWAQLVTSFLLLLAFPPLEAAAILQLMDRVAGTSFFMPSGLVVSGTPLTNAGGGNPLLWQHLFWFLAHPEVYVLILPGMGIIAEVIANNTRKPLWGYKSLVGAGVFLGFMSFVVWAHHMFMTGMGTVISAFFQTTTMIISIPSVVILTALIISLWGASIRFTVPMLFALAFLPMFGIGGLTGLPLGLAASDIHLHDTYYVIAHFHYVVAPGTIFAMFAGIYYWFPKVTGRQMNEKLGKIHFWFSLLFINGVFLPMFLQGLMGVSRRLYDGGAQYAHAKPIIHTNLLISTSAWLLLAAQLPFIWNFFHSIFKGKRVGANHWNATTLEWAATTSPPLGHGNFAVIPQVYRGPYEYSVPGYDAADYLPQNVPDEPPHPPAEGEGGGMLAATAVAQREG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 3 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 4 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 5 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 6 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 7 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 8 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 9 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 232 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 243 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 244 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 271 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 272 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 367 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 375 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 376 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 377 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 378 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.84 |
| Metatranscriptomes | 0.4 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 0.67 |
| Rhizoplane | 3.64 |
| Rhizosphere | 85.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000740 | 3300002705 | Bacteria | 17229 |
| 2 | JGI25154J39366_1003058 | 3300002738 | Bacteria | 3774 |
| 3 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 4 | JGI25157J39369_1000351 | 3300002741 | Bacteria | 32381 |
| 5 | JGI25164J39214_1002626 | 3300002772 | Bacteria | 2630 |
| 6 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 7 | Ga0055525_1000767 | 3300003759 | Bacteria | 10537 |
| 8 | Ga0055535_1000307 | 3300003761 | Bacteria | 49806 |
| 9 | Ga0055529_1000488 | 3300003763 | Bacteria | 36464 |
| 10 | Ga0055526_1007422 | 3300003771 | Bacteria | 5698 |
| 11 | Ga0055537_1000177 | 3300003773 | Bacteria | 47558 |
| 12 | Ga0055524_1004106 | 3300003775 | Bacteria | 6824 |
| 13 | Ga0055524_1006970 | 3300003775 | Bacteria | 4855 |
| 14 | Ga0055536_1011983 | 3300003781 | Bacteria | 3262 |
| 15 | Ga0055534_1002897 | 3300003784 | Bacteria | 5689 |
| 16 | Ga0055528_1000045 | 3300003790 | Bacteria | 101917 |
| 17 | Ga0055540_1008475 | 3300003792 | Bacteria | 3698 |
| 18 | Ga0065714_10068777 | 3300005288 | Bacteria | 4549 |
| 19 | Ga0065704_10010850 | 3300005289 | Bacteria | 1961 |
| 20 | Ga0065712_10000389 | 3300005290 | Bacteria | 11944 |
| 21 | Ga0065712_10002078 | 3300005290 | Bacteria | 5860 |
| 22 | Ga0065715_10000231 | 3300005293 | Bacteria | 39804 |
| 23 | Ga0065715_10090395 | 3300005293 | Bacteria | 7096 |
| 24 | Ga0065715_10103076 | 3300005293 | Bacteria | 3061 |
| 25 | Ga0065707_10088172 | 3300005295 | Bacteria | 4751 |
| 26 | Ga0065707_10099691 | 3300005295 | Bacteria | 2987 |
| 27 | Ga0070658_10006034 | 3300005327 | Bacteria | 9832 |
| 28 | Ga0070658_10050821 | 3300005327 | Bacteria | 3360 |
| 29 | Ga0070683_100000649 | 3300005329 | Bacteria | 25103 |
| 30 | Ga0070690_100025032 | 3300005330 | Bacteria | 3675 |
| 31 | Ga0070670_100000094 | 3300005331 | Bacteria | 84268 |
| 32 | Ga0070670_100009318 | 3300005331 | Bacteria | 8388 |
| 33 | Ga0070670_100012630 | 3300005331 | Bacteria | 7231 |
| 34 | Ga0070670_100018281 | 3300005331 | Bacteria | 6013 |
| 35 | Ga0070670_100056141 | 3300005331 | Bacteria | 3379 |
| 36 | Ga0068869_100007312 | 3300005334 | Bacteria | 7042 |
| 37 | Ga0070666_10003449 | 3300005335 | Bacteria | 9580 |
| 38 | Ga0070680_100017974 | 3300005336 | Bacteria | 5583 |
| 39 | Ga0070680_100045014 | 3300005336 | Bacteria | 3587 |
| 40 | Ga0070680_100080323 | 3300005336 | Bacteria | 2689 |
| 41 | Ga0068868_100000245 | 3300005338 | Bacteria | 36844 |
| 42 | Ga0068868_100002860 | 3300005338 | Bacteria | 11969 |
| 43 | Ga0070689_100002543 | 3300005340 | Bacteria | 11953 |
| 44 | Ga0070689_100065113 | 3300005340 | Bacteria | 2838 |
| 45 | Ga0070689_100105692 | 3300005340 | Bacteria | 2233 |
| 46 | Ga0070691_10008765 | 3300005341 | Bacteria | 4630 |
| 47 | Ga0070661_100041487 | 3300005344 | Bacteria | 3358 |
| 48 | Ga0070692_10008886 | 3300005345 | Bacteria | 4503 |
| 49 | Ga0070692_10020165 | 3300005345 | Bacteria | 3229 |
| 50 | Ga0070668_100003090 | 3300005347 | Bacteria | 12302 |
| 51 | Ga0070668_100020167 | 3300005347 | Bacteria | 5026 |
| 52 | Ga0070669_100000348 | 3300005353 | Bacteria | 36149 |
| 53 | Ga0070669_100000352 | 3300005353 | Bacteria | 35915 |
| 54 | Ga0070675_100000020 | 3300005354 | Bacteria | 168778 |
| 55 | Ga0070675_100027987 | 3300005354 | Bacteria | 4532 |
| 56 | Ga0070675_100035290 | 3300005354 | Bacteria | 4063 |
| 57 | Ga0070671_100010669 | 3300005355 | Bacteria | 7375 |
| 58 | Ga0070671_100021909 | 3300005355 | Bacteria | 5219 |
| 59 | Ga0070671_100054204 | 3300005355 | Bacteria | 3334 |
| 60 | Ga0070671_100094732 | 3300005355 | Bacteria | 2503 |
| 61 | Ga0070673_100037962 | 3300005364 | Bacteria | 3674 |
| 62 | Ga0070688_100013815 | 3300005365 | Bacteria | 4565 |
| 63 | Ga0070659_100044061 | 3300005366 | Bacteria | 3492 |
| 64 | Ga0070713_100011224 | 3300005436 | Bacteria | 6514 |
| 65 | Ga0070701_10004769 | 3300005438 | Bacteria | 5539 |
| 66 | Ga0070705_100025872 | 3300005440 | Bacteria | 3187 |
| 67 | Ga0070700_100000104 | 3300005441 | Bacteria | 53476 |
| 68 | Ga0070708_100018452 | 3300005445 | Bacteria | 5840 |
| 69 | Ga0070708_100124786 | 3300005445 | Bacteria | 2378 |
| 70 | Ga0070663_100007029 | 3300005455 | Bacteria | 6821 |
| 71 | Ga0070663_100026338 | 3300005455 | Bacteria | 3938 |
| 72 | Ga0070678_100001166 | 3300005456 | Bacteria | 13932 |
| 73 | Ga0070678_100010305 | 3300005456 | Bacteria | 5702 |
| 74 | Ga0070678_100034564 | 3300005456 | Bacteria | 3522 |
| 75 | Ga0070678_100062516 | 3300005456 | Bacteria | 2750 |
| 76 | Ga0070662_100047990 | 3300005457 | Bacteria | 3075 |
| 77 | Ga0070681_10011770 | 3300005458 | Bacteria | 8671 |
| 78 | Ga0070681_10084357 | 3300005458 | Bacteria | 3129 |
| 79 | Ga0070681_10145485 | 3300005458 | Bacteria | 2299 |
| 80 | Ga0068867_100000995 | 3300005459 | Bacteria | 19329 |
| 81 | Ga0070685_10008340 | 3300005466 | Bacteria | 5318 |
| 82 | Ga0070685_10059000 | 3300005466 | Bacteria | 2239 |
| 83 | Ga0070685_10078232 | 3300005466 | Bacteria | 1977 |
| 84 | Ga0070706_100017295 | 3300005467 | Bacteria | 6656 |
| 85 | Ga0070706_100018329 | 3300005467 | Bacteria | 6459 |
| 86 | Ga0070706_100101580 | 3300005467 | Bacteria | 2673 |
| 87 | Ga0070707_100073024 | 3300005468 | Bacteria | 3307 |
| 88 | Ga0070699_100005764 | 3300005518 | Bacteria | 10838 |
| 89 | Ga0070699_100005984 | 3300005518 | Bacteria | 10631 |
| 90 | Ga0070699_100052736 | 3300005518 | Bacteria | 3519 |
| 91 | Ga0070699_100064587 | 3300005518 | Bacteria | 3174 |
| 92 | Ga0070679_100040799 | 3300005530 | Bacteria | 4618 |
| 93 | Ga0070684_100001971 | 3300005535 | Bacteria | 15082 |
| 94 | Ga0070684_100003804 | 3300005535 | Bacteria | 11405 |
| 95 | Ga0070684_100014736 | 3300005535 | Bacteria | 6343 |
| 96 | Ga0070697_100015122 | 3300005536 | Bacteria | 6060 |
| 97 | Ga0070697_100017194 | 3300005536 | Bacteria | 5686 |
| 98 | Ga0070672_100000242 | 3300005543 | Bacteria | 30531 |
| 99 | Ga0070672_100009930 | 3300005543 | Bacteria | 6582 |
| 100 | Ga0070686_100006734 | 3300005544 | Bacteria | 6396 |
| 101 | Ga0070686_100074646 | 3300005544 | Bacteria | 2229 |
| 102 | Ga0070686_100083119 | 3300005544 | Bacteria | 2125 |
| 103 | Ga0070695_100057158 | 3300005545 | Bacteria | 2520 |
| 104 | Ga0070693_100019125 | 3300005547 | Bacteria | 3586 |
| 105 | Ga0070665_100024772 | 3300005548 | Bacteria | 6045 |
| 106 | Ga0070704_100013674 | 3300005549 | Bacteria | 5047 |
| 107 | Ga0070704_100016965 | 3300005549 | Bacteria | 4617 |
| 108 | Ga0068855_100004160 | 3300005563 | Bacteria | 17656 |
| 109 | Ga0070664_100008165 | 3300005564 | Bacteria | 8465 |
| 110 | Ga0068857_100018875 | 3300005577 | Bacteria | 6050 |
| 111 | Ga0068857_100159388 | 3300005577 | Bacteria | 2047 |
| 112 | Ga0068857_100206113 | 3300005577 | Bacteria | 1793 |
| 113 | Ga0068854_100002935 | 3300005578 | Bacteria | 10575 |
| 114 | Ga0068854_100014117 | 3300005578 | Bacteria | 5258 |
| 115 | Ga0068854_100033338 | 3300005578 | Bacteria | 3590 |
| 116 | Ga0070702_100004921 | 3300005615 | Bacteria | 6156 |
| 117 | Ga0068859_100007636 | 3300005617 | Bacteria | 10988 |
| 118 | Ga0068859_100010679 | 3300005617 | Bacteria | 9241 |
| 119 | Ga0068859_100018501 | 3300005617 | Bacteria | 7001 |
| 120 | Ga0068864_100000013 | 3300005618 | Bacteria | 326235 |
| 121 | Ga0068864_100006309 | 3300005618 | Bacteria | 9727 |
| 122 | Ga0068864_100044184 | 3300005618 | Bacteria | 3818 |
| 123 | Ga0068861_100068431 | 3300005719 | Bacteria | 2744 |
| 124 | Ga0068870_10000244 | 3300005840 | Bacteria | 20156 |
| 125 | Ga0068870_10008070 | 3300005840 | Bacteria | 4717 |
| 126 | Ga0068863_100061686 | 3300005841 | Bacteria | 3545 |
| 127 | Ga0068858_100000011 | 3300005842 | Bacteria | 233214 |
| 128 | Ga0068858_100032311 | 3300005842 | Bacteria | 4861 |
| 129 | Ga0068860_100033594 | 3300005843 | Bacteria | 4921 |
| 130 | Ga0068860_100040049 | 3300005843 | Bacteria | 4480 |
| 131 | Ga0068862_100000275 | 3300005844 | Bacteria | 57657 |
| 132 | Ga0068862_100005826 | 3300005844 | Bacteria | 10270 |
| 133 | Ga0068862_100035927 | 3300005844 | Bacteria | 4198 |
| 134 | Ga0081455_10026507 | 3300005937 | Bacteria | 5327 |
| 135 | Ga0081455_10094323 | 3300005937 | Bacteria | 2418 |
| 136 | Ga0081538_10030223 | 3300005981 | Bacteria | 3682 |
| 137 | Ga0081539_10000122 | 3300005985 | Bacteria | 183393 |
| 138 | Ga0070717_10000046 | 3300006028 | Bacteria | 106495 |
| 139 | Ga0070717_10087829 | 3300006028 | Bacteria | 2620 |
| 140 | Ga0075365_10087655 | 3300006038 | Bacteria | 2116 |
| 141 | Ga0075368_10019550 | 3300006042 | Bacteria | 2557 |
| 142 | Ga0075432_10012695 | 3300006058 | Bacteria | 2861 |
| 143 | Ga0070716_100009457 | 3300006173 | Bacteria | 4860 |
| 144 | Ga0075367_10016574 | 3300006178 | Bacteria | 4024 |
| 145 | Ga0075367_10049906 | 3300006178 | Bacteria | 2468 |
| 146 | Ga0075366_10047802 | 3300006195 | Bacteria | 2536 |
| 147 | Ga0075366_10078940 | 3300006195 | Bacteria | 1964 |
| 148 | Ga0075370_10002711 | 3300006353 | Bacteria | 8289 |
| 149 | Ga0068871_100011956 | 3300006358 | Bacteria | 6390 |
| 150 | Ga0075428_100000756 | 3300006844 | Bacteria | 33584 |
| 151 | Ga0075428_100005221 | 3300006844 | Bacteria | 14441 |
| 152 | Ga0075428_100008399 | 3300006844 | Bacteria | 11449 |
| 153 | Ga0075428_100012862 | 3300006844 | Bacteria | 9314 |
| 154 | Ga0075428_100014173 | 3300006844 | Bacteria | 8869 |
| 155 | Ga0075428_100042186 | 3300006844 | Bacteria | 5018 |
| 156 | Ga0075428_100055111 | 3300006844 | Bacteria | 4357 |
| 157 | Ga0075428_100123777 | 3300006844 | Bacteria | 2814 |
| 158 | Ga0075431_100001877 | 3300006847 | Bacteria | 19911 |
| 159 | Ga0075431_100036608 | 3300006847 | Bacteria | 5054 |
| 160 | Ga0075431_100039477 | 3300006847 | Bacteria | 4862 |
| 161 | Ga0075433_10000236 | 3300006852 | Bacteria | 31700 |
| 162 | Ga0075433_10004565 | 3300006852 | Bacteria | 10801 |
| 163 | Ga0075433_10025564 | 3300006852 | Bacteria | 4992 |
| 164 | Ga0075433_10087674 | 3300006852 | Bacteria | 2748 |
| 165 | Ga0075433_10088274 | 3300006852 | Bacteria | 2739 |
| 166 | Ga0075434_100003430 | 3300006871 | Bacteria | 14176 |
| 167 | Ga0075434_100003683 | 3300006871 | Bacteria | 13685 |
| 168 | Ga0075434_100008145 | 3300006871 | Bacteria | 9718 |
| 169 | Ga0075434_100035219 | 3300006871 | Bacteria | 4948 |
| 170 | Ga0075434_100041707 | 3300006871 | Bacteria | 4547 |
| 171 | Ga0075429_100038415 | 3300006880 | Bacteria | 4167 |
| 172 | Ga0075429_100060377 | 3300006880 | Bacteria | 3302 |
| 173 | Ga0068865_100025251 | 3300006881 | Bacteria | 3906 |
| 174 | Ga0075436_100000808 | 3300006914 | Bacteria | 20793 |
| 175 | Ga0075436_100004058 | 3300006914 | Bacteria | 10044 |
| 176 | Ga0075436_100011107 | 3300006914 | Bacteria | 6175 |
| 177 | Ga0097620_100007636 | 3300006931 | Bacteria | 10988 |
| 178 | Ga0097620_100010682 | 3300006931 | Bacteria | 9241 |
| 179 | Ga0097620_100018501 | 3300006931 | Bacteria | 7001 |
| 180 | Ga0075435_100000784 | 3300007076 | Bacteria | 19756 |
| 181 | Ga0075435_100116643 | 3300007076 | Bacteria | 2224 |
| 182 | Ga0099794_10048342 | 3300007265 | Bacteria | 2042 |
| 183 | Ga0099795_10011555 | 3300007788 | Bacteria | 2644 |
| 184 | Ga0105244_10006538 | 3300009036 | Bacteria | 7519 |
| 185 | Ga0105240_10005108 | 3300009093 | Bacteria | 19644 |
| 186 | Ga0105240_10007177 | 3300009093 | Bacteria | 16224 |
| 187 | Ga0105240_10018998 | 3300009093 | Bacteria | 9202 |
| 188 | Ga0105240_10167631 | 3300009093 | Bacteria | 2604 |
| 189 | Ga0111539_10000031 | 3300009094 | Bacteria | 165994 |
| 190 | Ga0111539_10000903 | 3300009094 | Bacteria | 38809 |
| 191 | Ga0111539_10008858 | 3300009094 | Bacteria | 12750 |
| 192 | Ga0111539_10010083 | 3300009094 | Bacteria | 11908 |
| 193 | Ga0111539_10011408 | 3300009094 | Bacteria | 11154 |
| 194 | Ga0111539_10077981 | 3300009094 | Bacteria | 3898 |
| 195 | Ga0111539_10168068 | 3300009094 | Bacteria | 2563 |
| 196 | Ga0111539_10259863 | 3300009094 | Bacteria | 2021 |
| 197 | Ga0105245_10000727 | 3300009098 | Bacteria | 29676 |
| 198 | Ga0105245_10001167 | 3300009098 | Bacteria | 23772 |
| 199 | Ga0105245_10004050 | 3300009098 | Bacteria | 13023 |
| 200 | Ga0105245_10008265 | 3300009098 | Bacteria | 9099 |
| 201 | Ga0105247_10012624 | 3300009101 | Bacteria | 5072 |
| 202 | Ga0114129_10005112 | 3300009147 | Bacteria | 18461 |
| 203 | Ga0114129_10006350 | 3300009147 | Bacteria | 16759 |
| 204 | Ga0114129_10010106 | 3300009147 | Bacteria | 13454 |
| 205 | Ga0114129_10019320 | 3300009147 | Bacteria | 9703 |
| 206 | Ga0114129_10023573 | 3300009147 | Bacteria | 8723 |
| 207 | Ga0114129_10103609 | 3300009147 | Bacteria | 3934 |
| 208 | Ga0105243_10006051 | 3300009148 | Bacteria | 9361 |
| 209 | Ga0105242_10043311 | 3300009176 | Bacteria | 3641 |
| 210 | Ga0105248_10021610 | 3300009177 | Bacteria | 7128 |
| 211 | Ga0105238_10000030 | 3300009551 | Bacteria | 181972 |
| 212 | Ga0105238_10065270 | 3300009551 | Bacteria | 3641 |
| 213 | Ga0105249_10012001 | 3300009553 | Bacteria | 7622 |
| 214 | Ga0099796_10005087 | 3300010159 | Bacteria | 3251 |
| 215 | Ga0105239_10014607 | 3300010375 | Bacteria | 8711 |
| 216 | Ga0105239_10174007 | 3300010375 | Bacteria | 2408 |
| 217 | Ga0157371_10012102 | 3300013102 | Bacteria | 6610 |
| 218 | Ga0157370_10052371 | 3300013104 | Bacteria | 3897 |
| 219 | Ga0157369_10000404 | 3300013105 | Bacteria | 57448 |
| 220 | Ga0157374_10000020 | 3300013296 | Bacteria | 276902 |
| 221 | Ga0157374_10088530 | 3300013296 | Bacteria | 2949 |
| 222 | Ga0157378_10003050 | 3300013297 | Bacteria | 14890 |
| 223 | Ga0157378_10009761 | 3300013297 | Bacteria | 8366 |
| 224 | Ga0157378_10118480 | 3300013297 | Bacteria | 2437 |
| 225 | Ga0163162_10023217 | 3300013306 | Bacteria | 6119 |
| 226 | Ga0157372_10085983 | 3300013307 | Bacteria | 3567 |
| 227 | Ga0157375_10000024 | 3300013308 | Bacteria | 231767 |
| 228 | Ga0157375_10000389 | 3300013308 | Bacteria | 39904 |
| 229 | Ga0157375_10022636 | 3300013308 | Bacteria | 5786 |
| 230 | Ga0157375_10028477 | 3300013308 | Bacteria | 5236 |
| 231 | Ga0163163_10024047 | 3300014325 | Bacteria | 5795 |
| 232 | Ga0163163_10024812 | 3300014325 | Bacteria | 5709 |
| 233 | Ga0163163_10046487 | 3300014325 | Bacteria | 4264 |
| 234 | Ga0157380_10002857 | 3300014326 | Bacteria | 11723 |
| 235 | Ga0157380_10015368 | 3300014326 | Bacteria | 5627 |
| 236 | Ga0157380_10018808 | 3300014326 | Bacteria | 5138 |
| 237 | Ga0157380_10023538 | 3300014326 | Bacteria | 4647 |
| 238 | Ga0157380_10120663 | 3300014326 | Bacteria | 2220 |
| 239 | Ga0157377_10000031 | 3300014745 | Bacteria | 124109 |
| 240 | Ga0157377_10000260 | 3300014745 | Bacteria | 25939 |
| 241 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 242 | Ga0157376_10042351 | 3300014969 | Bacteria | 3732 |
| 243 | Ga0163161_10040039 | 3300017792 | Bacteria | 3365 |
| 244 | Ga0163161_10067418 | 3300017792 | Bacteria | 2614 |
| 245 | Ga0163161_10091016 | 3300017792 | Bacteria | 2257 |
| 246 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 247 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 248 | Ga0213876_10000135 | 3300021384 | Bacteria | 80441 |
| 249 | Ga0213876_10004239 | 3300021384 | Bacteria | 8048 |
| 250 | Ga0213876_10008103 | 3300021384 | Bacteria | 5695 |
| 251 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 252 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 253 | Ga0207427_101039 | 3300025231 | Bacteria | 11567 |
| 254 | Ga0209258_100319 | 3300025242 | Bacteria | 74569 |
| 255 | Ga0209258_100699 | 3300025242 | Bacteria | 22932 |
| 256 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 257 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 258 | Ga0209677_100175 | 3300025253 | Bacteria | 55052 |
| 259 | Ga0209677_100782 | 3300025253 | Bacteria | 16014 |
| 260 | Ga0209677_104320 | 3300025253 | Bacteria | 4155 |
| 261 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 262 | Ga0209759_1001175 | 3300025256 | Bacteria | 16458 |
| 263 | Ga0209759_1002013 | 3300025256 | Bacteria | 9668 |
| 264 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 265 | Ga0209455_1000157 | 3300025272 | Bacteria | 119719 |
| 266 | Ga0209673_1000494 | 3300025273 | Bacteria | 65078 |
| 267 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 268 | Ga0209676_1000307 | 3300025292 | Bacteria | 96239 |
| 269 | Ga0209564_1000993 | 3300025295 | Bacteria | 35449 |
| 270 | Ga0209050_1003024 | 3300025298 | Bacteria | 13016 |
| 271 | Ga0209256_1008116 | 3300025299 | Bacteria | 4951 |
| 272 | Ga0209051_1001868 | 3300025303 | Bacteria | 16533 |
| 273 | Ga0209051_1002067 | 3300025303 | Bacteria | 15222 |
| 274 | Ga0209257_1000091 | 3300025304 | Bacteria | 270637 |
| 275 | Ga0209257_1004202 | 3300025304 | Bacteria | 11421 |
| 276 | Ga0207697_10002245 | 3300025315 | Bacteria | 10092 |
| 277 | Ga0207656_10026684 | 3300025321 | Bacteria | 2357 |
| 278 | Ga0207655_1025199 | 3300025728 | Bacteria | 2893 |
| 279 | Ga0207710_10004767 | 3300025900 | Bacteria | 5883 |
| 280 | Ga0207710_10020698 | 3300025900 | Bacteria | 2814 |
| 281 | Ga0207688_10010922 | 3300025901 | Bacteria | 4941 |
| 282 | Ga0207645_10026691 | 3300025907 | Bacteria | 3731 |
| 283 | Ga0207645_10041262 | 3300025907 | Bacteria | 2954 |
| 284 | Ga0207643_10013262 | 3300025908 | Bacteria | 4461 |
| 285 | Ga0207643_10016159 | 3300025908 | Bacteria | 4069 |
| 286 | Ga0207643_10049313 | 3300025908 | Bacteria | 2386 |
| 287 | Ga0207705_10047196 | 3300025909 | Bacteria | 3097 |
| 288 | Ga0207705_10088662 | 3300025909 | Bacteria | 2263 |
| 289 | Ga0207684_10004441 | 3300025910 | Bacteria | 13222 |
| 290 | Ga0207707_10001945 | 3300025912 | Bacteria | 18792 |
| 291 | Ga0207707_10056114 | 3300025912 | Bacteria | 3426 |
| 292 | Ga0207707_10124841 | 3300025912 | Bacteria | 2251 |
| 293 | Ga0207695_10003505 | 3300025913 | Bacteria | 22004 |
| 294 | Ga0207695_10009579 | 3300025913 | Bacteria | 11969 |
| 295 | Ga0207695_10017072 | 3300025913 | Bacteria | 8465 |
| 296 | Ga0207695_10046498 | 3300025913 | Bacteria | 4601 |
| 297 | Ga0207660_10005193 | 3300025917 | Bacteria | 8467 |
| 298 | Ga0207660_10013073 | 3300025917 | Bacteria | 5435 |
| 299 | Ga0207660_10026023 | 3300025917 | Bacteria | 3980 |
| 300 | Ga0207662_10023471 | 3300025918 | Bacteria | 3544 |
| 301 | Ga0207662_10023915 | 3300025918 | Bacteria | 3513 |
| 302 | Ga0207662_10047449 | 3300025918 | Bacteria | 2544 |
| 303 | Ga0207657_10010713 | 3300025919 | Bacteria | 9129 |
| 304 | Ga0207657_10023809 | 3300025919 | Bacteria | 5692 |
| 305 | Ga0207657_10061516 | 3300025919 | Bacteria | 3219 |
| 306 | Ga0207649_10043513 | 3300025920 | Bacteria | 2746 |
| 307 | Ga0207652_10001697 | 3300025921 | Bacteria | 19284 |
| 308 | Ga0207646_10005844 | 3300025922 | Bacteria | 12866 |
| 309 | Ga0207646_10006832 | 3300025922 | Bacteria | 11729 |
| 310 | Ga0207646_10027865 | 3300025922 | Bacteria | 5150 |
| 311 | Ga0207681_10000305 | 3300025923 | Bacteria | 36167 |
| 312 | Ga0207694_10000002 | 3300025924 | Bacteria | 1165763 |
| 313 | Ga0207694_10000003 | 3300025924 | Bacteria | 1165533 |
| 314 | Ga0207694_10034754 | 3300025924 | Bacteria | 3866 |
| 315 | Ga0207650_10000101 | 3300025925 | Bacteria | 112066 |
| 316 | Ga0207650_10007091 | 3300025925 | Bacteria | 7636 |
| 317 | Ga0207650_10035554 | 3300025925 | Bacteria | 3619 |
| 318 | Ga0207650_10036772 | 3300025925 | Bacteria | 3563 |
| 319 | Ga0207659_10000035 | 3300025926 | Bacteria | 104092 |
| 320 | Ga0207659_10000617 | 3300025926 | Bacteria | 21204 |
| 321 | Ga0207659_10045938 | 3300025926 | Bacteria | 3082 |
| 322 | Ga0207687_10000024 | 3300025927 | Bacteria | 187490 |
| 323 | Ga0207687_10000301 | 3300025927 | Bacteria | 33834 |
| 324 | Ga0207687_10005201 | 3300025927 | Bacteria | 8632 |
| 325 | Ga0207687_10048475 | 3300025927 | Bacteria | 2950 |
| 326 | Ga0207700_10015684 | 3300025928 | Bacteria | 5009 |
| 327 | Ga0207644_10051072 | 3300025931 | Bacteria | 2966 |
| 328 | Ga0207690_10061452 | 3300025932 | Bacteria | 2554 |
| 329 | Ga0207706_10066020 | 3300025933 | Bacteria | 3185 |
| 330 | Ga0207709_10003953 | 3300025935 | Bacteria | 8651 |
| 331 | Ga0207709_10035654 | 3300025935 | Bacteria | 2943 |
| 332 | Ga0207670_10001271 | 3300025936 | Bacteria | 13327 |
| 333 | Ga0207670_10041302 | 3300025936 | Bacteria | 3033 |
| 334 | Ga0207670_10051769 | 3300025936 | Bacteria | 2759 |
| 335 | Ga0207669_10007218 | 3300025937 | Bacteria | 5121 |
| 336 | Ga0207669_10039479 | 3300025937 | Bacteria | 2728 |
| 337 | Ga0207665_10035772 | 3300025939 | Bacteria | 3298 |
| 338 | Ga0207665_10040660 | 3300025939 | Bacteria | 3103 |
| 339 | Ga0207691_10000444 | 3300025940 | Bacteria | 40991 |
| 340 | Ga0207691_10009037 | 3300025940 | Bacteria | 9560 |
| 341 | Ga0207691_10010200 | 3300025940 | Bacteria | 9012 |
| 342 | Ga0207691_10010403 | 3300025940 | Bacteria | 8923 |
| 343 | Ga0207711_10015048 | 3300025941 | Bacteria | 6425 |
| 344 | Ga0207711_10039269 | 3300025941 | Bacteria | 4026 |
| 345 | Ga0207711_10115276 | 3300025941 | Bacteria | 2394 |
| 346 | Ga0207689_10006141 | 3300025942 | Bacteria | 10632 |
| 347 | Ga0207689_10006852 | 3300025942 | Bacteria | 10021 |
| 348 | Ga0207689_10014485 | 3300025942 | Bacteria | 6709 |
| 349 | Ga0207689_10112758 | 3300025942 | Bacteria | 2235 |
| 350 | Ga0207661_10000022 | 3300025944 | Bacteria | 198514 |
| 351 | Ga0207661_10002360 | 3300025944 | Bacteria | 12994 |
| 352 | Ga0207661_10002465 | 3300025944 | Bacteria | 12712 |
| 353 | Ga0207661_10139443 | 3300025944 | Bacteria | 2085 |
| 354 | Ga0207661_10152895 | 3300025944 | Bacteria | 1996 |
| 355 | Ga0207679_10017579 | 3300025945 | Bacteria | 4773 |
| 356 | Ga0207667_10003700 | 3300025949 | Bacteria | 18853 |
| 357 | Ga0207651_10006179 | 3300025960 | Bacteria | 6234 |
| 358 | Ga0207668_10038784 | 3300025972 | Bacteria | 3201 |
| 359 | Ga0207668_10045064 | 3300025972 | Bacteria | 3005 |
| 360 | Ga0207668_10051730 | 3300025972 | Bacteria | 2838 |
| 361 | Ga0207640_10004476 | 3300025981 | Bacteria | 7577 |
| 362 | Ga0207640_10098101 | 3300025981 | Bacteria | 2047 |
| 363 | Ga0207677_10000002 | 3300026023 | Bacteria | 478921 |
| 364 | Ga0207677_10000264 | 3300026023 | Bacteria | 39747 |
| 365 | Ga0207677_10014291 | 3300026023 | Bacteria | 4632 |
| 366 | Ga0207703_10000004 | 3300026035 | Bacteria | 526312 |
| 367 | Ga0207703_10082081 | 3300026035 | Bacteria | 2689 |
| 368 | Ga0207703_10093545 | 3300026035 | Bacteria | 2532 |
| 369 | Ga0207639_10000006 | 3300026041 | Bacteria | 544415 |
| 370 | Ga0207678_10017965 | 3300026067 | Bacteria | 6213 |
| 371 | Ga0207678_10022747 | 3300026067 | Bacteria | 5489 |
| 372 | Ga0207708_10000012 | 3300026075 | Bacteria | 207611 |
| 373 | Ga0207708_10010152 | 3300026075 | Bacteria | 6992 |
| 374 | Ga0207708_10058240 | 3300026075 | Bacteria | 2948 |
| 375 | Ga0207702_10005245 | 3300026078 | Bacteria | 11378 |
| 376 | Ga0207648_10000375 | 3300026089 | Bacteria | 49109 |
| 377 | Ga0207648_10013213 | 3300026089 | Bacteria | 7693 |
| 378 | Ga0207676_10000030 | 3300026095 | Bacteria | 221663 |
| 379 | Ga0207676_10016261 | 3300026095 | Bacteria | 5387 |
| 380 | Ga0207676_10020445 | 3300026095 | Bacteria | 4844 |
| 381 | Ga0207676_10044867 | 3300026095 | Bacteria | 3412 |
| 382 | Ga0207676_10059727 | 3300026095 | Bacteria | 3012 |
| 383 | Ga0207674_10043028 | 3300026116 | Bacteria | 4659 |
| 384 | Ga0207674_10050794 | 3300026116 | Bacteria | 4235 |
| 385 | Ga0207674_10110549 | 3300026116 | Bacteria | 2723 |
| 386 | Ga0207675_100005097 | 3300026118 | Bacteria | 12640 |
| 387 | Ga0207675_100017249 | 3300026118 | Bacteria | 6742 |
| 388 | Ga0207675_100103433 | 3300026118 | Bacteria | 2684 |
| 389 | Ga0207675_100140367 | 3300026118 | Bacteria | 2295 |
| 390 | Ga0207683_10017830 | 3300026121 | Bacteria | 6055 |
| 391 | Ga0207683_10031823 | 3300026121 | Bacteria | 4580 |
| 392 | Ga0207683_10043872 | 3300026121 | Bacteria | 3908 |
| 393 | Ga0209974_10003969 | 3300027876 | Bacteria | 5295 |
| 394 | Ga0207428_10000012 | 3300027907 | Bacteria | 354383 |
| 395 | Ga0207428_10000525 | 3300027907 | Bacteria | 45711 |
| 396 | Ga0207428_10001048 | 3300027907 | Bacteria | 30412 |
| 397 | Ga0207428_10025102 | 3300027907 | Bacteria | 4991 |
| 398 | Ga0207428_10060949 | 3300027907 | Bacteria | 2989 |
| 399 | Ga0207428_10101471 | 3300027907 | Bacteria | 2223 |
| 400 | Ga0207428_10122484 | 3300027907 | Bacteria | 1994 |
| 401 | Ga0207428_10125684 | 3300027907 | Bacteria | 1964 |
| 402 | Ga0207428_10130140 | 3300027907 | Bacteria | 1926 |
| 403 | Ga0268265_10000191 | 3300028380 | Bacteria | 72200 |
| 404 | Ga0268265_10000263 | 3300028380 | Bacteria | 59820 |
| 405 | Ga0268265_10018414 | 3300028380 | Bacteria | 4839 |
| 406 | Ga0268265_10034336 | 3300028380 | Bacteria | 3696 |
| 407 | Ga0268264_10000914 | 3300028381 | Bacteria | 30928 |
| 408 | Ga0268264_10002400 | 3300028381 | Bacteria | 16495 |
| 409 | Ga0268264_10029986 | 3300028381 | Bacteria | 4460 |
| 410 | Ga0265337_1013714 | 3300028556 | Bacteria | 2708 |
| 411 | Ga0265326_10001276 | 3300028558 | Bacteria | 8935 |
| 412 | Ga0265326_10004659 | 3300028558 | Bacteria | 4372 |
| 413 | Ga0265319_1000001 | 3300028563 | Bacteria | 549513 |
| 414 | Ga0265319_1000747 | 3300028563 | Bacteria | 21209 |
| 415 | Ga0265318_10003207 | 3300028577 | Bacteria | 8345 |
| 416 | Ga0265323_10000215 | 3300028653 | Bacteria | 34197 |
| 417 | Ga0265322_10000089 | 3300028654 | Bacteria | 42821 |
| 418 | Ga0265322_10000224 | 3300028654 | Bacteria | 25191 |
| 419 | Ga0265336_10000040 | 3300028666 | Bacteria | 138266 |
| 420 | Ga0265336_10000432 | 3300028666 | Bacteria | 25816 |
| 421 | Ga0265338_10000111 | 3300028800 | Bacteria | 151469 |
| 422 | Ga0265338_10000607 | 3300028800 | Bacteria | 62806 |
| 423 | Ga0265338_10002460 | 3300028800 | Bacteria | 27676 |
| 424 | Ga0265338_10006237 | 3300028800 | Bacteria | 15257 |
| 425 | Ga0265338_10006702 | 3300028800 | Bacteria | 14554 |
| 426 | Ga0265338_10011992 | 3300028800 | Bacteria | 9927 |
| 427 | Ga0265338_10020079 | 3300028800 | Bacteria | 7046 |
| 428 | Ga0265338_10025006 | 3300028800 | Bacteria | 6079 |
| 429 | Ga0265338_10027459 | 3300028800 | Bacteria | 5711 |
| 430 | Ga0265324_10000589 | 3300029957 | Bacteria | 24888 |
| 431 | Ga0265324_10000978 | 3300029957 | Bacteria | 17699 |
| 432 | Ga0265324_10004432 | 3300029957 | Bacteria | 6351 |
| 433 | Ga0265324_10034373 | 3300029957 | Bacteria | 1765 |
| 434 | Ga0307511_10056147 | 3300030521 | Bacteria | 3083 |
| 435 | Ga0265330_10001621 | 3300031235 | Bacteria | 12825 |
| 436 | Ga0265332_10001623 | 3300031238 | Bacteria | 12318 |
| 437 | Ga0265328_10018376 | 3300031239 | Bacteria | 2697 |
| 438 | Ga0265320_10000653 | 3300031240 | Bacteria | 26510 |
| 439 | Ga0265320_10003110 | 3300031240 | Bacteria | 11268 |
| 440 | Ga0265320_10007095 | 3300031240 | Bacteria | 6989 |
| 441 | Ga0265320_10014031 | 3300031240 | Bacteria | 4585 |
| 442 | Ga0265325_10024796 | 3300031241 | Bacteria | 3259 |
| 443 | Ga0265329_10000272 | 3300031242 | Bacteria | 27351 |
| 444 | Ga0265340_10003766 | 3300031247 | Bacteria | 8537 |
| 445 | Ga0265340_10013223 | 3300031247 | Unclassified | 4343 |
| 446 | Ga0265339_10000624 | 3300031249 | Bacteria | 27447 |
| 447 | Ga0265331_10001631 | 3300031250 | Bacteria | 16368 |
| 448 | Ga0265327_10000005 | 3300031251 | Bacteria | 790146 |
| 449 | Ga0265327_10000580 | 3300031251 | Bacteria | 61843 |
| 450 | Ga0265327_10016399 | 3300031251 | Bacteria | 4706 |
| 451 | Ga0265327_10024010 | 3300031251 | Bacteria | 3592 |
| 452 | Ga0265316_10000234 | 3300031344 | Bacteria | 64079 |
| 453 | Ga0265316_10001836 | 3300031344 | Bacteria | 22346 |
| 454 | Ga0307408_100029498 | 3300031548 | Bacteria | 3802 |
| 455 | Ga0265313_10000870 | 3300031595 | Bacteria | 30487 |
| 456 | Ga0265313_10003911 | 3300031595 | Bacteria | 11724 |
| 457 | Ga0265313_10031810 | 3300031595 | Bacteria | 2702 |
| 458 | Ga0316575_10026250 | 3300031665 | Unclassified | 2263 |
| 459 | Ga0316579_10062792 | 3300031691 | Bacteria | 1749 |
| 460 | Ga0265314_10001492 | 3300031711 | Bacteria | 25974 |
| 461 | Ga0265314_10001680 | 3300031711 | Bacteria | 24092 |
| 462 | Ga0265314_10071646 | 3300031711 | Bacteria | 2318 |
| 463 | Ga0265342_10000142 | 3300031712 | Bacteria | 80728 |
| 464 | Ga0265342_10011896 | 3300031712 | Bacteria | 5920 |
| 465 | Ga0316578_10014768 | 3300031728 | Bacteria | 4183 |
| 466 | Ga0307516_10003164 | 3300031730 | Bacteria | 21417 |
| 467 | Ga0307405_10034459 | 3300031731 | Bacteria | 3013 |
| 468 | Ga0316577_10040013 | 3300031733 | Bacteria | 2622 |
| 469 | Ga0307416_100026833 | 3300032002 | Bacteria | 4252 |
| 470 | Ga0307411_10063644 | 3300032005 | Bacteria | 2466 |
| 471 | Ga0307415_100011908 | 3300032126 | Bacteria | 5004 |
| 472 | Ga0316583_10004894 | 3300032133 | Bacteria | 4788 |
| 473 | Ga0316585_10004587 | 3300032137 | Bacteria | 3857 |
| 474 | Ga0316585_10006452 | 3300032137 | Bacteria | 3354 |
| 475 | Ga0316593_10000001 | 3300032168 | Bacteria | 24747 |
| 476 | Ga0316593_10000372 | 3300032168 | Bacteria | 7942 |
| 477 | Ga0373934_0001195 | 3300035086 | Bacteria | 9401 |
| 478 | Ga0373944_0000152 | 3300035089 | Bacteria | 13680 |
| 479 | Ga0373932_0000070 | 3300035112 | Bacteria | 25672 |
| 480 | Ga0373945_0032559 | 3300035116 | Bacteria | 1848 |
| 481 | Ga0373953_0005805 | 3300035117 | Bacteria | 4034 |
| 482 | Ga0373954_0000506 | 3300035118 | Bacteria | 14591 |
| 483 | Ga0373954_0003169 | 3300035118 | Bacteria | 6947 |
| 484 | Ga0373954_0007174 | 3300035118 | Bacteria | 4866 |
| 485 | Ga0373956_0000019 | 3300035119 | Bacteria | 50599 |
| 486 | Ga0373956_0031830 | 3300035119 | Bacteria | 2313 |
| 487 | Ga0373957_0001675 | 3300035120 | Bacteria | 6067 |
| 488 | Ga0373957_0020329 | 3300035120 | Bacteria | 2344 |
| 489 | Ga0373943_0022261 | 3300035170 | Bacteria | 2935 |
| 490 | Ga0373955_0010696 | 3300035172 | Bacteria | 4344 |
| 491 | Ga0373961_0000401 | 3300035241 | Bacteria | 18158 |
| 492 | Ga0373931_0037772 | 3300035691 | Bacteria | 2522 |
| 493 | Ga0373935_0016410 | 3300035692 | Bacteria | 4480 |
| 494 | Ga0373935_0028222 | 3300035692 | Bacteria | 3469 |
| 495 | Ga0373933_0001818 | 3300035724 | Bacteria | 12368 |
| 496 | Ga0373937_0000993 | 3300036401 | Bacteria | 24079 |
| 497 | Ga0373937_0022242 | 3300036401 | Bacteria | 5699 |
| 498 | Ga0373937_0276078 | 3300036401 | Bacteria | 1586 |
| 499 | Ga0316582_0000223 | 3300036647 | Bacteria | 18571 |
| 500 | Ga0316582_0008553 | 3300036647 | Bacteria | 5509 |
| 501 | Ga0316584_0005118 | 3300036712 | Bacteria | 8750 |
| 502 | Ga0373925_0001450 | 3300037068 | Bacteria | 20471 |
| 503 | Ga0373925_0002115 | 3300037068 | Bacteria | 16299 |
| 504 | Ga0373925_0013654 | 3300037068 | Bacteria | 5881 |
| 505 | Ga0395899_0001243 | 3300037312 | Bacteria | 22144 |
| 506 | Ga0395899_0005394 | 3300037312 | Bacteria | 9936 |
| 507 | Ga0395900_0005627 | 3300037418 | Bacteria | 13106 |
| 508 | Ga0395898_0008569 | 3300037466 | Bacteria | 10795 |
| 509 | Ga0395898_0025434 | 3300037466 | Bacteria | 5965 |
| 510 | Ga0395898_0163807 | 3300037466 | Bacteria | 2127 |
| 511 | Ga0395905_0014228 | 3300037471 | Bacteria | 7601 |
| 512 | Ga0436364_0822442 | 3300037853 | Bacteria | 9083 |
| 513 | Ga0395901_0003173 | 3300038443 | Bacteria | 16538 |
| 514 | Ga0436365_0264177 | 3300039437 | Bacteria | 2694 |
| 515 | Ga0436365_0332720 | 3300039437 | Bacteria | 227622 |
| 516 | Ga0436365_0741332 | 3300039437 | Bacteria | 3866 |
| 517 | Ga0436365_0832427 | 3300039437 | Bacteria | 97428 |
| 518 | Ga0436365_1089890 | 3300039437 | Bacteria | 7035 |
| 519 | Ga0436365_1281712 | 3300039437 | Bacteria | 80367 |
| 520 | Ga0436365_1342523 | 3300039437 | Bacteria | 9327 |
| 521 | Ga0436365_1912664 | 3300039437 | Bacteria | 9703 |
| 522 | Ga0436362_0086070 | 3300039453 | Bacteria | 8527 |
| 523 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 524 | Ga0439446_0005265 | 3300042156 | Bacteria | 3322 |
| 525 | Ga0439434_0018522 | 3300042435 | Bacteria | 2085 |
| 526 | Ga0451577_0022548 | 3300042876 | Bacteria | 5749 |
| 527 | Ga0451577_0043672 | 3300042876 | Bacteria | 4015 |
| 528 | Ga0453683_0001132 | 3300044673 | Bacteria | 24253 |
| 529 | Ga0466965_0003310 | 3300044683 | Bacteria | 7053 |
| 530 | Ga0466966_0009059 | 3300044684 | Bacteria | 6593 |
| 531 | Ga0466961_0025989 | 3300044693 | Bacteria | 3763 |
| 532 | Ga0466964_0004084 | 3300044706 | Bacteria | 5371 |
| 533 | Ga0453684_0138564 | 3300044712 | Bacteria | 2909 |
| 534 | Ga0466971_0004547 | 3300044719 | Bacteria | 6000 |
| 535 | Ga0466957_0082110 | 3300044842 | Bacteria | 2008 |
| 536 | Ga0466959_0026708 | 3300045049 | Bacteria | 4280 |
| 537 | Ga0451576_0001932 | 3300045051 | Bacteria | 33128 |
| 538 | Ga0451576_0012996 | 3300045051 | Bacteria | 9328 |
| 539 | Ga0451576_0021397 | 3300045051 | Bacteria | 7029 |
| 540 | Ga0451576_0030186 | 3300045051 | Bacteria | 5797 |
| 541 | Ga0466958_0007306 | 3300045836 | Bacteria | 6067 |
| 542 | Ga0466967_0055360 | 3300045976 | Bacteria | 3494 |
| 543 | Ga0495592_0000008 | 3300046454 | Bacteria | 175382 |
| 544 | Ga0495592_0000978 | 3300046454 | Bacteria | 19833 |
| 545 | Ga0495629_0000024 | 3300046459 | Bacteria | 136884 |
| 546 | Ga0495629_0085355 | 3300046459 | Bacteria | 2203 |
| 547 | Ga0495638_0011225 | 3300046460 | Bacteria | 6182 |
| 548 | Ga0495651_0000147 | 3300046462 | Bacteria | 51361 |
| 549 | Ga0495653_0015810 | 3300046463 | Bacteria | 6153 |
| 550 | Ga0495580_0075543 | 3300046472 | Bacteria | 2351 |
| 551 | Ga0495662_0034466 | 3300046476 | Bacteria | 2443 |
| 552 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 553 | Ga0495618_0002272 | 3300046514 | Bacteria | 12450 |
| 554 | Ga0495618_0019297 | 3300046514 | Bacteria | 4193 |
| 555 | Ga0495620_0000745 | 3300046515 | Bacteria | 20009 |
| 556 | Ga0495628_0000166 | 3300046516 | Bacteria | 57276 |
| 557 | Ga0495628_0000681 | 3300046516 | Bacteria | 31276 |
| 558 | Ga0495628_0014263 | 3300046516 | Bacteria | 6668 |
| 559 | Ga0495630_0009382 | 3300046517 | Bacteria | 7033 |
| 560 | Ga0495666_0000017 | 3300046526 | Bacteria | 68024 |
| 561 | Ga0495666_0015944 | 3300046526 | Bacteria | 3742 |
| 562 | Ga0495586_0000120 | 3300046535 | Bacteria | 47384 |
| 563 | Ga0495586_0000768 | 3300046535 | Bacteria | 18420 |
| 564 | Ga0495586_0038429 | 3300046535 | Bacteria | 2570 |
| 565 | Ga0495645_0002948 | 3300046543 | Bacteria | 11531 |
| 566 | Ga0495645_0003396 | 3300046543 | Bacteria | 10793 |
| 567 | Ga0495622_0018006 | 3300046557 | Bacteria | 3290 |
| 568 | Ga0495667_0033781 | 3300046559 | Bacteria | 3422 |
| 569 | Ga0495634_0001642 | 3300046642 | Bacteria | 19458 |
| 570 | Ga0495635_0000629 | 3300046663 | Bacteria | 22704 |
| 571 | Ga0495635_0048401 | 3300046663 | Bacteria | 2931 |
| 572 | Ga0495657_0010602 | 3300046675 | Bacteria | 6927 |
| 573 | Ga0495599_0029239 | 3300046678 | Bacteria | 3454 |
| 574 | Ga0495658_0024804 | 3300046683 | Bacteria | 3199 |
| 575 | Ga0495658_0080398 | 3300046683 | Bacteria | 1911 |
| 576 | Ga0495600_0015122 | 3300046809 | Bacteria | 4874 |
| 577 | Ga0495581_0014274 | 3300047315 | Bacteria | 4607 |
| 578 | Ga0495604_0037893 | 3300047317 | Bacteria | 3794 |
| 579 | Ga0495674_0001483 | 3300047319 | Bacteria | 22973 |
| 580 | Ga0495672_0001004 | 3300047320 | Bacteria | 29106 |
| 581 | Ga0495676_0005941 | 3300047321 | Bacteria | 11205 |
| 582 | Ga0495676_0066783 | 3300047321 | Bacteria | 2785 |
| 583 | Ga0495680_0001604 | 3300047322 | Bacteria | 24103 |
| 584 | Ga0495684_0002350 | 3300047471 | Bacteria | 15119 |
| 585 | Ga0495684_0011475 | 3300047471 | Bacteria | 6843 |
| 586 | Ga0495684_0087390 | 3300047471 | Bacteria | 2363 |
| 587 | Ga0495686_0017170 | 3300047472 | Bacteria | 4884 |
| 588 | Ga0496101_0000685 | 3300048904 | Bacteria | 20428 |
| 589 | Ga0496102_0003011 | 3300048905 | Bacteria | 14268 |
| 590 | Ga0496102_0063325 | 3300048905 | Bacteria | 3386 |
| 591 | Ga0496102_0128752 | 3300048905 | Bacteria | 2368 |
| 592 | Ga0496104_0040764 | 3300048907 | Bacteria | 4353 |
| 593 | Ga0496104_0071226 | 3300048907 | Bacteria | 3305 |
| 594 | Ga0496105_0034676 | 3300048908 | Bacteria | 4151 |
| 595 | Ga0496108_0026526 | 3300048911 | Bacteria | 4779 |
| 596 | Ga0496108_0030232 | 3300048911 | Bacteria | 4489 |
| 597 | Ga0496108_0058422 | 3300048911 | Bacteria | 3242 |
| 598 | Ga0496109_0002159 | 3300048912 | Bacteria | 16355 |
| 599 | Ga0496109_0004351 | 3300048912 | Bacteria | 11839 |
| 600 | Ga0496109_0117816 | 3300048912 | Bacteria | 2472 |
| 601 | Ga0496110_0005001 | 3300048913 | Bacteria | 10359 |
| 602 | Ga0496110_0006233 | 3300048913 | Bacteria | 9404 |
| 603 | Ga0496110_0021523 | 3300048913 | Bacteria | 5462 |
| 604 | Ga0496110_0047217 | 3300048913 | Bacteria | 3769 |
| 605 | Ga0496110_0063628 | 3300048913 | Bacteria | 3260 |
| 606 | Ga0496111_0004949 | 3300048914 | Bacteria | 8467 |
| 607 | Ga0496111_0059782 | 3300048914 | Bacteria | 2762 |
| 608 | Ga0496112_0006706 | 3300048915 | Bacteria | 10140 |
| 609 | Ga0496112_0008524 | 3300048915 | Bacteria | 9185 |
| 610 | Ga0496113_0119496 | 3300048916 | Bacteria | 2059 |
| 611 | Ga0496114_0000020 | 3300048917 | Bacteria | 238645 |
| 612 | Ga0496114_0002130 | 3300048917 | Bacteria | 15055 |
| 613 | Ga0496114_0003715 | 3300048917 | Bacteria | 11751 |
| 614 | Ga0496114_0026280 | 3300048917 | Bacteria | 4764 |
| 615 | Ga0496116_0017050 | 3300048919 | Bacteria | 5657 |
| 616 | Ga0496124_0000115 | 3300048927 | Bacteria | 164929 |
| 617 | Ga0501031_0000133 | 3300049568 | Bacteria | 41137 |
| 618 | Ga0501034_0021828 | 3300049571 | Bacteria | 6522 |
| 619 | Ga0501036_0007242 | 3300049572 | Bacteria | 9033 |
| 620 | Ga0501036_0008524 | 3300049572 | Bacteria | 8404 |
| 621 | Ga0501038_0016982 | 3300049574 | Bacteria | 6586 |
| 622 | Ga0501039_0031982 | 3300049575 | Bacteria | 4056 |
| 623 | Ga0501039_0082967 | 3300049575 | Bacteria | 2496 |
| 624 | Ga0501040_0006107 | 3300049576 | Bacteria | 7814 |
| 625 | Ga0501040_0007347 | 3300049576 | Bacteria | 7136 |
| 626 | Ga0501041_0006178 | 3300049577 | Bacteria | 7001 |
| 627 | Ga0501041_0022155 | 3300049577 | Bacteria | 3804 |
| 628 | Ga0501042_0008684 | 3300049578 | Bacteria | 6735 |
| 629 | Ga0501042_0010389 | 3300049578 | Bacteria | 6241 |
| 630 | Ga0501042_0021669 | 3300049578 | Bacteria | 4481 |
| 631 | Ga0501042_0077171 | 3300049578 | Bacteria | 2385 |
| 632 | Ga0501046_0027727 | 3300049580 | Bacteria | 4618 |
| 633 | Ga0501046_0057586 | 3300049580 | Bacteria | 3048 |
| 634 | Ga0501048_0043297 | 3300049582 | Bacteria | 3223 |
| 635 | Ga0501067_0051951 | 3300049583 | Bacteria | 2271 |
| 636 | Ga0501068_0064774 | 3300049584 | Bacteria | 2224 |
| 637 | Ga0501071_0004658 | 3300049587 | Bacteria | 8712 |
| 638 | Ga0501071_0008592 | 3300049587 | Bacteria | 6750 |
| 639 | Ga0501071_0019115 | 3300049587 | Bacteria | 4754 |
| 640 | Ga0501071_0061608 | 3300049587 | Bacteria | 2717 |
| 641 | Ga0501071_0120085 | 3300049587 | Bacteria | 1948 |
| 642 | Ga0501072_0019775 | 3300049588 | Bacteria | 5209 |
| 643 | Ga0501072_0025135 | 3300049588 | Bacteria | 4637 |
| 644 | Ga0501072_0036086 | 3300049588 | Bacteria | 3875 |
| 645 | Ga0501073_0029110 | 3300049589 | Bacteria | 3946 |
| 646 | Ga0501075_0001743 | 3300049591 | Bacteria | 14308 |
| 647 | Ga0501075_0004287 | 3300049591 | Bacteria | 9641 |
| 648 | Ga0501075_0013262 | 3300049591 | Bacteria | 5879 |
| 649 | Ga0501075_0027763 | 3300049591 | Bacteria | 4173 |
| 650 | Ga0501076_0000735 | 3300049592 | Bacteria | 21183 |
| 651 | Ga0501076_0004937 | 3300049592 | Bacteria | 9547 |
| 652 | Ga0501076_0018666 | 3300049592 | Bacteria | 5292 |
| 653 | Ga0501077_0000206 | 3300049593 | Bacteria | 34300 |
| 654 | Ga0501077_0008036 | 3300049593 | Bacteria | 6521 |
| 655 | Ga0501077_0008969 | 3300049593 | Bacteria | 6203 |
| 656 | Ga0501079_0009838 | 3300049741 | Bacteria | 7253 |
| 657 | Ga0501080_0034608 | 3300049742 | Bacteria | 4717 |
| 658 | Ga0501080_0065414 | 3300049742 | Bacteria | 3382 |
| 659 | Ga0501080_0065709 | 3300049742 | Bacteria | 3374 |
| 660 | Ga0501081_0003310 | 3300049743 | Bacteria | 10239 |
| 661 | Ga0501081_0016140 | 3300049743 | Bacteria | 4932 |
| 662 | Ga0501083_0007845 | 3300049744 | Bacteria | 7562 |
| 663 | Ga0501035_0055937 | 3300049822 | Bacteria | 3522 |
| 664 | Ga0501045_0007245 | 3300049824 | Bacteria | 7700 |
| 665 | nmdc:mga0yw44_54155_c1 | 3300050492 | Bacteria | 2437 |
| 666 | nmdc:mga0k408_8449_c1 | 3300050493 | Bacteria | 5528 |
| 667 | nmdc:mga07m45_2243_c2 | 3300050496 | Bacteria | 8377 |
| 668 | nmdc:mga05p37_116964_c1 | 3300050507 | Bacteria | 3277 |
| 669 | nmdc:mga05p37_12451_c1 | 3300050507 | Bacteria | 10159 |
| 670 | nmdc:mga05p37_17027_c1 | 3300050507 | Bacteria | 8766 |
| 671 | nmdc:mga05p37_17769_c1 | 3300050507 | Bacteria | 8582 |
| 672 | nmdc:mga05p37_33304_c1 | 3300050507 | Bacteria | 6311 |
| 673 | nmdc:mga05p37_35507_c1 | 3300050507 | Bacteria | 6113 |
| 674 | nmdc:mga05p37_7314_c1 | 3300050507 | Bacteria | 13029 |
| 675 | nmdc:mga05p37_76295_c2 | 3300050507 | Bacteria | 3378 |
| 676 | nmdc:mga09592_117865_c1 | 3300050508 | Bacteria | 2279 |
| 677 | nmdc:mga09592_1527_c1 | 3300050508 | Bacteria | 18657 |
| 678 | nmdc:mga09592_15514_c1 | 3300050508 | Bacteria | 6227 |
| 679 | nmdc:mga09592_54214_c1 | 3300050508 | Bacteria | 3387 |
| 680 | nmdc:mga09592_67230_c1 | 3300050508 | Bacteria | 3039 |
| 681 | nmdc:mga09592_74464_c1 | 3300050508 | Bacteria | 2885 |
| 682 | nmdc:mga09592_93784_c1 | 3300050508 | Bacteria | 2567 |
| 683 | nmdc:mga0qj67_23614_c1 | 3300050509 | Bacteria | 4732 |
| 684 | nmdc:mga0qj67_4864_c2 | 3300050509 | Bacteria | 9271 |
| 685 | nmdc:mga0qj67_5865_c1 | 3300050509 | Bacteria | 8994 |
| 686 | nmdc:mga06r32_1445_c1 | 3300050510 | Bacteria | 21463 |
| 687 | nmdc:mga06r32_219004_c1 | 3300050510 | Bacteria | 1892 |
| 688 | nmdc:mga06r32_39938_c1 | 3300050510 | Bacteria | 4454 |
| 689 | nmdc:mga06r32_49833_c1 | 3300050510 | Bacteria | 4006 |
| 690 | nmdc:mga06r32_67060_c1 | 3300050510 | Bacteria | 3464 |
| 691 | nmdc:mga08y16_12746_c1 | 3300050511 | Bacteria | 8847 |
| 692 | nmdc:mga08y16_18590_c1 | 3300050511 | Bacteria | 7322 |
| 693 | nmdc:mga08y16_73139_c1 | 3300050511 | Bacteria | 3572 |
| 694 | nmdc:mga08y16_7357_c1 | 3300050511 | Bacteria | 11549 |
| 695 | nmdc:mga08y16_77603_c1 | 3300050511 | Bacteria | 3464 |
| 696 | nmdc:mga08y16_7_c1 | 3300050511 | Bacteria | 610289 |
| 697 | nmdc:mga0n895_118143_c1 | 3300050512 | Bacteria | 2671 |
| 698 | nmdc:mga0n895_123078_c1 | 3300050512 | Bacteria | 2616 |
| 699 | nmdc:mga0n895_23617_c1 | 3300050512 | Bacteria | 5782 |
| 700 | nmdc:mga0n895_2440_c1 | 3300050512 | Bacteria | 14517 |
| 701 | nmdc:mga0n895_3804_c1 | 3300050512 | Bacteria | 12226 |
| 702 | nmdc:mga0n895_39045_c1 | 3300050512 | Bacteria | 4603 |
| 703 | nmdc:mga0n895_45134_c1 | 3300050512 | Bacteria | 4299 |
| 704 | nmdc:mga0n895_58225_c1 | 3300050512 | Bacteria | 3809 |
| 705 | nmdc:mga0rr50_127864_c1 | 3300050513 | Bacteria | 2031 |
| 706 | nmdc:mga0rr50_133690_c1 | 3300050513 | Bacteria | 1989 |
| 707 | nmdc:mga0rr50_31421_c1 | 3300050513 | Bacteria | 3770 |
| 708 | nmdc:mga0rr50_542_c1 | 3300050513 | Bacteria | 20249 |
| 709 | nmdc:mga0rr50_7901_c1 | 3300050513 | Bacteria | 6598 |
| 710 | nmdc:mga08x19_1124_c1 | 3300050514 | Bacteria | 16670 |
| 711 | nmdc:mga08x19_6281_c1 | 3300050514 | Bacteria | 7033 |
| 712 | nmdc:mga0a205_10361_c1 | 3300050515 | Bacteria | 8567 |
| 713 | nmdc:mga0a205_13084_c1 | 3300050515 | Bacteria | 7707 |
| 714 | nmdc:mga0a205_134057_c1 | 3300050515 | Bacteria | 2377 |
| 715 | nmdc:mga0a205_293_c2 | 3300050515 | Bacteria | 34916 |
| 716 | nmdc:mga0a205_36064_c1 | 3300050515 | Bacteria | 4751 |
| 717 | nmdc:mga0a205_65360_c1 | 3300050515 | Bacteria | 3514 |
| 718 | nmdc:mga0a205_9784_c1 | 3300050515 | Bacteria | 8789 |
| 719 | Ga0500635_0000113 | 3300053080 | Bacteria | 49202 |
| 720 | Ga0495655_0000117 | 3300053083 | Bacteria | 14650 |
| 721 | Ga0495655_0007332 | 3300053083 | Bacteria | 2045 |
| 722 | Ga0500641_0000973 | 3300053096 | Bacteria | 10189 |
| 723 | Ga0500568_0006841 | 3300053139 | Bacteria | 5678 |
| 724 | Ga0501084_0005639 | 3300054114 | Bacteria | 10280 |
| 725 | Ga0501084_0009502 | 3300054114 | Bacteria | 8046 |
| 726 | Ga0587111_0000631 | 3300060346 | Bacteria | 3576 |
| 727 | Ga0501082_0000005 | 3300060353 | Bacteria | 133412 |
| 728 | Ga0466962_0005278 | 3300061719 | Bacteria | 6207 |
| 729 | Ga0530510_0009755 | 3300061734 | Bacteria | 6738 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0037772 | Ga0373931_0037772_1090_2502 | 429 |
| 2 | 3300044842 | Ga0466957_0082110 | Ga0466957_0082110_673_1983 | 436 |
| 3 | 3300046535 | Ga0495586_0038429 | Ga0495586_0038429_1200_2546 | 447 |
| 4 | 3300035116 | Ga0373945_0032559 | Ga0373945_0032559_467_1828 | 452 |
| 5 | 3300046526 | Ga0495666_0015944 | Ga0495666_0015944_2340_3701 | 452 |
| 6 | 3300044712 | Ga0453684_0138564 | Ga0453684_0138564_19_1635 | 477 |
| 7 | 3300048913 | Ga0496110_0063628 | Ga0496110_0063628_883_2553 | 478 |
| 8 | 3300036401 | Ga0373937_0000993 | Ga0373937_0000993_21663_23273 | 481 |
| 9 | 3300014326 | Ga0157380_10023538 | Ga0157380_100235386 | 483 |
| 10 | 3300050508 | nmdc:mga09592_93784_c1 | nmdc:mga09592_93784_c1_10_1632 | 486 |
| 11 | 3300006852 | Ga0075433_10025564 | Ga0075433_100255642 | 487 |
| 12 | 3300006871 | Ga0075434_100003683 | Ga0075434_1000036837 | 487 |
| 13 | 3300009176 | Ga0105242_10043311 | Ga0105242_100433112 | 491 |
| 14 | 3300050507 | nmdc:mga05p37_76295_c2 | nmdc:mga05p37_76295_c2_1043_2653 | 491 |
| 15 | 3300027907 | Ga0207428_10101471 | Ga0207428_101014711 | 493 |
| 16 | 3300049587 | Ga0501071_0120085 | Ga0501071_0120085_288_1934 | 495 |
| 17 | 3300003781 | Ga0055536_1011983 | Ga0055536_10119831 | 496 |
| 18 | 3300005331 | Ga0070670_100056141 | Ga0070670_1000561412 | 496 |
| 19 | 3300005336 | Ga0070680_100017974 | Ga0070680_1000179744 | 496 |
| 20 | 3300005336 | Ga0070680_100080323 | Ga0070680_1000803232 | 496 |
| 21 | 3300005341 | Ga0070691_10008765 | Ga0070691_100087656 | 496 |
| 22 | 3300005344 | Ga0070661_100041487 | Ga0070661_1000414874 | 496 |
| 23 | 3300005345 | Ga0070692_10020165 | Ga0070692_100201653 | 496 |
| 24 | 3300005347 | Ga0070668_100020167 | Ga0070668_1000201675 | 496 |
| 25 | 3300005355 | Ga0070671_100021909 | Ga0070671_1000219092 | 496 |
| 26 | 3300005366 | Ga0070659_100044061 | Ga0070659_1000440612 | 496 |
| 27 | 3300005440 | Ga0070705_100025872 | Ga0070705_1000258722 | 496 |
| 28 | 3300005455 | Ga0070663_100026338 | Ga0070663_1000263384 | 496 |
| 29 | 3300005458 | Ga0070681_10145485 | Ga0070681_101454851 | 496 |
| 30 | 3300005466 | Ga0070685_10078232 | Ga0070685_100782322 | 496 |
| 31 | 3300005530 | Ga0070679_100040799 | Ga0070679_1000407992 | 496 |
| 32 | 3300005535 | Ga0070684_100014736 | Ga0070684_1000147366 | 496 |
| 33 | 3300005549 | Ga0070704_100016965 | Ga0070704_1000169652 | 496 |
| 34 | 3300005577 | Ga0068857_100206113 | Ga0068857_1002061132 | 496 |
| 35 | 3300005578 | Ga0068854_100014117 | Ga0068854_1000141172 | 496 |
| 36 | 3300005617 | Ga0068859_100018501 | Ga0068859_1000185015 | 496 |
| 37 | 3300005840 | Ga0068870_10008070 | Ga0068870_100080702 | 496 |
| 38 | 3300005841 | Ga0068863_100061686 | Ga0068863_1000616861 | 496 |
| 39 | 3300005842 | Ga0068858_100032311 | Ga0068858_1000323115 | 496 |
| 40 | 3300005843 | Ga0068860_100040049 | Ga0068860_1000400495 | 496 |
| 41 | 3300005844 | Ga0068862_100035927 | Ga0068862_1000359273 | 496 |
| 42 | 3300005937 | Ga0081455_10094323 | Ga0081455_100943232 | 496 |
| 43 | 3300006058 | Ga0075432_10012695 | Ga0075432_100126952 | 496 |
| 44 | 3300006844 | Ga0075428_100000756 | Ga0075428_10000075628 | 496 |
| 45 | 3300006844 | Ga0075428_100042186 | Ga0075428_1000421862 | 496 |
| 46 | 3300006852 | Ga0075433_10087674 | Ga0075433_100876742 | 496 |
| 47 | 3300006880 | Ga0075429_100060377 | Ga0075429_1000603774 | 496 |
| 48 | 3300006931 | Ga0097620_100018501 | Ga0097620_1000185016 | 496 |
| 49 | 3300009094 | Ga0111539_10077981 | Ga0111539_100779812 | 496 |
| 50 | 3300009098 | Ga0105245_10004050 | Ga0105245_100040504 | 496 |
| 51 | 3300009101 | Ga0105247_10012624 | Ga0105247_100126244 | 496 |
| 52 | 3300009148 | Ga0105243_10006051 | Ga0105243_100060513 | 496 |
| 53 | 3300010375 | Ga0105239_10014607 | Ga0105239_100146076 | 496 |
| 54 | 3300013104 | Ga0157370_10052371 | Ga0157370_100523712 | 496 |
| 55 | 3300013296 | Ga0157374_10088530 | Ga0157374_100885302 | 496 |
| 56 | 3300013307 | Ga0157372_10085983 | Ga0157372_100859834 | 496 |
| 57 | 3300013308 | Ga0157375_10022636 | Ga0157375_100226367 | 496 |
| 58 | 3300014326 | Ga0157380_10015368 | Ga0157380_100153685 | 496 |
| 59 | 3300014969 | Ga0157376_10042351 | Ga0157376_100423512 | 496 |
| 60 | 3300017792 | Ga0163161_10040039 | Ga0163161_100400394 | 496 |
| 61 | 3300025292 | Ga0209676_1000307 | Ga0209676_100030782 | 496 |
| 62 | 3300025298 | Ga0209050_1003024 | Ga0209050_10030248 | 496 |
| 63 | 3300025303 | Ga0209051_1001868 | Ga0209051_100186814 | 496 |
| 64 | 3300025321 | Ga0207656_10026684 | Ga0207656_100266842 | 496 |
| 65 | 3300025728 | Ga0207655_1025199 | Ga0207655_10251991 | 496 |
| 66 | 3300025900 | Ga0207710_10004767 | Ga0207710_100047676 | 496 |
| 67 | 3300025907 | Ga0207645_10041262 | Ga0207645_100412622 | 496 |
| 68 | 3300025908 | Ga0207643_10013262 | Ga0207643_100132622 | 496 |
| 69 | 3300025909 | Ga0207705_10088662 | Ga0207705_100886622 | 496 |
| 70 | 3300025912 | Ga0207707_10124841 | Ga0207707_101248412 | 496 |
| 71 | 3300025917 | Ga0207660_10013073 | Ga0207660_100130734 | 496 |
| 72 | 3300025917 | Ga0207660_10026023 | Ga0207660_100260233 | 496 |
| 73 | 3300025918 | Ga0207662_10023915 | Ga0207662_100239153 | 496 |
| 74 | 3300025919 | Ga0207657_10023809 | Ga0207657_100238093 | 496 |
| 75 | 3300025924 | Ga0207694_10034754 | Ga0207694_100347544 | 496 |
| 76 | 3300025927 | Ga0207687_10048475 | Ga0207687_100484752 | 496 |
| 77 | 3300025932 | Ga0207690_10061452 | Ga0207690_100614522 | 496 |
| 78 | 3300025935 | Ga0207709_10035654 | Ga0207709_100356543 | 496 |
| 79 | 3300025937 | Ga0207669_10039479 | Ga0207669_100394792 | 496 |
| 80 | 3300025940 | Ga0207691_10010200 | Ga0207691_100102006 | 496 |
| 81 | 3300025941 | Ga0207711_10039269 | Ga0207711_100392694 | 496 |
| 82 | 3300025944 | Ga0207661_10002360 | Ga0207661_1000236011 | 496 |
| 83 | 3300025944 | Ga0207661_10139443 | Ga0207661_101394432 | 496 |
| 84 | 3300025944 | Ga0207661_10152895 | Ga0207661_101528952 | 496 |
| 85 | 3300025972 | Ga0207668_10045064 | Ga0207668_100450642 | 496 |
| 86 | 3300025981 | Ga0207640_10098101 | Ga0207640_100981012 | 496 |
| 87 | 3300026023 | Ga0207677_10014291 | Ga0207677_100142913 | 496 |
| 88 | 3300026067 | Ga0207678_10022747 | Ga0207678_100227472 | 496 |
| 89 | 3300026075 | Ga0207708_10010152 | Ga0207708_100101526 | 496 |
| 90 | 3300026095 | Ga0207676_10059727 | Ga0207676_100597272 | 496 |
| 91 | 3300026116 | Ga0207674_10110549 | Ga0207674_101105492 | 496 |
| 92 | 3300026118 | Ga0207675_100103433 | Ga0207675_1001034332 | 496 |
| 93 | 3300027907 | Ga0207428_10000525 | Ga0207428_1000052533 | 496 |
| 94 | 3300027907 | Ga0207428_10122484 | Ga0207428_101224841 | 496 |
| 95 | 3300027907 | Ga0207428_10130140 | Ga0207428_101301402 | 496 |
| 96 | 3300048905 | Ga0496102_0063325 | Ga0496102_0063325_886_2535 | 496 |
| 97 | 3300048907 | Ga0496104_0071226 | Ga0496104_0071226_1353_2999 | 496 |
| 98 | 3300048908 | Ga0496105_0034676 | Ga0496105_0034676_1580_3229 | 496 |
| 99 | 3300048911 | Ga0496108_0026526 | Ga0496108_0026526_1257_2906 | 496 |
| 100 | 3300048911 | Ga0496108_0058422 | Ga0496108_0058422_325_1971 | 496 |
| 101 | 3300048912 | Ga0496109_0117816 | Ga0496109_0117816_172_1818 | 496 |
| 102 | 3300048913 | Ga0496110_0006233 | Ga0496110_0006233_5548_7194 | 496 |
| 103 | 3300048913 | Ga0496110_0021523 | Ga0496110_0021523_1638_3287 | 496 |
| 104 | 3300048914 | Ga0496111_0004949 | Ga0496111_0004949_1400_3046 | 496 |
| 105 | 3300048917 | Ga0496114_0026280 | Ga0496114_0026280_1897_3546 | 496 |
| 106 | 3300049572 | Ga0501036_0007242 | Ga0501036_0007242_5491_7137 | 496 |
| 107 | 3300049574 | Ga0501038_0016982 | Ga0501038_0016982_1321_2967 | 496 |
| 108 | 3300049575 | Ga0501039_0031982 | Ga0501039_0031982_682_2328 | 496 |
| 109 | 3300049576 | Ga0501040_0007347 | Ga0501040_0007347_3089_4735 | 496 |
| 110 | 3300049577 | Ga0501041_0022155 | Ga0501041_0022155_1360_3006 | 496 |
| 111 | 3300049578 | Ga0501042_0008684 | Ga0501042_0008684_1341_2987 | 496 |
| 112 | 3300049580 | Ga0501046_0057586 | Ga0501046_0057586_52_1698 | 496 |
| 113 | 3300049583 | Ga0501067_0051951 | Ga0501067_0051951_196_1842 | 496 |
| 114 | 3300049584 | Ga0501068_0064774 | Ga0501068_0064774_53_1699 | 496 |
| 115 | 3300049587 | Ga0501071_0004658 | Ga0501071_0004658_2705_4351 | 496 |
| 116 | 3300049587 | Ga0501071_0061608 | Ga0501071_0061608_615_2261 | 496 |
| 117 | 3300049588 | Ga0501072_0019775 | Ga0501072_0019775_246_1892 | 496 |
| 118 | 3300049588 | Ga0501072_0025135 | Ga0501072_0025135_2070_3716 | 496 |
| 119 | 3300049591 | Ga0501075_0013262 | Ga0501075_0013262_331_1977 | 496 |
| 120 | 3300049592 | Ga0501076_0000735 | Ga0501076_0000735_6423_8069 | 496 |
| 121 | 3300049592 | Ga0501076_0018666 | Ga0501076_0018666_330_1976 | 496 |
| 122 | 3300049593 | Ga0501077_0008969 | Ga0501077_0008969_2588_4234 | 496 |
| 123 | 3300049741 | Ga0501079_0009838 | Ga0501079_0009838_2879_4525 | 496 |
| 124 | 3300049742 | Ga0501080_0034608 | Ga0501080_0034608_1750_3396 | 496 |
| 125 | 3300049743 | Ga0501081_0016140 | Ga0501081_0016140_1611_3257 | 496 |
| 126 | 3300049744 | Ga0501083_0007845 | Ga0501083_0007845_3107_4753 | 496 |
| 127 | 3300049822 | Ga0501035_0055937 | Ga0501035_0055937_633_2279 | 496 |
| 128 | 3300049824 | Ga0501045_0007245 | Ga0501045_0007245_2906_4552 | 496 |
| 129 | 3300050508 | nmdc:mga09592_117865_c1 | nmdc:mga09592_117865_c1_44_1690 | 496 |
| 130 | 3300050511 | nmdc:mga08y16_77603_c1 | nmdc:mga08y16_77603_c1_1132_2778 | 496 |
| 131 | 3300050515 | nmdc:mga0a205_134057_c1 | nmdc:mga0a205_134057_c1_348_1994 | 496 |
| 132 | 3300054114 | Ga0501084_0005639 | Ga0501084_0005639_8062_9708 | 496 |
| 133 | 3300061734 | Ga0530510_0009755 | Ga0530510_0009755_1300_2946 | 496 |
| 134 | 3300005355 | Ga0070671_100054204 | Ga0070671_1000542042 | 497 |
| 135 | 3300005456 | Ga0070678_100034564 | Ga0070678_1000345642 | 497 |
| 136 | 3300009551 | Ga0105238_10065270 | Ga0105238_100652703 | 497 |
| 137 | 3300031731 | Ga0307405_10034459 | Ga0307405_100344593 | 497 |
| 138 | 3300032002 | Ga0307416_100026833 | Ga0307416_1000268333 | 497 |
| 139 | 3300032126 | Ga0307415_100011908 | Ga0307415_1000119082 | 497 |
| 140 | 3300005563 | Ga0068855_100004160 | Ga0068855_1000041603 | 498 |
| 141 | 3300025912 | Ga0207707_10001945 | Ga0207707_1000194520 | 498 |
| 142 | 3300025913 | Ga0207695_10003505 | Ga0207695_100035054 | 498 |
| 143 | 3300025921 | Ga0207652_10001697 | Ga0207652_100016977 | 498 |
| 144 | 3300025949 | Ga0207667_10003700 | Ga0207667_100037003 | 498 |
| 145 | 3300005458 | Ga0070681_10084357 | Ga0070681_100843572 | 499 |
| 146 | 3300025912 | Ga0207707_10056114 | Ga0207707_100561143 | 499 |
| 147 | 3300025913 | Ga0207695_10017072 | Ga0207695_100170723 | 499 |
| 148 | 3300025931 | Ga0207644_10051072 | Ga0207644_100510722 | 499 |
| 149 | 3300025941 | Ga0207711_10115276 | Ga0207711_101152762 | 499 |
| 150 | 3300050492 | nmdc:mga0yw44_54155_c1 | nmdc:mga0yw44_54155_c1_168_1931 | 499 |
| 151 | 3300005289 | Ga0065704_10010850 | Ga0065704_100108501 | 500 |
| 152 | 3300005347 | Ga0070668_100003090 | Ga0070668_1000030902 | 500 |
| 153 | 3300005456 | Ga0070678_100010305 | Ga0070678_1000103054 | 500 |
| 154 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002245 | 500 |
| 155 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001328 | 500 |
| 156 | 3300025935 | Ga0207709_10003953 | Ga0207709_100039534 | 500 |
| 157 | 3300026121 | Ga0207683_10031823 | Ga0207683_100318233 | 500 |
| 158 | 3300039437 | Ga0436365_0332720 | Ga0436365_0332720_147969_149834 | 500 |
| 159 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_690790_692655 | 500 |
| 160 | 3300048919 | Ga0496116_0017050 | Ga0496116_0017050_3153_4760 | 500 |
| 161 | 3300003771 | Ga0055526_1007422 | Ga0055526_10074223 | 501 |
| 162 | 3300003773 | Ga0055537_1000177 | Ga0055537_10001773 | 501 |
| 163 | 3300003775 | Ga0055524_1004106 | Ga0055524_10041063 | 501 |
| 164 | 3300003784 | Ga0055534_1002897 | Ga0055534_10028976 | 501 |
| 165 | 3300003790 | Ga0055528_1000045 | Ga0055528_10000453 | 501 |
| 166 | 3300006038 | Ga0075365_10087655 | Ga0075365_100876552 | 501 |
| 167 | 3300017792 | Ga0163161_10067418 | Ga0163161_100674183 | 501 |
| 168 | 3300025263 | Ga0209565_1000037 | Ga0209565_1000037252 | 501 |
| 169 | 3300025273 | Ga0209673_1000494 | Ga0209673_100049445 | 501 |
| 170 | 3300025291 | Ga0209675_1000020 | Ga0209675_1000020287 | 501 |
| 171 | 3300025295 | Ga0209564_1000993 | Ga0209564_100099315 | 501 |
| 172 | 3300025299 | Ga0209256_1008116 | Ga0209256_10081162 | 501 |
| 173 | 3300025304 | Ga0209257_1004202 | Ga0209257_10042026 | 501 |
| 174 | 3300028800 | Ga0265338_10020079 | Ga0265338_100200793 | 501 |
| 175 | 3300031548 | Ga0307408_100029498 | Ga0307408_1000294982 | 501 |
| 176 | 3300047320 | Ga0495672_0001004 | Ga0495672_0001004_12776_14386 | 501 |
| 177 | 3300005441 | Ga0070700_100000104 | Ga0070700_10000010422 | 502 |
| 178 | 3300005467 | Ga0070706_100017295 | Ga0070706_1000172956 | 502 |
| 179 | 3300025910 | Ga0207684_10004441 | Ga0207684_1000444110 | 502 |
| 180 | 3300025942 | Ga0207689_10014485 | Ga0207689_100144854 | 502 |
| 181 | 3300026075 | Ga0207708_10000012 | Ga0207708_10000012132 | 502 |
| 182 | 3300039437 | Ga0436365_0741332 | Ga0436365_0741332_1226_2968 | 502 |
| 183 | 3300039437 | Ga0436365_1089890 | Ga0436365_1089890_3977_5707 | 502 |
| 184 | 3300025920 | Ga0207649_10043513 | Ga0207649_100435132 | 503 |
| 185 | 3300053083 | Ga0495655_0007332 | Ga0495655_0007332_216_1988 | 503 |
| 186 | 3300009093 | Ga0105240_10018998 | Ga0105240_100189988 | 504 |
| 187 | 3300025913 | Ga0207695_10046498 | Ga0207695_100464983 | 504 |
| 188 | 3300039437 | Ga0436365_1342523 | Ga0436365_1342523_4515_6251 | 504 |
| 189 | 3300005466 | Ga0070685_10059000 | Ga0070685_100590002 | 505 |
| 190 | 3300005467 | Ga0070706_100101580 | Ga0070706_1001015802 | 505 |
| 191 | 3300006871 | Ga0075434_100041707 | Ga0075434_1000417071 | 505 |
| 192 | 3300039437 | Ga0436365_1912664 | Ga0436365_1912664_3329_5080 | 505 |
| 193 | 3300042435 | Ga0439434_0018522 | Ga0439434_0018522_305_2029 | 505 |
| 194 | 3300025304 | Ga0209257_1000091 | Ga0209257_100009185 | 506 |
| 195 | 3300047471 | Ga0495684_0087390 | Ga0495684_0087390_247_1947 | 506 |
| 196 | 3300005330 | Ga0070690_100025032 | Ga0070690_1000250324 | 507 |
| 197 | 3300005331 | Ga0070670_100012630 | Ga0070670_1000126301 | 507 |
| 198 | 3300005438 | Ga0070701_10004769 | Ga0070701_100047692 | 507 |
| 199 | 3300005459 | Ga0068867_100000995 | Ga0068867_1000009957 | 507 |
| 200 | 3300005518 | Ga0070699_100005984 | Ga0070699_1000059842 | 507 |
| 201 | 3300005543 | Ga0070672_100009930 | Ga0070672_1000099304 | 507 |
| 202 | 3300005544 | Ga0070686_100083119 | Ga0070686_1000831192 | 507 |
| 203 | 3300005549 | Ga0070704_100013674 | Ga0070704_1000136743 | 507 |
| 204 | 3300005564 | Ga0070664_100008165 | Ga0070664_1000081656 | 507 |
| 205 | 3300005577 | Ga0068857_100018875 | Ga0068857_1000188754 | 507 |
| 206 | 3300005617 | Ga0068859_100010679 | Ga0068859_1000106796 | 507 |
| 207 | 3300005719 | Ga0068861_100068431 | Ga0068861_1000684312 | 507 |
| 208 | 3300005840 | Ga0068870_10000244 | Ga0068870_1000024418 | 507 |
| 209 | 3300006931 | Ga0097620_100010682 | Ga0097620_1000106826 | 507 |
| 210 | 3300009094 | Ga0111539_10168068 | Ga0111539_101680682 | 507 |
| 211 | 3300009553 | Ga0105249_10012001 | Ga0105249_100120014 | 507 |
| 212 | 3300013297 | Ga0157378_10118480 | Ga0157378_101184802 | 507 |
| 213 | 3300013308 | Ga0157375_10028477 | Ga0157375_100284774 | 507 |
| 214 | 3300021384 | Ga0213876_10008103 | Ga0213876_100081032 | 507 |
| 215 | 3300025908 | Ga0207643_10016159 | Ga0207643_100161592 | 507 |
| 216 | 3300025926 | Ga0207659_10000617 | Ga0207659_100006179 | 507 |
| 217 | 3300025936 | Ga0207670_10041302 | Ga0207670_100413024 | 507 |
| 218 | 3300025936 | Ga0207670_10051769 | Ga0207670_100517692 | 507 |
| 219 | 3300025940 | Ga0207691_10009037 | Ga0207691_100090375 | 507 |
| 220 | 3300025940 | Ga0207691_10010403 | Ga0207691_100104034 | 507 |
| 221 | 3300025942 | Ga0207689_10112758 | Ga0207689_101127582 | 507 |
| 222 | 3300025972 | Ga0207668_10038784 | Ga0207668_100387842 | 507 |
| 223 | 3300026035 | Ga0207703_10082081 | Ga0207703_100820812 | 507 |
| 224 | 3300026089 | Ga0207648_10000375 | Ga0207648_1000037529 | 507 |
| 225 | 3300026095 | Ga0207676_10044867 | Ga0207676_100448672 | 507 |
| 226 | 3300026116 | Ga0207674_10043028 | Ga0207674_100430285 | 507 |
| 227 | 3300026118 | Ga0207675_100005097 | Ga0207675_10000509713 | 507 |
| 228 | 3300026121 | Ga0207683_10043872 | Ga0207683_100438722 | 507 |
| 229 | 3300027907 | Ga0207428_10060949 | Ga0207428_100609493 | 507 |
| 230 | 3300028380 | Ga0268265_10000263 | Ga0268265_1000026339 | 507 |
| 231 | 3300028381 | Ga0268264_10002400 | Ga0268264_1000240012 | 507 |
| 232 | 3300028800 | Ga0265338_10025006 | Ga0265338_100250066 | 507 |
| 233 | 3300031251 | Ga0265327_10000005 | Ga0265327_10000005166 | 507 |
| 234 | 3300037853 | Ga0436364_0822442 | Ga0436364_0822442_2752_4509 | 507 |
| 235 | 3300039437 | Ga0436365_0264177 | Ga0436365_0264177_892_2646 | 507 |
| 236 | 3300039437 | Ga0436365_1281712 | Ga0436365_1281712_812_2569 | 507 |
| 237 | 3300045976 | Ga0466967_0055360 | Ga0466967_0055360_734_2428 | 507 |
| 238 | 3300046683 | Ga0495658_0024804 | Ga0495658_0024804_701_2407 | 507 |
| 239 | 3300047321 | Ga0495676_0066783 | Ga0495676_0066783_624_2330 | 507 |
| 240 | 3300050509 | nmdc:mga0qj67_4864_c2 | nmdc:mga0qj67_4864_c2_7327_9036 | 507 |
| 241 | 3300050512 | nmdc:mga0n895_45134_c1 | nmdc:mga0n895_45134_c1_699_2402 | 507 |
| 242 | 3300050513 | nmdc:mga0rr50_133690_c1 | nmdc:mga0rr50_133690_c1_79_1782 | 507 |
| 243 | 3300006844 | Ga0075428_100055111 | Ga0075428_1000551115 | 508 |
| 244 | 3300009094 | Ga0111539_10011408 | Ga0111539_100114086 | 508 |
| 245 | 3300025918 | Ga0207662_10047449 | Ga0207662_100474492 | 508 |
| 246 | 3300036401 | Ga0373937_0276078 | Ga0373937_0276078_32_1561 | 508 |
| 247 | 3300005618 | Ga0068864_100006309 | Ga0068864_1000063093 | 509 |
| 248 | 3300006844 | Ga0075428_100014173 | Ga0075428_1000141733 | 509 |
| 249 | 3300009093 | Ga0105240_10005108 | Ga0105240_1000510819 | 509 |
| 250 | 3300014325 | Ga0163163_10046487 | Ga0163163_100464871 | 509 |
| 251 | 3300021384 | Ga0213876_10004239 | Ga0213876_100042394 | 509 |
| 252 | 3300026041 | Ga0207639_10000006 | Ga0207639_10000006280 | 509 |
| 253 | 3300026095 | Ga0207676_10016261 | Ga0207676_100162617 | 509 |
| 254 | 3300027907 | Ga0207428_10025102 | Ga0207428_100251024 | 509 |
| 255 | 3300031240 | Ga0265320_10007095 | Ga0265320_100070955 | 509 |
| 256 | 3300050511 | nmdc:mga08y16_73139_c1 | nmdc:mga08y16_73139_c1_1485_3152 | 509 |
| 257 | 3300050512 | nmdc:mga0n895_23617_c1 | nmdc:mga0n895_23617_c1_1479_3185 | 509 |
| 258 | 3300009094 | Ga0111539_10000903 | Ga0111539_1000090326 | 510 |
| 259 | 3300050508 | nmdc:mga09592_54214_c1 | nmdc:mga09592_54214_c1_19_1731 | 510 |
| 260 | 3300005335 | Ga0070666_10003449 | Ga0070666_100034499 | 511 |
| 261 | 3300005458 | Ga0070681_10011770 | Ga0070681_100117708 | 511 |
| 262 | 3300005468 | Ga0070707_100073024 | Ga0070707_1000730245 | 511 |
| 263 | 3300005536 | Ga0070697_100017194 | Ga0070697_1000171944 | 511 |
| 264 | 3300006028 | Ga0070717_10087829 | Ga0070717_100878291 | 511 |
| 265 | 3300006844 | Ga0075428_100008399 | Ga0075428_1000083995 | 511 |
| 266 | 3300006852 | Ga0075433_10088274 | Ga0075433_100882743 | 511 |
| 267 | 3300009147 | Ga0114129_10005112 | Ga0114129_100051125 | 511 |
| 268 | 3300025922 | Ga0207646_10005844 | Ga0207646_1000584410 | 511 |
| 269 | 3300025922 | Ga0207646_10006832 | Ga0207646_1000683210 | 511 |
| 270 | 3300046454 | Ga0495592_0000008 | Ga0495592_0000008_78804_80606 | 511 |
| 271 | 3300046476 | Ga0495662_0034466 | Ga0495662_0034466_369_2171 | 511 |
| 272 | 3300046514 | Ga0495618_0019297 | Ga0495618_0019297_1581_3383 | 511 |
| 273 | 3300046516 | Ga0495628_0000166 | Ga0495628_0000166_52771_54573 | 511 |
| 274 | 3300046543 | Ga0495645_0002948 | Ga0495645_0002948_9562_11364 | 511 |
| 275 | 3300046678 | Ga0495599_0029239 | Ga0495599_0029239_266_2068 | 511 |
| 276 | 3300050507 | nmdc:mga05p37_17027_c1 | nmdc:mga05p37_17027_c1_5569_7335 | 511 |
| 277 | 3300050508 | nmdc:mga09592_74464_c1 | nmdc:mga09592_74464_c1_47_1813 | 511 |
| 278 | 3300050512 | nmdc:mga0n895_39045_c1 | nmdc:mga0n895_39045_c1_979_2745 | 511 |
| 279 | 3300050515 | nmdc:mga0a205_36064_c1 | nmdc:mga0a205_36064_c1_2911_4677 | 511 |
| 280 | 3300060346 | Ga0587111_0000631 | Ga0587111_0000631_1393_3156 | 511 |
| 281 | 3300005445 | Ga0070708_100018452 | Ga0070708_1000184527 | 512 |
| 282 | 3300005518 | Ga0070699_100052736 | Ga0070699_1000527363 | 512 |
| 283 | 3300032137 | Ga0316585_10006452 | Ga0316585_100064524 | 512 |
| 284 | 3300036647 | Ga0316582_0008553 | Ga0316582_0008553_1706_3253 | 512 |
| 285 | 3300036712 | Ga0316584_0005118 | Ga0316584_0005118_1881_3428 | 512 |
| 286 | 3300005340 | Ga0070689_100065113 | Ga0070689_1000651132 | 513 |
| 287 | 3300005355 | Ga0070671_100010669 | Ga0070671_1000106691 | 513 |
| 288 | 3300005457 | Ga0070662_100047990 | Ga0070662_1000479902 | 513 |
| 289 | 3300005544 | Ga0070686_100006734 | Ga0070686_1000067346 | 513 |
| 290 | 3300009147 | Ga0114129_10010106 | Ga0114129_1001010613 | 513 |
| 291 | 3300010375 | Ga0105239_10174007 | Ga0105239_101740072 | 513 |
| 292 | 3300028381 | Ga0268264_10029986 | Ga0268264_100299864 | 513 |
| 293 | 3300031665 | Ga0316575_10026250 | Ga0316575_100262502 | 513 |
| 294 | 3300045051 | Ga0451576_0012996 | Ga0451576_0012996_2657_4387 | 513 |
| 295 | 3300050507 | nmdc:mga05p37_35507_c1 | nmdc:mga05p37_35507_c1_2030_3793 | 513 |
| 296 | 3300050515 | nmdc:mga0a205_13084_c1 | nmdc:mga0a205_13084_c1_5151_6914 | 513 |
| 297 | 3300005354 | Ga0070675_100035290 | Ga0070675_1000352903 | 514 |
| 298 | 3300005456 | Ga0070678_100062516 | Ga0070678_1000625162 | 514 |
| 299 | 3300005548 | Ga0070665_100024772 | Ga0070665_1000247725 | 514 |
| 300 | 3300005843 | Ga0068860_100033594 | Ga0068860_1000335948 | 514 |
| 301 | 3300006358 | Ga0068871_100011956 | Ga0068871_1000119566 | 514 |
| 302 | 3300006844 | Ga0075428_100012862 | Ga0075428_10001286210 | 514 |
| 303 | 3300006881 | Ga0068865_100025251 | Ga0068865_1000252513 | 514 |
| 304 | 3300009093 | Ga0105240_10007177 | Ga0105240_100071778 | 514 |
| 305 | 3300009098 | Ga0105245_10008265 | Ga0105245_100082654 | 514 |
| 306 | 3300013102 | Ga0157371_10012102 | Ga0157371_1001210210 | 514 |
| 307 | 3300025926 | Ga0207659_10045938 | Ga0207659_100459382 | 514 |
| 308 | 3300025927 | Ga0207687_10005201 | Ga0207687_100052016 | 514 |
| 309 | 3300028381 | Ga0268264_10000914 | Ga0268264_1000091435 | 514 |
| 310 | 3300028558 | Ga0265326_10001276 | Ga0265326_100012768 | 514 |
| 311 | 3300028563 | Ga0265319_1000747 | Ga0265319_10007477 | 514 |
| 312 | 3300028577 | Ga0265318_10003207 | Ga0265318_100032072 | 514 |
| 313 | 3300028653 | Ga0265323_10000215 | Ga0265323_100002153 | 514 |
| 314 | 3300028654 | Ga0265322_10000089 | Ga0265322_1000008935 | 514 |
| 315 | 3300028666 | Ga0265336_10000432 | Ga0265336_1000043220 | 514 |
| 316 | 3300028800 | Ga0265338_10002460 | Ga0265338_1000246011 | 514 |
| 317 | 3300028800 | Ga0265338_10006237 | Ga0265338_1000623711 | 514 |
| 318 | 3300028800 | Ga0265338_10006702 | Ga0265338_1000670210 | 514 |
| 319 | 3300029957 | Ga0265324_10000589 | Ga0265324_1000058916 | 514 |
| 320 | 3300031235 | Ga0265330_10001621 | Ga0265330_100016213 | 514 |
| 321 | 3300031238 | Ga0265332_10001623 | Ga0265332_1000162312 | 514 |
| 322 | 3300031239 | Ga0265328_10018376 | Ga0265328_100183761 | 514 |
| 323 | 3300031240 | Ga0265320_10000653 | Ga0265320_1000065323 | 514 |
| 324 | 3300031240 | Ga0265320_10014031 | Ga0265320_100140312 | 514 |
| 325 | 3300031241 | Ga0265325_10024796 | Ga0265325_100247961 | 514 |
| 326 | 3300031242 | Ga0265329_10000272 | Ga0265329_1000027214 | 514 |
| 327 | 3300031247 | Ga0265340_10003766 | Ga0265340_100037662 | 514 |
| 328 | 3300031247 | Ga0265340_10013223 | Ga0265340_100132236 | 514 |
| 329 | 3300031249 | Ga0265339_10000624 | Ga0265339_1000062414 | 514 |
| 330 | 3300031250 | Ga0265331_10001631 | Ga0265331_100016316 | 514 |
| 331 | 3300031344 | Ga0265316_10001836 | Ga0265316_1000183616 | 514 |
| 332 | 3300031595 | Ga0265313_10003911 | Ga0265313_100039117 | 514 |
| 333 | 3300031595 | Ga0265313_10031810 | Ga0265313_100318103 | 514 |
| 334 | 3300031711 | Ga0265314_10001492 | Ga0265314_1000149214 | 514 |
| 335 | 3300031712 | Ga0265342_10000142 | Ga0265342_1000014214 | 514 |
| 336 | 3300031712 | Ga0265342_10011896 | Ga0265342_100118966 | 514 |
| 337 | 3300035170 | Ga0373943_0022261 | Ga0373943_0022261_326_2098 | 514 |
| 338 | 3300035692 | Ga0373935_0028222 | Ga0373935_0028222_496_2268 | 514 |
| 339 | 3300037068 | Ga0373925_0001450 | Ga0373925_0001450_17244_19013 | 514 |
| 340 | 3300046459 | Ga0495629_0000024 | Ga0495629_0000024_39320_41089 | 514 |
| 341 | 3300046526 | Ga0495666_0000017 | Ga0495666_0000017_64925_66694 | 514 |
| 342 | 3300046535 | Ga0495586_0000120 | Ga0495586_0000120_37141_38910 | 514 |
| 343 | 3300046663 | Ga0495635_0000629 | Ga0495635_0000629_18669_20441 | 514 |
| 344 | 3300046663 | Ga0495635_0048401 | Ga0495635_0048401_679_2451 | 514 |
| 345 | 3300047321 | Ga0495676_0005941 | Ga0495676_0005941_2642_4411 | 514 |
| 346 | 3300047322 | Ga0495680_0001604 | Ga0495680_0001604_22162_23934 | 514 |
| 347 | 3300047471 | Ga0495684_0002350 | Ga0495684_0002350_4031_5803 | 514 |
| 348 | 3300048904 | Ga0496101_0000685 | Ga0496101_0000685_17968_19740 | 514 |
| 349 | 3300048905 | Ga0496102_0003011 | Ga0496102_0003011_10070_11821 | 514 |
| 350 | 3300048917 | Ga0496114_0002130 | Ga0496114_0002130_13081_14853 | 514 |
| 351 | 3300049591 | Ga0501075_0004287 | Ga0501075_0004287_1546_3309 | 514 |
| 352 | 3300049593 | Ga0501077_0000206 | Ga0501077_0000206_14105_15868 | 514 |
| 353 | 3300050509 | nmdc:mga0qj67_23614_c1 | nmdc:mga0qj67_23614_c1_1701_3458 | 514 |
| 354 | 3300050512 | nmdc:mga0n895_118143_c1 | nmdc:mga0n895_118143_c1_806_2545 | 514 |
| 355 | 3300060353 | Ga0501082_0000005 | Ga0501082_0000005_97271_99034 | 514 |
| 356 | 3300009094 | Ga0111539_10010083 | Ga0111539_1001008311 | 515 |
| 357 | 3300026035 | Ga0207703_10093545 | Ga0207703_100935452 | 515 |
| 358 | 3300042876 | Ga0451577_0022548 | Ga0451577_0022548_2936_4726 | 515 |
| 359 | 3300044673 | Ga0453683_0001132 | Ga0453683_0001132_15050_16819 | 515 |
| 360 | 3300049576 | Ga0501040_0006107 | Ga0501040_0006107_2907_4700 | 515 |
| 361 | 3300049577 | Ga0501041_0006178 | Ga0501041_0006178_2100_3893 | 515 |
| 362 | 3300049578 | Ga0501042_0010389 | Ga0501042_0010389_862_2655 | 515 |
| 363 | 3300049587 | Ga0501071_0008592 | Ga0501071_0008592_2516_4309 | 515 |
| 364 | 3300049591 | Ga0501075_0001743 | Ga0501075_0001743_1838_3631 | 515 |
| 365 | 3300049593 | Ga0501077_0008036 | Ga0501077_0008036_1617_3410 | 515 |
| 366 | 3300049742 | Ga0501080_0065414 | Ga0501080_0065414_162_1955 | 515 |
| 367 | 3300049743 | Ga0501081_0003310 | Ga0501081_0003310_15_1808 | 515 |
| 368 | 3300050511 | nmdc:mga08y16_12746_c1 | nmdc:mga08y16_12746_c1_1669_3423 | 515 |
| 369 | 3300054114 | Ga0501084_0009502 | Ga0501084_0009502_5974_7767 | 515 |
| 370 | 3300005331 | Ga0070670_100009318 | Ga0070670_1000093184 | 516 |
| 371 | 3300025925 | Ga0207650_10007091 | Ga0207650_100070916 | 516 |
| 372 | 3300031728 | Ga0316578_10014768 | Ga0316578_100147682 | 516 |
| 373 | 3300031733 | Ga0316577_10040013 | Ga0316577_100400133 | 516 |
| 374 | 3300032133 | Ga0316583_10004894 | Ga0316583_100048943 | 516 |
| 375 | 3300032137 | Ga0316585_10004587 | Ga0316585_100045875 | 516 |
| 376 | 3300032168 | Ga0316593_10000001 | Ga0316593_1000000122 | 516 |
| 377 | 3300036647 | Ga0316582_0000223 | Ga0316582_0000223_14939_16525 | 516 |
| 378 | 3300003775 | Ga0055524_1006970 | Ga0055524_10069702 | 517 |
| 379 | 3300009147 | Ga0114129_10019320 | Ga0114129_100193209 | 517 |
| 380 | 3300014326 | Ga0157380_10002857 | Ga0157380_1000285710 | 517 |
| 381 | 3300025900 | Ga0207710_10020698 | Ga0207710_100206983 | 517 |
| 382 | 3300031691 | Ga0316579_10062792 | Ga0316579_100627921 | 517 |
| 383 | 3300032168 | Ga0316593_10000372 | Ga0316593_1000037210 | 517 |
| 384 | 3300049580 | Ga0501046_0027727 | Ga0501046_0027727_2072_3832 | 517 |
| 385 | 3300049588 | Ga0501072_0036086 | Ga0501072_0036086_1665_3425 | 517 |
| 386 | 3300050507 | nmdc:mga05p37_33304_c1 | nmdc:mga05p37_33304_c1_47_1810 | 517 |
| 387 | 3300050511 | nmdc:mga08y16_18590_c1 | nmdc:mga08y16_18590_c1_1938_3704 | 517 |
| 388 | iso_pu_bacteria | 2524614729 | 2525556322 | 517 |
| 389 | iso_pu_bacteria | 2894414249 | 2894414928 | 517 |
| 390 | iso_pu_bacteria | 2919513703 | 2919514193 | 517 |
| 391 | iso_pu_bacteria | 2919675420 | 2919676032 | 517 |
| 392 | 3300005288 | Ga0065714_10068777 | Ga0065714_100687772 | 518 |
| 393 | 3300005290 | Ga0065712_10000389 | Ga0065712_100003898 | 518 |
| 394 | 3300005290 | Ga0065712_10002078 | Ga0065712_100020782 | 518 |
| 395 | 3300005293 | Ga0065715_10000231 | Ga0065715_1000023112 | 518 |
| 396 | 3300005293 | Ga0065715_10090395 | Ga0065715_100903958 | 518 |
| 397 | 3300005293 | Ga0065715_10103076 | Ga0065715_101030761 | 518 |
| 398 | 3300005295 | Ga0065707_10099691 | Ga0065707_100996912 | 518 |
| 399 | 3300005329 | Ga0070683_100000649 | Ga0070683_1000006493 | 518 |
| 400 | 3300005331 | Ga0070670_100018281 | Ga0070670_1000182812 | 518 |
| 401 | 3300005336 | Ga0070680_100045014 | Ga0070680_1000450145 | 518 |
| 402 | 3300005338 | Ga0068868_100002860 | Ga0068868_10000286015 | 518 |
| 403 | 3300005345 | Ga0070692_10008886 | Ga0070692_100088864 | 518 |
| 404 | 3300005353 | Ga0070669_100000352 | Ga0070669_10000035219 | 518 |
| 405 | 3300005354 | Ga0070675_100027987 | Ga0070675_1000279877 | 518 |
| 406 | 3300005355 | Ga0070671_100094732 | Ga0070671_1000947321 | 518 |
| 407 | 3300005364 | Ga0070673_100037962 | Ga0070673_1000379622 | 518 |
| 408 | 3300005365 | Ga0070688_100013815 | Ga0070688_1000138156 | 518 |
| 409 | 3300005436 | Ga0070713_100011224 | Ga0070713_1000112245 | 518 |
| 410 | 3300005455 | Ga0070663_100007029 | Ga0070663_1000070298 | 518 |
| 411 | 3300005456 | Ga0070678_100001166 | Ga0070678_1000011663 | 518 |
| 412 | 3300005466 | Ga0070685_10008340 | Ga0070685_100083406 | 518 |
| 413 | 3300005535 | Ga0070684_100003804 | Ga0070684_10000380410 | 518 |
| 414 | 3300005545 | Ga0070695_100057158 | Ga0070695_1000571582 | 518 |
| 415 | 3300005577 | Ga0068857_100159388 | Ga0068857_1001593882 | 518 |
| 416 | 3300005617 | Ga0068859_100007636 | Ga0068859_1000076364 | 518 |
| 417 | 3300005618 | Ga0068864_100044184 | Ga0068864_1000441846 | 518 |
| 418 | 3300005844 | Ga0068862_100005826 | Ga0068862_10000582611 | 518 |
| 419 | 3300005985 | Ga0081539_10000122 | Ga0081539_1000012211 | 518 |
| 420 | 3300006042 | Ga0075368_10019550 | Ga0075368_100195502 | 518 |
| 421 | 3300006178 | Ga0075367_10016574 | Ga0075367_100165745 | 518 |
| 422 | 3300006178 | Ga0075367_10049906 | Ga0075367_100499062 | 518 |
| 423 | 3300006195 | Ga0075366_10047802 | Ga0075366_100478022 | 518 |
| 424 | 3300006844 | Ga0075428_100005221 | Ga0075428_10000522112 | 518 |
| 425 | 3300006847 | Ga0075431_100039477 | Ga0075431_1000394772 | 518 |
| 426 | 3300006852 | Ga0075433_10000236 | Ga0075433_1000023631 | 518 |
| 427 | 3300006852 | Ga0075433_10004565 | Ga0075433_100045655 | 518 |
| 428 | 3300006871 | Ga0075434_100003430 | Ga0075434_1000034306 | 518 |
| 429 | 3300006871 | Ga0075434_100008145 | Ga0075434_1000081458 | 518 |
| 430 | 3300006931 | Ga0097620_100007636 | Ga0097620_10000763611 | 518 |
| 431 | 3300007076 | Ga0075435_100116643 | Ga0075435_1001166432 | 518 |
| 432 | 3300009094 | Ga0111539_10008858 | Ga0111539_100088585 | 518 |
| 433 | 3300009147 | Ga0114129_10006350 | Ga0114129_100063509 | 518 |
| 434 | 3300009147 | Ga0114129_10023573 | Ga0114129_100235736 | 518 |
| 435 | 3300009177 | Ga0105248_10021610 | Ga0105248_100216104 | 518 |
| 436 | 3300014325 | Ga0163163_10024047 | Ga0163163_100240472 | 518 |
| 437 | 3300014325 | Ga0163163_10024812 | Ga0163163_100248125 | 518 |
| 438 | 3300014326 | Ga0157380_10018808 | Ga0157380_100188085 | 518 |
| 439 | 3300014326 | Ga0157380_10120663 | Ga0157380_101206632 | 518 |
| 440 | 3300014745 | Ga0157377_10000260 | Ga0157377_1000026018 | 518 |
| 441 | 3300025315 | Ga0207697_10002245 | Ga0207697_100022454 | 518 |
| 442 | 3300025901 | Ga0207688_10010922 | Ga0207688_100109226 | 518 |
| 443 | 3300025907 | Ga0207645_10026691 | Ga0207645_100266913 | 518 |
| 444 | 3300025908 | Ga0207643_10049313 | Ga0207643_100493132 | 518 |
| 445 | 3300025918 | Ga0207662_10023471 | Ga0207662_100234713 | 518 |
| 446 | 3300025919 | Ga0207657_10010713 | Ga0207657_100107138 | 518 |
| 447 | 3300025925 | Ga0207650_10035554 | Ga0207650_100355542 | 518 |
| 448 | 3300025925 | Ga0207650_10036772 | Ga0207650_100367726 | 518 |
| 449 | 3300025928 | Ga0207700_10015684 | Ga0207700_100156845 | 518 |
| 450 | 3300025933 | Ga0207706_10066020 | Ga0207706_100660202 | 518 |
| 451 | 3300025937 | Ga0207669_10007218 | Ga0207669_100072183 | 518 |
| 452 | 3300025941 | Ga0207711_10015048 | Ga0207711_100150486 | 518 |
| 453 | 3300025944 | Ga0207661_10002465 | Ga0207661_100024656 | 518 |
| 454 | 3300025945 | Ga0207679_10017579 | Ga0207679_100175792 | 518 |
| 455 | 3300025960 | Ga0207651_10006179 | Ga0207651_100061793 | 518 |
| 456 | 3300026023 | Ga0207677_10000002 | Ga0207677_10000002236 | 518 |
| 457 | 3300026067 | Ga0207678_10017965 | Ga0207678_100179657 | 518 |
| 458 | 3300026075 | Ga0207708_10058240 | Ga0207708_100582402 | 518 |
| 459 | 3300026089 | Ga0207648_10013213 | Ga0207648_100132132 | 518 |
| 460 | 3300026095 | Ga0207676_10020445 | Ga0207676_100204452 | 518 |
| 461 | 3300026116 | Ga0207674_10050794 | Ga0207674_100507942 | 518 |
| 462 | 3300026118 | Ga0207675_100017249 | Ga0207675_1000172498 | 518 |
| 463 | 3300026121 | Ga0207683_10017830 | Ga0207683_100178303 | 518 |
| 464 | 3300027907 | Ga0207428_10001048 | Ga0207428_1000104814 | 518 |
| 465 | 3300027907 | Ga0207428_10125684 | Ga0207428_101256842 | 518 |
| 466 | 3300028380 | Ga0268265_10018414 | Ga0268265_100184148 | 518 |
| 467 | 3300028380 | Ga0268265_10034336 | Ga0268265_100343363 | 518 |
| 468 | 3300028558 | Ga0265326_10004659 | Ga0265326_100046596 | 518 |
| 469 | 3300031251 | Ga0265327_10000580 | Ga0265327_1000058032 | 518 |
| 470 | 3300031251 | Ga0265327_10016399 | Ga0265327_100163994 | 518 |
| 471 | 3300031344 | Ga0265316_10000234 | Ga0265316_1000023454 | 518 |
| 472 | 3300032005 | Ga0307411_10063644 | Ga0307411_100636442 | 518 |
| 473 | 3300035112 | Ga0373932_0000070 | Ga0373932_0000070_11968_13884 | 518 |
| 474 | 3300035118 | Ga0373954_0000506 | Ga0373954_0000506_4678_6270 | 518 |
| 475 | 3300035118 | Ga0373954_0003169 | Ga0373954_0003169_1172_2761 | 518 |
| 476 | 3300037068 | Ga0373925_0002115 | Ga0373925_0002115_1468_3234 | 518 |
| 477 | 3300046454 | Ga0495592_0000978 | Ga0495592_0000978_6237_7826 | 518 |
| 478 | 3300046516 | Ga0495628_0000681 | Ga0495628_0000681_6259_7848 | 518 |
| 479 | 3300046543 | Ga0495645_0003396 | Ga0495645_0003396_2636_4225 | 518 |
| 480 | 3300048905 | Ga0496102_0128752 | Ga0496102_0128752_319_2082 | 518 |
| 481 | 3300048907 | Ga0496104_0040764 | Ga0496104_0040764_2251_4014 | 518 |
| 482 | 3300048911 | Ga0496108_0030232 | Ga0496108_0030232_443_2206 | 518 |
| 483 | 3300048912 | Ga0496109_0002159 | Ga0496109_0002159_8489_10252 | 518 |
| 484 | 3300048912 | Ga0496109_0004351 | Ga0496109_0004351_2108_3871 | 518 |
| 485 | 3300048913 | Ga0496110_0005001 | Ga0496110_0005001_4260_6023 | 518 |
| 486 | 3300048913 | Ga0496110_0047217 | Ga0496110_0047217_303_2066 | 518 |
| 487 | 3300048914 | Ga0496111_0059782 | Ga0496111_0059782_932_2695 | 518 |
| 488 | 3300048915 | Ga0496112_0006706 | Ga0496112_0006706_1678_3441 | 518 |
| 489 | 3300048915 | Ga0496112_0008524 | Ga0496112_0008524_1626_3389 | 518 |
| 490 | 3300048916 | Ga0496113_0119496 | Ga0496113_0119496_92_1855 | 518 |
| 491 | 3300048917 | Ga0496114_0003715 | Ga0496114_0003715_5193_6956 | 518 |
| 492 | 3300048927 | Ga0496124_0000115 | Ga0496124_0000115_139229_140845 | 518 |
| 493 | 3300049571 | Ga0501034_0021828 | Ga0501034_0021828_2965_4728 | 518 |
| 494 | 3300049572 | Ga0501036_0008524 | Ga0501036_0008524_2469_4241 | 518 |
| 495 | 3300049575 | Ga0501039_0082967 | Ga0501039_0082967_403_2166 | 518 |
| 496 | 3300049578 | Ga0501042_0021669 | Ga0501042_0021669_2508_4280 | 518 |
| 497 | 3300049578 | Ga0501042_0077171 | Ga0501042_0077171_559_2319 | 518 |
| 498 | 3300049582 | Ga0501048_0043297 | Ga0501048_0043297_1383_3155 | 518 |
| 499 | 3300049587 | Ga0501071_0019115 | Ga0501071_0019115_169_1941 | 518 |
| 500 | 3300049591 | Ga0501075_0027763 | Ga0501075_0027763_1135_2907 | 518 |
| 501 | 3300049592 | Ga0501076_0004937 | Ga0501076_0004937_1261_3033 | 518 |
| 502 | 3300050493 | nmdc:mga0k408_8449_c1 | nmdc:mga0k408_8449_c1_1987_3750 | 518 |
| 503 | 3300050507 | nmdc:mga05p37_116964_c1 | nmdc:mga05p37_116964_c1_360_2123 | 518 |
| 504 | 3300050507 | nmdc:mga05p37_12451_c1 | nmdc:mga05p37_12451_c1_4507_6273 | 518 |
| 505 | 3300050507 | nmdc:mga05p37_17769_c1 | nmdc:mga05p37_17769_c1_1313_3079 | 518 |
| 506 | 3300050507 | nmdc:mga05p37_7314_c1 | nmdc:mga05p37_7314_c1_7010_8770 | 518 |
| 507 | 3300050508 | nmdc:mga09592_1527_c1 | nmdc:mga09592_1527_c1_6590_8353 | 518 |
| 508 | 3300050508 | nmdc:mga09592_67230_c1 | nmdc:mga09592_67230_c1_167_1930 | 518 |
| 509 | 3300050509 | nmdc:mga0qj67_5865_c1 | nmdc:mga0qj67_5865_c1_5137_6900 | 518 |
| 510 | 3300050510 | nmdc:mga06r32_219004_c1 | nmdc:mga06r32_219004_c1_38_1801 | 518 |
| 511 | 3300050510 | nmdc:mga06r32_67060_c1 | nmdc:mga06r32_67060_c1_821_2584 | 518 |
| 512 | 3300050511 | nmdc:mga08y16_7357_c1 | nmdc:mga08y16_7357_c1_795_2558 | 518 |
| 513 | 3300050512 | nmdc:mga0n895_123078_c1 | nmdc:mga0n895_123078_c1_836_2602 | 518 |
| 514 | 3300050512 | nmdc:mga0n895_2440_c1 | nmdc:mga0n895_2440_c1_7346_9106 | 518 |
| 515 | 3300050512 | nmdc:mga0n895_58225_c1 | nmdc:mga0n895_58225_c1_1171_2934 | 518 |
| 516 | 3300050513 | nmdc:mga0rr50_127864_c1 | nmdc:mga0rr50_127864_c1_193_1959 | 518 |
| 517 | 3300050513 | nmdc:mga0rr50_7901_c1 | nmdc:mga0rr50_7901_c1_4276_6036 | 518 |
| 518 | 3300050515 | nmdc:mga0a205_10361_c1 | nmdc:mga0a205_10361_c1_4774_6537 | 518 |
| 519 | 3300050515 | nmdc:mga0a205_293_c2 | nmdc:mga0a205_293_c2_5430_7190 | 518 |
| 520 | 3300050515 | nmdc:mga0a205_9784_c1 | nmdc:mga0a205_9784_c1_3368_5128 | 518 |
| 521 | 3300053096 | Ga0500641_0000973 | Ga0500641_0000973_408_2171 | 518 |
| 522 | 3300053139 | Ga0500568_0006841 | Ga0500568_0006841_2189_3949 | 518 |
| 523 | iso_pu_bacteria | 2545555834 | 2545679529 | 518 |
| 524 | iso_pu_bacteria | 2824600985 | 2824602316 | 518 |
| 525 | iso_pu_bacteria | 2824609381 | 2824610590 | 518 |
| 526 | iso_pu_bacteria | 2824653114 | 2824654284 | 518 |
| 527 | iso_pu_bacteria | 2888419890 | 2888424964 | 518 |
| 528 | iso_pu_bacteria | 641522639 | 641644058 | 518 |
| 529 | iso_pu_bacteria | 643348564 | 643600090 | 518 |
| 530 | iso_pu_bacteria | 8006964411 | 8006965326 | 518 |
| 531 | iso_pu_bacteria | 8006994254 | 8006996760 | 518 |
| 532 | 3300005295 | Ga0065707_10088172 | Ga0065707_100881723 | 519 |
| 533 | 3300005327 | Ga0070658_10006034 | Ga0070658_100060343 | 519 |
| 534 | 3300005331 | Ga0070670_100000094 | Ga0070670_10000009415 | 519 |
| 535 | 3300005334 | Ga0068869_100007312 | Ga0068869_1000073124 | 519 |
| 536 | 3300005338 | Ga0068868_100000245 | Ga0068868_10000024520 | 519 |
| 537 | 3300005340 | Ga0070689_100002543 | Ga0070689_10000254314 | 519 |
| 538 | 3300005340 | Ga0070689_100105692 | Ga0070689_1001056922 | 519 |
| 539 | 3300005353 | Ga0070669_100000348 | Ga0070669_10000034829 | 519 |
| 540 | 3300005354 | Ga0070675_100000020 | Ga0070675_10000002084 | 519 |
| 541 | 3300005445 | Ga0070708_100124786 | Ga0070708_1001247862 | 519 |
| 542 | 3300005467 | Ga0070706_100018329 | Ga0070706_1000183298 | 519 |
| 543 | 3300005518 | Ga0070699_100005764 | Ga0070699_1000057641 | 519 |
| 544 | 3300005518 | Ga0070699_100064587 | Ga0070699_1000645872 | 519 |
| 545 | 3300005535 | Ga0070684_100001971 | Ga0070684_1000019714 | 519 |
| 546 | 3300005536 | Ga0070697_100015122 | Ga0070697_1000151223 | 519 |
| 547 | 3300005543 | Ga0070672_100000242 | Ga0070672_1000002422 | 519 |
| 548 | 3300005547 | Ga0070693_100019125 | Ga0070693_1000191252 | 519 |
| 549 | 3300005578 | Ga0068854_100002935 | Ga0068854_1000029354 | 519 |
| 550 | 3300005578 | Ga0068854_100033338 | Ga0068854_1000333383 | 519 |
| 551 | 3300005615 | Ga0070702_100004921 | Ga0070702_1000049218 | 519 |
| 552 | 3300005618 | Ga0068864_100000013 | Ga0068864_10000001318 | 519 |
| 553 | 3300005842 | Ga0068858_100000011 | Ga0068858_10000001137 | 519 |
| 554 | 3300005844 | Ga0068862_100000275 | Ga0068862_1000002754 | 519 |
| 555 | 3300006028 | Ga0070717_10000046 | Ga0070717_1000004613 | 519 |
| 556 | 3300006847 | Ga0075431_100001877 | Ga0075431_10000187719 | 519 |
| 557 | 3300006847 | Ga0075431_100036608 | Ga0075431_1000366083 | 519 |
| 558 | 3300006871 | Ga0075434_100035219 | Ga0075434_1000352197 | 519 |
| 559 | 3300006880 | Ga0075429_100038415 | Ga0075429_1000384153 | 519 |
| 560 | 3300006914 | Ga0075436_100000808 | Ga0075436_1000008087 | 519 |
| 561 | 3300006914 | Ga0075436_100004058 | Ga0075436_1000040586 | 519 |
| 562 | 3300006914 | Ga0075436_100011107 | Ga0075436_1000111076 | 519 |
| 563 | 3300007076 | Ga0075435_100000784 | Ga0075435_1000007846 | 519 |
| 564 | 3300009036 | Ga0105244_10006538 | Ga0105244_100065383 | 519 |
| 565 | 3300009093 | Ga0105240_10167631 | Ga0105240_101676311 | 519 |
| 566 | 3300009094 | Ga0111539_10000031 | Ga0111539_1000003135 | 519 |
| 567 | 3300009098 | Ga0105245_10000727 | Ga0105245_1000072717 | 519 |
| 568 | 3300009098 | Ga0105245_10001167 | Ga0105245_1000116719 | 519 |
| 569 | 3300009551 | Ga0105238_10000030 | Ga0105238_1000003087 | 519 |
| 570 | 3300013105 | Ga0157369_10000404 | Ga0157369_1000040430 | 519 |
| 571 | 3300013296 | Ga0157374_10000020 | Ga0157374_10000020186 | 519 |
| 572 | 3300013297 | Ga0157378_10003050 | Ga0157378_1000305011 | 519 |
| 573 | 3300013297 | Ga0157378_10009761 | Ga0157378_100097613 | 519 |
| 574 | 3300013308 | Ga0157375_10000024 | Ga0157375_10000024126 | 519 |
| 575 | 3300013308 | Ga0157375_10000389 | Ga0157375_1000038920 | 519 |
| 576 | 3300014745 | Ga0157377_10000031 | Ga0157377_1000003130 | 519 |
| 577 | 3300014969 | Ga0157376_10000003 | Ga0157376_1000000382 | 519 |
| 578 | 3300021384 | Ga0213876_10000135 | Ga0213876_1000013536 | 519 |
| 579 | 3300025909 | Ga0207705_10047196 | Ga0207705_100471963 | 519 |
| 580 | 3300025917 | Ga0207660_10005193 | Ga0207660_100051934 | 519 |
| 581 | 3300025923 | Ga0207681_10000305 | Ga0207681_1000030511 | 519 |
| 582 | 3300025924 | Ga0207694_10000002 | Ga0207694_100000021012 | 519 |
| 583 | 3300025924 | Ga0207694_10000003 | Ga0207694_1000000388 | 519 |
| 584 | 3300025925 | Ga0207650_10000101 | Ga0207650_1000010115 | 519 |
| 585 | 3300025926 | Ga0207659_10000035 | Ga0207659_1000003518 | 519 |
| 586 | 3300025927 | Ga0207687_10000024 | Ga0207687_1000002438 | 519 |
| 587 | 3300025927 | Ga0207687_10000301 | Ga0207687_1000030110 | 519 |
| 588 | 3300025936 | Ga0207670_10001271 | Ga0207670_1000127116 | 519 |
| 589 | 3300025939 | Ga0207665_10035772 | Ga0207665_100357721 | 519 |
| 590 | 3300025940 | Ga0207691_10000444 | Ga0207691_1000044412 | 519 |
| 591 | 3300025942 | Ga0207689_10006141 | Ga0207689_100061412 | 519 |
| 592 | 3300025944 | Ga0207661_10000022 | Ga0207661_10000022171 | 519 |
| 593 | 3300025981 | Ga0207640_10004476 | Ga0207640_100044762 | 519 |
| 594 | 3300026023 | Ga0207677_10000264 | Ga0207677_1000026430 | 519 |
| 595 | 3300026035 | Ga0207703_10000004 | Ga0207703_10000004323 | 519 |
| 596 | 3300026095 | Ga0207676_10000030 | Ga0207676_10000030146 | 519 |
| 597 | 3300026118 | Ga0207675_100140367 | Ga0207675_1001403671 | 519 |
| 598 | 3300027876 | Ga0209974_10003969 | Ga0209974_100039692 | 519 |
| 599 | 3300027907 | Ga0207428_10000012 | Ga0207428_1000001271 | 519 |
| 600 | 3300028380 | Ga0268265_10000191 | Ga0268265_1000019124 | 519 |
| 601 | 3300028563 | Ga0265319_1000001 | Ga0265319_1000001466 | 519 |
| 602 | 3300028654 | Ga0265322_10000224 | Ga0265322_1000022410 | 519 |
| 603 | 3300028800 | Ga0265338_10000111 | Ga0265338_1000011196 | 519 |
| 604 | 3300028800 | Ga0265338_10000607 | Ga0265338_100006079 | 519 |
| 605 | 3300028800 | Ga0265338_10027459 | Ga0265338_100274598 | 519 |
| 606 | 3300029957 | Ga0265324_10000978 | Ga0265324_100009786 | 519 |
| 607 | 3300031240 | Ga0265320_10003110 | Ga0265320_100031103 | 519 |
| 608 | 3300031251 | Ga0265327_10024010 | Ga0265327_100240103 | 519 |
| 609 | 3300031595 | Ga0265313_10000870 | Ga0265313_1000087011 | 519 |
| 610 | 3300035241 | Ga0373961_0000401 | Ga0373961_0000401_15796_17565 | 519 |
| 611 | 3300039437 | Ga0436365_0832427 | Ga0436365_0832427_66817_68694 | 519 |
| 612 | 3300039453 | Ga0436362_0086070 | Ga0436362_0086070_3127_5004 | 519 |
| 613 | 3300045051 | Ga0451576_0001932 | Ga0451576_0001932_13761_15554 | 519 |
| 614 | 3300046459 | Ga0495629_0085355 | Ga0495629_0085355_369_2153 | 519 |
| 615 | 3300046515 | Ga0495620_0000745 | Ga0495620_0000745_14348_16216 | 519 |
| 616 | 3300046557 | Ga0495622_0018006 | Ga0495622_0018006_768_2552 | 519 |
| 617 | 3300047315 | Ga0495581_0014274 | Ga0495581_0014274_833_2617 | 519 |
| 618 | 3300048917 | Ga0496114_0000020 | Ga0496114_0000020_49975_51744 | 519 |
| 619 | 3300049589 | Ga0501073_0029110 | Ga0501073_0029110_485_2347 | 519 |
| 620 | 3300049742 | Ga0501080_0065709 | Ga0501080_0065709_767_2605 | 519 |
| 621 | 3300050508 | nmdc:mga09592_15514_c1 | nmdc:mga09592_15514_c1_824_2683 | 519 |
| 622 | 3300050510 | nmdc:mga06r32_1445_c1 | nmdc:mga06r32_1445_c1_6400_8262 | 519 |
| 623 | 3300050510 | nmdc:mga06r32_39938_c1 | nmdc:mga06r32_39938_c1_1358_3187 | 519 |
| 624 | 3300050510 | nmdc:mga06r32_49833_c1 | nmdc:mga06r32_49833_c1_2014_3888 | 519 |
| 625 | 3300050511 | nmdc:mga08y16_7_c1 | nmdc:mga08y16_7_c1_134590_136449 | 519 |
| 626 | 3300050512 | nmdc:mga0n895_3804_c1 | nmdc:mga0n895_3804_c1_7571_9337 | 519 |
| 627 | 3300050513 | nmdc:mga0rr50_31421_c1 | nmdc:mga0rr50_31421_c1_875_2797 | 519 |
| 628 | 3300050513 | nmdc:mga0rr50_542_c1 | nmdc:mga0rr50_542_c1_6818_8689 | 519 |
| 629 | 3300050514 | nmdc:mga08x19_1124_c1 | nmdc:mga08x19_1124_c1_7741_9612 | 519 |
| 630 | 3300050514 | nmdc:mga08x19_6281_c1 | nmdc:mga08x19_6281_c1_4672_6441 | 519 |
| 631 | 3300050515 | nmdc:mga0a205_65360_c1 | nmdc:mga0a205_65360_c1_194_1948 | 519 |
| 632 | 3300053083 | Ga0495655_0000117 | Ga0495655_0000117_7929_9800 | 519 |
| 633 | 3300005544 | Ga0070686_100074646 | Ga0070686_1000746461 | 520 |
| 634 | 3300005937 | Ga0081455_10026507 | Ga0081455_100265073 | 520 |
| 635 | 3300006844 | Ga0075428_100123777 | Ga0075428_1001237772 | 520 |
| 636 | 3300009094 | Ga0111539_10259863 | Ga0111539_102598631 | 520 |
| 637 | 3300009147 | Ga0114129_10103609 | Ga0114129_101036091 | 520 |
| 638 | 3300013306 | Ga0163162_10023217 | Ga0163162_100232171 | 520 |
| 639 | 3300025922 | Ga0207646_10027865 | Ga0207646_100278652 | 520 |
| 640 | 3300028556 | Ga0265337_1013714 | Ga0265337_10137142 | 520 |
| 641 | 3300028800 | Ga0265338_10011992 | Ga0265338_100119927 | 520 |
| 642 | 3300029957 | Ga0265324_10004432 | Ga0265324_100044326 | 520 |
| 643 | 3300031711 | Ga0265314_10001680 | Ga0265314_1000168011 | 520 |
| 644 | 3300031711 | Ga0265314_10071646 | Ga0265314_100716461 | 520 |
| 645 | 3300035117 | Ga0373953_0005805 | Ga0373953_0005805_1779_3368 | 520 |
| 646 | 3300035118 | Ga0373954_0007174 | Ga0373954_0007174_1166_2755 | 520 |
| 647 | 3300035120 | Ga0373957_0020329 | Ga0373957_0020329_325_1914 | 520 |
| 648 | 3300035692 | Ga0373935_0016410 | Ga0373935_0016410_2654_4243 | 520 |
| 649 | 3300036401 | Ga0373937_0022242 | Ga0373937_0022242_1477_3282 | 520 |
| 650 | 3300037068 | Ga0373925_0013654 | Ga0373925_0013654_4247_5836 | 520 |
| 651 | 3300042156 | Ga0439446_0005265 | Ga0439446_0005265_459_2111 | 520 |
| 652 | 3300042876 | Ga0451577_0043672 | Ga0451577_0043672_215_2032 | 520 |
| 653 | 3300045051 | Ga0451576_0030186 | Ga0451576_0030186_1201_3030 | 520 |
| 654 | 3300046463 | Ga0495653_0015810 | Ga0495653_0015810_2226_3815 | 520 |
| 655 | 3300046472 | Ga0495580_0075543 | Ga0495580_0075543_83_1672 | 520 |
| 656 | 3300046516 | Ga0495628_0014263 | Ga0495628_0014263_855_2444 | 520 |
| 657 | 3300046517 | Ga0495630_0009382 | Ga0495630_0009382_4317_5906 | 520 |
| 658 | 3300046559 | Ga0495667_0033781 | Ga0495667_0033781_735_2324 | 520 |
| 659 | 3300046675 | Ga0495657_0010602 | Ga0495657_0010602_1221_2810 | 520 |
| 660 | 3300046683 | Ga0495658_0080398 | Ga0495658_0080398_239_1828 | 520 |
| 661 | 3300046809 | Ga0495600_0015122 | Ga0495600_0015122_1520_3109 | 520 |
| 662 | 3300047317 | Ga0495604_0037893 | Ga0495604_0037893_24_1613 | 520 |
| 663 | 3300047319 | Ga0495674_0001483 | Ga0495674_0001483_544_2133 | 520 |
| 664 | 3300047471 | Ga0495684_0011475 | Ga0495684_0011475_1715_3304 | 520 |
| 665 | 3300005981 | Ga0081538_10030223 | Ga0081538_100302231 | 521 |
| 666 | 3300006173 | Ga0070716_100009457 | Ga0070716_1000094573 | 521 |
| 667 | 3300007265 | Ga0099794_10048342 | Ga0099794_100483422 | 521 |
| 668 | 3300007788 | Ga0099795_10011555 | Ga0099795_100115553 | 521 |
| 669 | 3300010159 | Ga0099796_10005087 | Ga0099796_100050873 | 521 |
| 670 | 3300017792 | Ga0163161_10091016 | Ga0163161_100910162 | 521 |
| 671 | 3300025939 | Ga0207665_10040660 | Ga0207665_100406605 | 521 |
| 672 | 3300025972 | Ga0207668_10051730 | Ga0207668_100517303 | 521 |
| 673 | 3300035086 | Ga0373934_0001195 | Ga0373934_0001195_3081_4670 | 521 |
| 674 | 3300035119 | Ga0373956_0000019 | Ga0373956_0000019_24325_25914 | 521 |
| 675 | 3300035119 | Ga0373956_0031830 | Ga0373956_0031830_260_2122 | 521 |
| 676 | 3300035120 | Ga0373957_0001675 | Ga0373957_0001675_245_1834 | 521 |
| 677 | 3300035172 | Ga0373955_0010696 | Ga0373955_0010696_1040_2629 | 521 |
| 678 | 3300035724 | Ga0373933_0001818 | Ga0373933_0001818_10205_11794 | 521 |
| 679 | 3300037466 | Ga0395898_0163807 | Ga0395898_0163807_185_1954 | 521 |
| 680 | 3300046460 | Ga0495638_0011225 | Ga0495638_0011225_2499_4244 | 521 |
| 681 | 3300046462 | Ga0495651_0000147 | Ga0495651_0000147_34108_35697 | 521 |
| 682 | 3300046514 | Ga0495618_0002272 | Ga0495618_0002272_8047_9909 | 521 |
| 683 | 3300046535 | Ga0495586_0000768 | Ga0495586_0000768_12835_14697 | 521 |
| 684 | 3300046642 | Ga0495634_0001642 | Ga0495634_0001642_10935_12797 | 521 |
| 685 | 3300049568 | Ga0501031_0000133 | Ga0501031_0000133_37665_39533 | 521 |
| 686 | 3300037312 | Ga0395899_0001243 | Ga0395899_0001243_1663_3315 | 522 |
| 687 | 3300037418 | Ga0395900_0005627 | Ga0395900_0005627_4413_6065 | 522 |
| 688 | 3300037466 | Ga0395898_0008569 | Ga0395898_0008569_4120_5772 | 522 |
| 689 | 3300037471 | Ga0395905_0014228 | Ga0395905_0014228_3608_5260 | 522 |
| 690 | 3300045051 | Ga0451576_0021397 | Ga0451576_0021397_567_2213 | 522 |
| 691 | 3300035089 | Ga0373944_0000152 | Ga0373944_0000152_552_2462 | 523 |
| 692 | 3300002772 | JGI25164J39214_1002626 | JGI25164J39214_10026262 | 525 |
| 693 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033150 | 525 |
| 694 | 3300003759 | Ga0055525_1000767 | Ga0055525_10007678 | 525 |
| 695 | 3300006353 | Ga0075370_10002711 | Ga0075370_100027114 | 525 |
| 696 | 3300025226 | Ga0209674_100064 | Ga0209674_10006498 | 525 |
| 697 | 3300025230 | Ga0209563_100099 | Ga0209563_10009998 | 525 |
| 698 | 3300025231 | Ga0207427_101039 | Ga0207427_10103912 | 525 |
| 699 | 3300025253 | Ga0209677_100175 | Ga0209677_10017539 | 525 |
| 700 | 3300025919 | Ga0207657_10061516 | Ga0207657_100615163 | 525 |
| 701 | 3300050496 | nmdc:mga07m45_2243_c2 | nmdc:mga07m45_2243_c2_3564_5195 | 525 |
| 702 | 3300005327 | Ga0070658_10050821 | Ga0070658_100508212 | 526 |
| 703 | 3300025253 | Ga0209677_104320 | Ga0209677_1043203 | 526 |
| 704 | 3300030521 | Ga0307511_10056147 | Ga0307511_100561473 | 526 |
| 705 | 3300046506 | Ga0495583_0000046 | Ga0495583_0000046_65656_67287 | 526 |
| 706 | 3300025256 | Ga0209759_1002013 | Ga0209759_10020134 | 527 |
| 707 | 3300003761 | Ga0055535_1000307 | Ga0055535_100030725 | 528 |
| 708 | 3300003763 | Ga0055529_1000488 | Ga0055529_100048823 | 528 |
| 709 | 3300003792 | Ga0055540_1008475 | Ga0055540_10084755 | 528 |
| 710 | 3300025242 | Ga0209258_100319 | Ga0209258_10031950 | 528 |
| 711 | 3300025256 | Ga0209759_1001175 | Ga0209759_10011757 | 528 |
| 712 | 3300025272 | Ga0209455_1000157 | Ga0209455_100015789 | 528 |
| 713 | 3300025303 | Ga0209051_1002067 | Ga0209051_100206712 | 528 |
| 714 | 3300047472 | Ga0495686_0017170 | Ga0495686_0017170_500_2131 | 528 |
| 715 | 3300053080 | Ga0500635_0000113 | Ga0500635_0000113_34872_36509 | 528 |
| 716 | 3300006195 | Ga0075366_10078940 | Ga0075366_100789402 | 529 |
| 717 | 3300025942 | Ga0207689_10006852 | Ga0207689_100068523 | 529 |
| 718 | 3300002705 | JGI25156J39149_1000740 | JGI25156J39149_100074010 | 530 |
| 719 | 3300002738 | JGI25154J39366_1003058 | JGI25154J39366_10030581 | 530 |
| 720 | 3300002741 | JGI25157J39369_1000021 | JGI25157J39369_100002113 | 530 |
| 721 | 3300002741 | JGI25157J39369_1000351 | JGI25157J39369_10003514 | 530 |
| 722 | 3300025242 | Ga0209258_100699 | Ga0209258_1006994 | 530 |
| 723 | 3300025246 | Ga0209646_1000060 | Ga0209646_1000060146 | 530 |
| 724 | 3300025250 | Ga0209026_1000049 | Ga0209026_1000049144 | 530 |
| 725 | 3300025253 | Ga0209677_100782 | Ga0209677_10078214 | 530 |
| 726 | 3300025256 | Ga0209759_1000069 | Ga0209759_1000069144 | 530 |
| 727 | 3300025913 | Ga0207695_10009579 | Ga0207695_100095792 | 530 |
| 728 | 3300026078 | Ga0207702_10005245 | Ga0207702_1000524512 | 530 |
| 729 | 3300028666 | Ga0265336_10000040 | Ga0265336_1000004035 | 530 |
| 730 | 3300029957 | Ga0265324_10034373 | Ga0265324_100343731 | 530 |
| 731 | 3300031730 | Ga0307516_10003164 | Ga0307516_1000316424 | 530 |
| 732 | 3300037312 | Ga0395899_0005394 | Ga0395899_0005394_4128_5849 | 530 |
| 733 | 3300037466 | Ga0395898_0025434 | Ga0395898_0025434_659_2296 | 530 |
| 734 | 3300038443 | Ga0395901_0003173 | Ga0395901_0003173_6809_8446 | 530 |
| 735 | 3300044683 | Ga0466965_0003310 | Ga0466965_0003310_2615_4243 | 530 |
| 736 | 3300044684 | Ga0466966_0009059 | Ga0466966_0009059_2411_4039 | 530 |
| 737 | 3300044693 | Ga0466961_0025989 | Ga0466961_0025989_943_2571 | 530 |
| 738 | 3300044706 | Ga0466964_0004084 | Ga0466964_0004084_1345_2973 | 530 |
| 739 | 3300044719 | Ga0466971_0004547 | Ga0466971_0004547_2732_4360 | 530 |
| 740 | 3300045049 | Ga0466959_0026708 | Ga0466959_0026708_2045_3673 | 530 |
| 741 | 3300045836 | Ga0466958_0007306 | Ga0466958_0007306_2431_4059 | 530 |
| 742 | 3300061719 | Ga0466962_0005278 | Ga0466962_0005278_3509_5137 | 530 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oma-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation | 0.9839 | 17 | 514 |
| 6pw1-assembly2.cif.gz_C | cytochrome c oxidase delta 16 | 0.9839 | 16 | 511 |
| 3omi-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation | 0.9833 | 17 | 511 |
| 1m57-assembly2.cif.gz_G | structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant)) | 0.9825 | 12 | 520 |
| 3ehb-assembly1.cif.gz_A | a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate | 0.9804 | 12 | 517 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9ZZX1_1_342_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9812 | 15 | 335 | 1.20.210.10 |
| af_Q7HP04_41_512_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9787 | 15 | 475 | 1.20.210.10 |
| af_O21042_10_509_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9731 | 16 | 482 | 1.20.210.10 |
| af_Q2FZK0_30_556_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9668 | 14 | 522 | 1.20.210.10 |
| af_P03878_1_258_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.966 | 15 | 257 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S5MDM5-F1-model_v4 | Cytochrome c oxidase subunit I | 0.994 | 31 | 314 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-A0A090SML1-F1-model_v4 | deleted | 0.9928 | 38 | 353 |
|
| AF-A0A1M7HXD2-F1-model_v4 | Cytochrome c oxidase subunit 1 | 0.9921 | 11 | 464 |
GO:0004129
GO:0009060 GO:0015990 GO:0020037 GO:0022904 GO:0045277 |
| AF-A0A097ZNF2-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.992 | 152 | 350 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
| AF-B4XVT4-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9919 | 157 | 366 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar