F478639

General Info

Members Datasets Scaffolds Average Seq Length
742 378 729 571

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10005193|Ga0207660_100051934
Length 641
Sequence VPPKRQIRVGSQWMYARDAQRALEEALRVAEAERAEHEHQIPFIRKYVFSTDHKWIGIQYAITALTFLLLGFSMMLLMRFQLAFPGESMAKIPVIGGMLVKLLGASNAPGGVMLPEFYNQLGAMHGTVMVFLAIVPLAVGAFGNYVVPLQIGAPDMAFPKLNMMSYWCYLPGGFLMLSSFFFPGGSANSGWTSYPPLSIIATQGQTIWILGMVLLITSSLLGSVNFIVTIFQLRAKGLTFMRLPFFVWAQLVTSFLLLLAFPPLEAAAILQLMDRVAGTSFFMPSGLVVSGTPLTNAGGGNPLLWQHLFWFLAHPEVYVLILPGMGIIAEVIANNTRKPLWGYKSLVGAGVFLGFMSFVVWAHHMFMTGMGTVISAFFQTTTMIISIPSVVILTALIISLWGASIRFTVPMLFALAFLPMFGIGGLTGLPLGLAASDIHLHDTYYVIAHFHYVVAPGTIFAMFAGIYYWFPKVTGRQMNEKLGKIHFWFSLLFINGVFLPMFLQGLMGVSRRLYDGGAQYAHAKPIIHTNLLISTSAWLLLAAQLPFIWNFFHSIFKGKRVGANHWNATTLEWAATTSPPLGHGNFAVIPQVYRGPYEYSVPGYDAADYLPQNVPDEPPHPPAEGEGGGMLAATAVAQREG

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
4 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
5 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
6 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
7 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
8 2919513703 Luteimonas sp. 3794 Isolate Unclassified
9 2919675420 Luteimonas terrae 4099 Isolate Unclassified
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
209 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
210 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
213 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
243 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
244 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
367 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
375 641522639 Methylobacterium sp. 4-46 Isolate Nodule
376 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
377 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
378 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0.4
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0.67
Rhizoplane 3.64
Rhizosphere 85.18
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000740 3300002705 Bacteria 17229
2 JGI25154J39366_1003058 3300002738 Bacteria 3774
3 JGI25157J39369_1000021 3300002741 Bacteria 163907
4 JGI25157J39369_1000351 3300002741 Bacteria 32381
5 JGI25164J39214_1002626 3300002772 Bacteria 2630
6 Ga0055533_1000033 3300003756 Bacteria 265716
7 Ga0055525_1000767 3300003759 Bacteria 10537
8 Ga0055535_1000307 3300003761 Bacteria 49806
9 Ga0055529_1000488 3300003763 Bacteria 36464
10 Ga0055526_1007422 3300003771 Bacteria 5698
11 Ga0055537_1000177 3300003773 Bacteria 47558
12 Ga0055524_1004106 3300003775 Bacteria 6824
13 Ga0055524_1006970 3300003775 Bacteria 4855
14 Ga0055536_1011983 3300003781 Bacteria 3262
15 Ga0055534_1002897 3300003784 Bacteria 5689
16 Ga0055528_1000045 3300003790 Bacteria 101917
17 Ga0055540_1008475 3300003792 Bacteria 3698
18 Ga0065714_10068777 3300005288 Bacteria 4549
19 Ga0065704_10010850 3300005289 Bacteria 1961
20 Ga0065712_10000389 3300005290 Bacteria 11944
21 Ga0065712_10002078 3300005290 Bacteria 5860
22 Ga0065715_10000231 3300005293 Bacteria 39804
23 Ga0065715_10090395 3300005293 Bacteria 7096
24 Ga0065715_10103076 3300005293 Bacteria 3061
25 Ga0065707_10088172 3300005295 Bacteria 4751
26 Ga0065707_10099691 3300005295 Bacteria 2987
27 Ga0070658_10006034 3300005327 Bacteria 9832
28 Ga0070658_10050821 3300005327 Bacteria 3360
29 Ga0070683_100000649 3300005329 Bacteria 25103
30 Ga0070690_100025032 3300005330 Bacteria 3675
31 Ga0070670_100000094 3300005331 Bacteria 84268
32 Ga0070670_100009318 3300005331 Bacteria 8388
33 Ga0070670_100012630 3300005331 Bacteria 7231
34 Ga0070670_100018281 3300005331 Bacteria 6013
35 Ga0070670_100056141 3300005331 Bacteria 3379
36 Ga0068869_100007312 3300005334 Bacteria 7042
37 Ga0070666_10003449 3300005335 Bacteria 9580
38 Ga0070680_100017974 3300005336 Bacteria 5583
39 Ga0070680_100045014 3300005336 Bacteria 3587
40 Ga0070680_100080323 3300005336 Bacteria 2689
41 Ga0068868_100000245 3300005338 Bacteria 36844
42 Ga0068868_100002860 3300005338 Bacteria 11969
43 Ga0070689_100002543 3300005340 Bacteria 11953
44 Ga0070689_100065113 3300005340 Bacteria 2838
45 Ga0070689_100105692 3300005340 Bacteria 2233
46 Ga0070691_10008765 3300005341 Bacteria 4630
47 Ga0070661_100041487 3300005344 Bacteria 3358
48 Ga0070692_10008886 3300005345 Bacteria 4503
49 Ga0070692_10020165 3300005345 Bacteria 3229
50 Ga0070668_100003090 3300005347 Bacteria 12302
51 Ga0070668_100020167 3300005347 Bacteria 5026
52 Ga0070669_100000348 3300005353 Bacteria 36149
53 Ga0070669_100000352 3300005353 Bacteria 35915
54 Ga0070675_100000020 3300005354 Bacteria 168778
55 Ga0070675_100027987 3300005354 Bacteria 4532
56 Ga0070675_100035290 3300005354 Bacteria 4063
57 Ga0070671_100010669 3300005355 Bacteria 7375
58 Ga0070671_100021909 3300005355 Bacteria 5219
59 Ga0070671_100054204 3300005355 Bacteria 3334
60 Ga0070671_100094732 3300005355 Bacteria 2503
61 Ga0070673_100037962 3300005364 Bacteria 3674
62 Ga0070688_100013815 3300005365 Bacteria 4565
63 Ga0070659_100044061 3300005366 Bacteria 3492
64 Ga0070713_100011224 3300005436 Bacteria 6514
65 Ga0070701_10004769 3300005438 Bacteria 5539
66 Ga0070705_100025872 3300005440 Bacteria 3187
67 Ga0070700_100000104 3300005441 Bacteria 53476
68 Ga0070708_100018452 3300005445 Bacteria 5840
69 Ga0070708_100124786 3300005445 Bacteria 2378
70 Ga0070663_100007029 3300005455 Bacteria 6821
71 Ga0070663_100026338 3300005455 Bacteria 3938
72 Ga0070678_100001166 3300005456 Bacteria 13932
73 Ga0070678_100010305 3300005456 Bacteria 5702
74 Ga0070678_100034564 3300005456 Bacteria 3522
75 Ga0070678_100062516 3300005456 Bacteria 2750
76 Ga0070662_100047990 3300005457 Bacteria 3075
77 Ga0070681_10011770 3300005458 Bacteria 8671
78 Ga0070681_10084357 3300005458 Bacteria 3129
79 Ga0070681_10145485 3300005458 Bacteria 2299
80 Ga0068867_100000995 3300005459 Bacteria 19329
81 Ga0070685_10008340 3300005466 Bacteria 5318
82 Ga0070685_10059000 3300005466 Bacteria 2239
83 Ga0070685_10078232 3300005466 Bacteria 1977
84 Ga0070706_100017295 3300005467 Bacteria 6656
85 Ga0070706_100018329 3300005467 Bacteria 6459
86 Ga0070706_100101580 3300005467 Bacteria 2673
87 Ga0070707_100073024 3300005468 Bacteria 3307
88 Ga0070699_100005764 3300005518 Bacteria 10838
89 Ga0070699_100005984 3300005518 Bacteria 10631
90 Ga0070699_100052736 3300005518 Bacteria 3519
91 Ga0070699_100064587 3300005518 Bacteria 3174
92 Ga0070679_100040799 3300005530 Bacteria 4618
93 Ga0070684_100001971 3300005535 Bacteria 15082
94 Ga0070684_100003804 3300005535 Bacteria 11405
95 Ga0070684_100014736 3300005535 Bacteria 6343
96 Ga0070697_100015122 3300005536 Bacteria 6060
97 Ga0070697_100017194 3300005536 Bacteria 5686
98 Ga0070672_100000242 3300005543 Bacteria 30531
99 Ga0070672_100009930 3300005543 Bacteria 6582
100 Ga0070686_100006734 3300005544 Bacteria 6396
101 Ga0070686_100074646 3300005544 Bacteria 2229
102 Ga0070686_100083119 3300005544 Bacteria 2125
103 Ga0070695_100057158 3300005545 Bacteria 2520
104 Ga0070693_100019125 3300005547 Bacteria 3586
105 Ga0070665_100024772 3300005548 Bacteria 6045
106 Ga0070704_100013674 3300005549 Bacteria 5047
107 Ga0070704_100016965 3300005549 Bacteria 4617
108 Ga0068855_100004160 3300005563 Bacteria 17656
109 Ga0070664_100008165 3300005564 Bacteria 8465
110 Ga0068857_100018875 3300005577 Bacteria 6050
111 Ga0068857_100159388 3300005577 Bacteria 2047
112 Ga0068857_100206113 3300005577 Bacteria 1793
113 Ga0068854_100002935 3300005578 Bacteria 10575
114 Ga0068854_100014117 3300005578 Bacteria 5258
115 Ga0068854_100033338 3300005578 Bacteria 3590
116 Ga0070702_100004921 3300005615 Bacteria 6156
117 Ga0068859_100007636 3300005617 Bacteria 10988
118 Ga0068859_100010679 3300005617 Bacteria 9241
119 Ga0068859_100018501 3300005617 Bacteria 7001
120 Ga0068864_100000013 3300005618 Bacteria 326235
121 Ga0068864_100006309 3300005618 Bacteria 9727
122 Ga0068864_100044184 3300005618 Bacteria 3818
123 Ga0068861_100068431 3300005719 Bacteria 2744
124 Ga0068870_10000244 3300005840 Bacteria 20156
125 Ga0068870_10008070 3300005840 Bacteria 4717
126 Ga0068863_100061686 3300005841 Bacteria 3545
127 Ga0068858_100000011 3300005842 Bacteria 233214
128 Ga0068858_100032311 3300005842 Bacteria 4861
129 Ga0068860_100033594 3300005843 Bacteria 4921
130 Ga0068860_100040049 3300005843 Bacteria 4480
131 Ga0068862_100000275 3300005844 Bacteria 57657
132 Ga0068862_100005826 3300005844 Bacteria 10270
133 Ga0068862_100035927 3300005844 Bacteria 4198
134 Ga0081455_10026507 3300005937 Bacteria 5327
135 Ga0081455_10094323 3300005937 Bacteria 2418
136 Ga0081538_10030223 3300005981 Bacteria 3682
137 Ga0081539_10000122 3300005985 Bacteria 183393
138 Ga0070717_10000046 3300006028 Bacteria 106495
139 Ga0070717_10087829 3300006028 Bacteria 2620
140 Ga0075365_10087655 3300006038 Bacteria 2116
141 Ga0075368_10019550 3300006042 Bacteria 2557
142 Ga0075432_10012695 3300006058 Bacteria 2861
143 Ga0070716_100009457 3300006173 Bacteria 4860
144 Ga0075367_10016574 3300006178 Bacteria 4024
145 Ga0075367_10049906 3300006178 Bacteria 2468
146 Ga0075366_10047802 3300006195 Bacteria 2536
147 Ga0075366_10078940 3300006195 Bacteria 1964
148 Ga0075370_10002711 3300006353 Bacteria 8289
149 Ga0068871_100011956 3300006358 Bacteria 6390
150 Ga0075428_100000756 3300006844 Bacteria 33584
151 Ga0075428_100005221 3300006844 Bacteria 14441
152 Ga0075428_100008399 3300006844 Bacteria 11449
153 Ga0075428_100012862 3300006844 Bacteria 9314
154 Ga0075428_100014173 3300006844 Bacteria 8869
155 Ga0075428_100042186 3300006844 Bacteria 5018
156 Ga0075428_100055111 3300006844 Bacteria 4357
157 Ga0075428_100123777 3300006844 Bacteria 2814
158 Ga0075431_100001877 3300006847 Bacteria 19911
159 Ga0075431_100036608 3300006847 Bacteria 5054
160 Ga0075431_100039477 3300006847 Bacteria 4862
161 Ga0075433_10000236 3300006852 Bacteria 31700
162 Ga0075433_10004565 3300006852 Bacteria 10801
163 Ga0075433_10025564 3300006852 Bacteria 4992
164 Ga0075433_10087674 3300006852 Bacteria 2748
165 Ga0075433_10088274 3300006852 Bacteria 2739
166 Ga0075434_100003430 3300006871 Bacteria 14176
167 Ga0075434_100003683 3300006871 Bacteria 13685
168 Ga0075434_100008145 3300006871 Bacteria 9718
169 Ga0075434_100035219 3300006871 Bacteria 4948
170 Ga0075434_100041707 3300006871 Bacteria 4547
171 Ga0075429_100038415 3300006880 Bacteria 4167
172 Ga0075429_100060377 3300006880 Bacteria 3302
173 Ga0068865_100025251 3300006881 Bacteria 3906
174 Ga0075436_100000808 3300006914 Bacteria 20793
175 Ga0075436_100004058 3300006914 Bacteria 10044
176 Ga0075436_100011107 3300006914 Bacteria 6175
177 Ga0097620_100007636 3300006931 Bacteria 10988
178 Ga0097620_100010682 3300006931 Bacteria 9241
179 Ga0097620_100018501 3300006931 Bacteria 7001
180 Ga0075435_100000784 3300007076 Bacteria 19756
181 Ga0075435_100116643 3300007076 Bacteria 2224
182 Ga0099794_10048342 3300007265 Bacteria 2042
183 Ga0099795_10011555 3300007788 Bacteria 2644
184 Ga0105244_10006538 3300009036 Bacteria 7519
185 Ga0105240_10005108 3300009093 Bacteria 19644
186 Ga0105240_10007177 3300009093 Bacteria 16224
187 Ga0105240_10018998 3300009093 Bacteria 9202
188 Ga0105240_10167631 3300009093 Bacteria 2604
189 Ga0111539_10000031 3300009094 Bacteria 165994
190 Ga0111539_10000903 3300009094 Bacteria 38809
191 Ga0111539_10008858 3300009094 Bacteria 12750
192 Ga0111539_10010083 3300009094 Bacteria 11908
193 Ga0111539_10011408 3300009094 Bacteria 11154
194 Ga0111539_10077981 3300009094 Bacteria 3898
195 Ga0111539_10168068 3300009094 Bacteria 2563
196 Ga0111539_10259863 3300009094 Bacteria 2021
197 Ga0105245_10000727 3300009098 Bacteria 29676
198 Ga0105245_10001167 3300009098 Bacteria 23772
199 Ga0105245_10004050 3300009098 Bacteria 13023
200 Ga0105245_10008265 3300009098 Bacteria 9099
201 Ga0105247_10012624 3300009101 Bacteria 5072
202 Ga0114129_10005112 3300009147 Bacteria 18461
203 Ga0114129_10006350 3300009147 Bacteria 16759
204 Ga0114129_10010106 3300009147 Bacteria 13454
205 Ga0114129_10019320 3300009147 Bacteria 9703
206 Ga0114129_10023573 3300009147 Bacteria 8723
207 Ga0114129_10103609 3300009147 Bacteria 3934
208 Ga0105243_10006051 3300009148 Bacteria 9361
209 Ga0105242_10043311 3300009176 Bacteria 3641
210 Ga0105248_10021610 3300009177 Bacteria 7128
211 Ga0105238_10000030 3300009551 Bacteria 181972
212 Ga0105238_10065270 3300009551 Bacteria 3641
213 Ga0105249_10012001 3300009553 Bacteria 7622
214 Ga0099796_10005087 3300010159 Bacteria 3251
215 Ga0105239_10014607 3300010375 Bacteria 8711
216 Ga0105239_10174007 3300010375 Bacteria 2408
217 Ga0157371_10012102 3300013102 Bacteria 6610
218 Ga0157370_10052371 3300013104 Bacteria 3897
219 Ga0157369_10000404 3300013105 Bacteria 57448
220 Ga0157374_10000020 3300013296 Bacteria 276902
221 Ga0157374_10088530 3300013296 Bacteria 2949
222 Ga0157378_10003050 3300013297 Bacteria 14890
223 Ga0157378_10009761 3300013297 Bacteria 8366
224 Ga0157378_10118480 3300013297 Bacteria 2437
225 Ga0163162_10023217 3300013306 Bacteria 6119
226 Ga0157372_10085983 3300013307 Bacteria 3567
227 Ga0157375_10000024 3300013308 Bacteria 231767
228 Ga0157375_10000389 3300013308 Bacteria 39904
229 Ga0157375_10022636 3300013308 Bacteria 5786
230 Ga0157375_10028477 3300013308 Bacteria 5236
231 Ga0163163_10024047 3300014325 Bacteria 5795
232 Ga0163163_10024812 3300014325 Bacteria 5709
233 Ga0163163_10046487 3300014325 Bacteria 4264
234 Ga0157380_10002857 3300014326 Bacteria 11723
235 Ga0157380_10015368 3300014326 Bacteria 5627
236 Ga0157380_10018808 3300014326 Bacteria 5138
237 Ga0157380_10023538 3300014326 Bacteria 4647
238 Ga0157380_10120663 3300014326 Bacteria 2220
239 Ga0157377_10000031 3300014745 Bacteria 124109
240 Ga0157377_10000260 3300014745 Bacteria 25939
241 Ga0157376_10000003 3300014969 Bacteria 568634
242 Ga0157376_10042351 3300014969 Bacteria 3732
243 Ga0163161_10040039 3300017792 Bacteria 3365
244 Ga0163161_10067418 3300017792 Bacteria 2614
245 Ga0163161_10091016 3300017792 Bacteria 2257
246 Ga0213873_10000002 3300021358 Bacteria 1164195
247 Ga0213876_10000001 3300021384 Bacteria 1186326
248 Ga0213876_10000135 3300021384 Bacteria 80441
249 Ga0213876_10004239 3300021384 Bacteria 8048
250 Ga0213876_10008103 3300021384 Bacteria 5695
251 Ga0209674_100064 3300025226 Bacteria 265769
252 Ga0209563_100099 3300025230 Bacteria 153336
253 Ga0207427_101039 3300025231 Bacteria 11567
254 Ga0209258_100319 3300025242 Bacteria 74569
255 Ga0209258_100699 3300025242 Bacteria 22932
256 Ga0209646_1000060 3300025246 Bacteria 256386
257 Ga0209026_1000049 3300025250 Bacteria 255273
258 Ga0209677_100175 3300025253 Bacteria 55052
259 Ga0209677_100782 3300025253 Bacteria 16014
260 Ga0209677_104320 3300025253 Bacteria 4155
261 Ga0209759_1000069 3300025256 Bacteria 182437
262 Ga0209759_1001175 3300025256 Bacteria 16458
263 Ga0209759_1002013 3300025256 Bacteria 9668
264 Ga0209565_1000037 3300025263 Bacteria 289371
265 Ga0209455_1000157 3300025272 Bacteria 119719
266 Ga0209673_1000494 3300025273 Bacteria 65078
267 Ga0209675_1000020 3300025291 Bacteria 335854
268 Ga0209676_1000307 3300025292 Bacteria 96239
269 Ga0209564_1000993 3300025295 Bacteria 35449
270 Ga0209050_1003024 3300025298 Bacteria 13016
271 Ga0209256_1008116 3300025299 Bacteria 4951
272 Ga0209051_1001868 3300025303 Bacteria 16533
273 Ga0209051_1002067 3300025303 Bacteria 15222
274 Ga0209257_1000091 3300025304 Bacteria 270637
275 Ga0209257_1004202 3300025304 Bacteria 11421
276 Ga0207697_10002245 3300025315 Bacteria 10092
277 Ga0207656_10026684 3300025321 Bacteria 2357
278 Ga0207655_1025199 3300025728 Bacteria 2893
279 Ga0207710_10004767 3300025900 Bacteria 5883
280 Ga0207710_10020698 3300025900 Bacteria 2814
281 Ga0207688_10010922 3300025901 Bacteria 4941
282 Ga0207645_10026691 3300025907 Bacteria 3731
283 Ga0207645_10041262 3300025907 Bacteria 2954
284 Ga0207643_10013262 3300025908 Bacteria 4461
285 Ga0207643_10016159 3300025908 Bacteria 4069
286 Ga0207643_10049313 3300025908 Bacteria 2386
287 Ga0207705_10047196 3300025909 Bacteria 3097
288 Ga0207705_10088662 3300025909 Bacteria 2263
289 Ga0207684_10004441 3300025910 Bacteria 13222
290 Ga0207707_10001945 3300025912 Bacteria 18792
291 Ga0207707_10056114 3300025912 Bacteria 3426
292 Ga0207707_10124841 3300025912 Bacteria 2251
293 Ga0207695_10003505 3300025913 Bacteria 22004
294 Ga0207695_10009579 3300025913 Bacteria 11969
295 Ga0207695_10017072 3300025913 Bacteria 8465
296 Ga0207695_10046498 3300025913 Bacteria 4601
297 Ga0207660_10005193 3300025917 Bacteria 8467
298 Ga0207660_10013073 3300025917 Bacteria 5435
299 Ga0207660_10026023 3300025917 Bacteria 3980
300 Ga0207662_10023471 3300025918 Bacteria 3544
301 Ga0207662_10023915 3300025918 Bacteria 3513
302 Ga0207662_10047449 3300025918 Bacteria 2544
303 Ga0207657_10010713 3300025919 Bacteria 9129
304 Ga0207657_10023809 3300025919 Bacteria 5692
305 Ga0207657_10061516 3300025919 Bacteria 3219
306 Ga0207649_10043513 3300025920 Bacteria 2746
307 Ga0207652_10001697 3300025921 Bacteria 19284
308 Ga0207646_10005844 3300025922 Bacteria 12866
309 Ga0207646_10006832 3300025922 Bacteria 11729
310 Ga0207646_10027865 3300025922 Bacteria 5150
311 Ga0207681_10000305 3300025923 Bacteria 36167
312 Ga0207694_10000002 3300025924 Bacteria 1165763
313 Ga0207694_10000003 3300025924 Bacteria 1165533
314 Ga0207694_10034754 3300025924 Bacteria 3866
315 Ga0207650_10000101 3300025925 Bacteria 112066
316 Ga0207650_10007091 3300025925 Bacteria 7636
317 Ga0207650_10035554 3300025925 Bacteria 3619
318 Ga0207650_10036772 3300025925 Bacteria 3563
319 Ga0207659_10000035 3300025926 Bacteria 104092
320 Ga0207659_10000617 3300025926 Bacteria 21204
321 Ga0207659_10045938 3300025926 Bacteria 3082
322 Ga0207687_10000024 3300025927 Bacteria 187490
323 Ga0207687_10000301 3300025927 Bacteria 33834
324 Ga0207687_10005201 3300025927 Bacteria 8632
325 Ga0207687_10048475 3300025927 Bacteria 2950
326 Ga0207700_10015684 3300025928 Bacteria 5009
327 Ga0207644_10051072 3300025931 Bacteria 2966
328 Ga0207690_10061452 3300025932 Bacteria 2554
329 Ga0207706_10066020 3300025933 Bacteria 3185
330 Ga0207709_10003953 3300025935 Bacteria 8651
331 Ga0207709_10035654 3300025935 Bacteria 2943
332 Ga0207670_10001271 3300025936 Bacteria 13327
333 Ga0207670_10041302 3300025936 Bacteria 3033
334 Ga0207670_10051769 3300025936 Bacteria 2759
335 Ga0207669_10007218 3300025937 Bacteria 5121
336 Ga0207669_10039479 3300025937 Bacteria 2728
337 Ga0207665_10035772 3300025939 Bacteria 3298
338 Ga0207665_10040660 3300025939 Bacteria 3103
339 Ga0207691_10000444 3300025940 Bacteria 40991
340 Ga0207691_10009037 3300025940 Bacteria 9560
341 Ga0207691_10010200 3300025940 Bacteria 9012
342 Ga0207691_10010403 3300025940 Bacteria 8923
343 Ga0207711_10015048 3300025941 Bacteria 6425
344 Ga0207711_10039269 3300025941 Bacteria 4026
345 Ga0207711_10115276 3300025941 Bacteria 2394
346 Ga0207689_10006141 3300025942 Bacteria 10632
347 Ga0207689_10006852 3300025942 Bacteria 10021
348 Ga0207689_10014485 3300025942 Bacteria 6709
349 Ga0207689_10112758 3300025942 Bacteria 2235
350 Ga0207661_10000022 3300025944 Bacteria 198514
351 Ga0207661_10002360 3300025944 Bacteria 12994
352 Ga0207661_10002465 3300025944 Bacteria 12712
353 Ga0207661_10139443 3300025944 Bacteria 2085
354 Ga0207661_10152895 3300025944 Bacteria 1996
355 Ga0207679_10017579 3300025945 Bacteria 4773
356 Ga0207667_10003700 3300025949 Bacteria 18853
357 Ga0207651_10006179 3300025960 Bacteria 6234
358 Ga0207668_10038784 3300025972 Bacteria 3201
359 Ga0207668_10045064 3300025972 Bacteria 3005
360 Ga0207668_10051730 3300025972 Bacteria 2838
361 Ga0207640_10004476 3300025981 Bacteria 7577
362 Ga0207640_10098101 3300025981 Bacteria 2047
363 Ga0207677_10000002 3300026023 Bacteria 478921
364 Ga0207677_10000264 3300026023 Bacteria 39747
365 Ga0207677_10014291 3300026023 Bacteria 4632
366 Ga0207703_10000004 3300026035 Bacteria 526312
367 Ga0207703_10082081 3300026035 Bacteria 2689
368 Ga0207703_10093545 3300026035 Bacteria 2532
369 Ga0207639_10000006 3300026041 Bacteria 544415
370 Ga0207678_10017965 3300026067 Bacteria 6213
371 Ga0207678_10022747 3300026067 Bacteria 5489
372 Ga0207708_10000012 3300026075 Bacteria 207611
373 Ga0207708_10010152 3300026075 Bacteria 6992
374 Ga0207708_10058240 3300026075 Bacteria 2948
375 Ga0207702_10005245 3300026078 Bacteria 11378
376 Ga0207648_10000375 3300026089 Bacteria 49109
377 Ga0207648_10013213 3300026089 Bacteria 7693
378 Ga0207676_10000030 3300026095 Bacteria 221663
379 Ga0207676_10016261 3300026095 Bacteria 5387
380 Ga0207676_10020445 3300026095 Bacteria 4844
381 Ga0207676_10044867 3300026095 Bacteria 3412
382 Ga0207676_10059727 3300026095 Bacteria 3012
383 Ga0207674_10043028 3300026116 Bacteria 4659
384 Ga0207674_10050794 3300026116 Bacteria 4235
385 Ga0207674_10110549 3300026116 Bacteria 2723
386 Ga0207675_100005097 3300026118 Bacteria 12640
387 Ga0207675_100017249 3300026118 Bacteria 6742
388 Ga0207675_100103433 3300026118 Bacteria 2684
389 Ga0207675_100140367 3300026118 Bacteria 2295
390 Ga0207683_10017830 3300026121 Bacteria 6055
391 Ga0207683_10031823 3300026121 Bacteria 4580
392 Ga0207683_10043872 3300026121 Bacteria 3908
393 Ga0209974_10003969 3300027876 Bacteria 5295
394 Ga0207428_10000012 3300027907 Bacteria 354383
395 Ga0207428_10000525 3300027907 Bacteria 45711
396 Ga0207428_10001048 3300027907 Bacteria 30412
397 Ga0207428_10025102 3300027907 Bacteria 4991
398 Ga0207428_10060949 3300027907 Bacteria 2989
399 Ga0207428_10101471 3300027907 Bacteria 2223
400 Ga0207428_10122484 3300027907 Bacteria 1994
401 Ga0207428_10125684 3300027907 Bacteria 1964
402 Ga0207428_10130140 3300027907 Bacteria 1926
403 Ga0268265_10000191 3300028380 Bacteria 72200
404 Ga0268265_10000263 3300028380 Bacteria 59820
405 Ga0268265_10018414 3300028380 Bacteria 4839
406 Ga0268265_10034336 3300028380 Bacteria 3696
407 Ga0268264_10000914 3300028381 Bacteria 30928
408 Ga0268264_10002400 3300028381 Bacteria 16495
409 Ga0268264_10029986 3300028381 Bacteria 4460
410 Ga0265337_1013714 3300028556 Bacteria 2708
411 Ga0265326_10001276 3300028558 Bacteria 8935
412 Ga0265326_10004659 3300028558 Bacteria 4372
413 Ga0265319_1000001 3300028563 Bacteria 549513
414 Ga0265319_1000747 3300028563 Bacteria 21209
415 Ga0265318_10003207 3300028577 Bacteria 8345
416 Ga0265323_10000215 3300028653 Bacteria 34197
417 Ga0265322_10000089 3300028654 Bacteria 42821
418 Ga0265322_10000224 3300028654 Bacteria 25191
419 Ga0265336_10000040 3300028666 Bacteria 138266
420 Ga0265336_10000432 3300028666 Bacteria 25816
421 Ga0265338_10000111 3300028800 Bacteria 151469
422 Ga0265338_10000607 3300028800 Bacteria 62806
423 Ga0265338_10002460 3300028800 Bacteria 27676
424 Ga0265338_10006237 3300028800 Bacteria 15257
425 Ga0265338_10006702 3300028800 Bacteria 14554
426 Ga0265338_10011992 3300028800 Bacteria 9927
427 Ga0265338_10020079 3300028800 Bacteria 7046
428 Ga0265338_10025006 3300028800 Bacteria 6079
429 Ga0265338_10027459 3300028800 Bacteria 5711
430 Ga0265324_10000589 3300029957 Bacteria 24888
431 Ga0265324_10000978 3300029957 Bacteria 17699
432 Ga0265324_10004432 3300029957 Bacteria 6351
433 Ga0265324_10034373 3300029957 Bacteria 1765
434 Ga0307511_10056147 3300030521 Bacteria 3083
435 Ga0265330_10001621 3300031235 Bacteria 12825
436 Ga0265332_10001623 3300031238 Bacteria 12318
437 Ga0265328_10018376 3300031239 Bacteria 2697
438 Ga0265320_10000653 3300031240 Bacteria 26510
439 Ga0265320_10003110 3300031240 Bacteria 11268
440 Ga0265320_10007095 3300031240 Bacteria 6989
441 Ga0265320_10014031 3300031240 Bacteria 4585
442 Ga0265325_10024796 3300031241 Bacteria 3259
443 Ga0265329_10000272 3300031242 Bacteria 27351
444 Ga0265340_10003766 3300031247 Bacteria 8537
445 Ga0265340_10013223 3300031247 Unclassified 4343
446 Ga0265339_10000624 3300031249 Bacteria 27447
447 Ga0265331_10001631 3300031250 Bacteria 16368
448 Ga0265327_10000005 3300031251 Bacteria 790146
449 Ga0265327_10000580 3300031251 Bacteria 61843
450 Ga0265327_10016399 3300031251 Bacteria 4706
451 Ga0265327_10024010 3300031251 Bacteria 3592
452 Ga0265316_10000234 3300031344 Bacteria 64079
453 Ga0265316_10001836 3300031344 Bacteria 22346
454 Ga0307408_100029498 3300031548 Bacteria 3802
455 Ga0265313_10000870 3300031595 Bacteria 30487
456 Ga0265313_10003911 3300031595 Bacteria 11724
457 Ga0265313_10031810 3300031595 Bacteria 2702
458 Ga0316575_10026250 3300031665 Unclassified 2263
459 Ga0316579_10062792 3300031691 Bacteria 1749
460 Ga0265314_10001492 3300031711 Bacteria 25974
461 Ga0265314_10001680 3300031711 Bacteria 24092
462 Ga0265314_10071646 3300031711 Bacteria 2318
463 Ga0265342_10000142 3300031712 Bacteria 80728
464 Ga0265342_10011896 3300031712 Bacteria 5920
465 Ga0316578_10014768 3300031728 Bacteria 4183
466 Ga0307516_10003164 3300031730 Bacteria 21417
467 Ga0307405_10034459 3300031731 Bacteria 3013
468 Ga0316577_10040013 3300031733 Bacteria 2622
469 Ga0307416_100026833 3300032002 Bacteria 4252
470 Ga0307411_10063644 3300032005 Bacteria 2466
471 Ga0307415_100011908 3300032126 Bacteria 5004
472 Ga0316583_10004894 3300032133 Bacteria 4788
473 Ga0316585_10004587 3300032137 Bacteria 3857
474 Ga0316585_10006452 3300032137 Bacteria 3354
475 Ga0316593_10000001 3300032168 Bacteria 24747
476 Ga0316593_10000372 3300032168 Bacteria 7942
477 Ga0373934_0001195 3300035086 Bacteria 9401
478 Ga0373944_0000152 3300035089 Bacteria 13680
479 Ga0373932_0000070 3300035112 Bacteria 25672
480 Ga0373945_0032559 3300035116 Bacteria 1848
481 Ga0373953_0005805 3300035117 Bacteria 4034
482 Ga0373954_0000506 3300035118 Bacteria 14591
483 Ga0373954_0003169 3300035118 Bacteria 6947
484 Ga0373954_0007174 3300035118 Bacteria 4866
485 Ga0373956_0000019 3300035119 Bacteria 50599
486 Ga0373956_0031830 3300035119 Bacteria 2313
487 Ga0373957_0001675 3300035120 Bacteria 6067
488 Ga0373957_0020329 3300035120 Bacteria 2344
489 Ga0373943_0022261 3300035170 Bacteria 2935
490 Ga0373955_0010696 3300035172 Bacteria 4344
491 Ga0373961_0000401 3300035241 Bacteria 18158
492 Ga0373931_0037772 3300035691 Bacteria 2522
493 Ga0373935_0016410 3300035692 Bacteria 4480
494 Ga0373935_0028222 3300035692 Bacteria 3469
495 Ga0373933_0001818 3300035724 Bacteria 12368
496 Ga0373937_0000993 3300036401 Bacteria 24079
497 Ga0373937_0022242 3300036401 Bacteria 5699
498 Ga0373937_0276078 3300036401 Bacteria 1586
499 Ga0316582_0000223 3300036647 Bacteria 18571
500 Ga0316582_0008553 3300036647 Bacteria 5509
501 Ga0316584_0005118 3300036712 Bacteria 8750
502 Ga0373925_0001450 3300037068 Bacteria 20471
503 Ga0373925_0002115 3300037068 Bacteria 16299
504 Ga0373925_0013654 3300037068 Bacteria 5881
505 Ga0395899_0001243 3300037312 Bacteria 22144
506 Ga0395899_0005394 3300037312 Bacteria 9936
507 Ga0395900_0005627 3300037418 Bacteria 13106
508 Ga0395898_0008569 3300037466 Bacteria 10795
509 Ga0395898_0025434 3300037466 Bacteria 5965
510 Ga0395898_0163807 3300037466 Bacteria 2127
511 Ga0395905_0014228 3300037471 Bacteria 7601
512 Ga0436364_0822442 3300037853 Bacteria 9083
513 Ga0395901_0003173 3300038443 Bacteria 16538
514 Ga0436365_0264177 3300039437 Bacteria 2694
515 Ga0436365_0332720 3300039437 Bacteria 227622
516 Ga0436365_0741332 3300039437 Bacteria 3866
517 Ga0436365_0832427 3300039437 Bacteria 97428
518 Ga0436365_1089890 3300039437 Bacteria 7035
519 Ga0436365_1281712 3300039437 Bacteria 80367
520 Ga0436365_1342523 3300039437 Bacteria 9327
521 Ga0436365_1912664 3300039437 Bacteria 9703
522 Ga0436362_0086070 3300039453 Bacteria 8527
523 Ga0436362_0660519 3300039453 Bacteria 832172
524 Ga0439446_0005265 3300042156 Bacteria 3322
525 Ga0439434_0018522 3300042435 Bacteria 2085
526 Ga0451577_0022548 3300042876 Bacteria 5749
527 Ga0451577_0043672 3300042876 Bacteria 4015
528 Ga0453683_0001132 3300044673 Bacteria 24253
529 Ga0466965_0003310 3300044683 Bacteria 7053
530 Ga0466966_0009059 3300044684 Bacteria 6593
531 Ga0466961_0025989 3300044693 Bacteria 3763
532 Ga0466964_0004084 3300044706 Bacteria 5371
533 Ga0453684_0138564 3300044712 Bacteria 2909
534 Ga0466971_0004547 3300044719 Bacteria 6000
535 Ga0466957_0082110 3300044842 Bacteria 2008
536 Ga0466959_0026708 3300045049 Bacteria 4280
537 Ga0451576_0001932 3300045051 Bacteria 33128
538 Ga0451576_0012996 3300045051 Bacteria 9328
539 Ga0451576_0021397 3300045051 Bacteria 7029
540 Ga0451576_0030186 3300045051 Bacteria 5797
541 Ga0466958_0007306 3300045836 Bacteria 6067
542 Ga0466967_0055360 3300045976 Bacteria 3494
543 Ga0495592_0000008 3300046454 Bacteria 175382
544 Ga0495592_0000978 3300046454 Bacteria 19833
545 Ga0495629_0000024 3300046459 Bacteria 136884
546 Ga0495629_0085355 3300046459 Bacteria 2203
547 Ga0495638_0011225 3300046460 Bacteria 6182
548 Ga0495651_0000147 3300046462 Bacteria 51361
549 Ga0495653_0015810 3300046463 Bacteria 6153
550 Ga0495580_0075543 3300046472 Bacteria 2351
551 Ga0495662_0034466 3300046476 Bacteria 2443
552 Ga0495583_0000046 3300046506 Bacteria 218059
553 Ga0495618_0002272 3300046514 Bacteria 12450
554 Ga0495618_0019297 3300046514 Bacteria 4193
555 Ga0495620_0000745 3300046515 Bacteria 20009
556 Ga0495628_0000166 3300046516 Bacteria 57276
557 Ga0495628_0000681 3300046516 Bacteria 31276
558 Ga0495628_0014263 3300046516 Bacteria 6668
559 Ga0495630_0009382 3300046517 Bacteria 7033
560 Ga0495666_0000017 3300046526 Bacteria 68024
561 Ga0495666_0015944 3300046526 Bacteria 3742
562 Ga0495586_0000120 3300046535 Bacteria 47384
563 Ga0495586_0000768 3300046535 Bacteria 18420
564 Ga0495586_0038429 3300046535 Bacteria 2570
565 Ga0495645_0002948 3300046543 Bacteria 11531
566 Ga0495645_0003396 3300046543 Bacteria 10793
567 Ga0495622_0018006 3300046557 Bacteria 3290
568 Ga0495667_0033781 3300046559 Bacteria 3422
569 Ga0495634_0001642 3300046642 Bacteria 19458
570 Ga0495635_0000629 3300046663 Bacteria 22704
571 Ga0495635_0048401 3300046663 Bacteria 2931
572 Ga0495657_0010602 3300046675 Bacteria 6927
573 Ga0495599_0029239 3300046678 Bacteria 3454
574 Ga0495658_0024804 3300046683 Bacteria 3199
575 Ga0495658_0080398 3300046683 Bacteria 1911
576 Ga0495600_0015122 3300046809 Bacteria 4874
577 Ga0495581_0014274 3300047315 Bacteria 4607
578 Ga0495604_0037893 3300047317 Bacteria 3794
579 Ga0495674_0001483 3300047319 Bacteria 22973
580 Ga0495672_0001004 3300047320 Bacteria 29106
581 Ga0495676_0005941 3300047321 Bacteria 11205
582 Ga0495676_0066783 3300047321 Bacteria 2785
583 Ga0495680_0001604 3300047322 Bacteria 24103
584 Ga0495684_0002350 3300047471 Bacteria 15119
585 Ga0495684_0011475 3300047471 Bacteria 6843
586 Ga0495684_0087390 3300047471 Bacteria 2363
587 Ga0495686_0017170 3300047472 Bacteria 4884
588 Ga0496101_0000685 3300048904 Bacteria 20428
589 Ga0496102_0003011 3300048905 Bacteria 14268
590 Ga0496102_0063325 3300048905 Bacteria 3386
591 Ga0496102_0128752 3300048905 Bacteria 2368
592 Ga0496104_0040764 3300048907 Bacteria 4353
593 Ga0496104_0071226 3300048907 Bacteria 3305
594 Ga0496105_0034676 3300048908 Bacteria 4151
595 Ga0496108_0026526 3300048911 Bacteria 4779
596 Ga0496108_0030232 3300048911 Bacteria 4489
597 Ga0496108_0058422 3300048911 Bacteria 3242
598 Ga0496109_0002159 3300048912 Bacteria 16355
599 Ga0496109_0004351 3300048912 Bacteria 11839
600 Ga0496109_0117816 3300048912 Bacteria 2472
601 Ga0496110_0005001 3300048913 Bacteria 10359
602 Ga0496110_0006233 3300048913 Bacteria 9404
603 Ga0496110_0021523 3300048913 Bacteria 5462
604 Ga0496110_0047217 3300048913 Bacteria 3769
605 Ga0496110_0063628 3300048913 Bacteria 3260
606 Ga0496111_0004949 3300048914 Bacteria 8467
607 Ga0496111_0059782 3300048914 Bacteria 2762
608 Ga0496112_0006706 3300048915 Bacteria 10140
609 Ga0496112_0008524 3300048915 Bacteria 9185
610 Ga0496113_0119496 3300048916 Bacteria 2059
611 Ga0496114_0000020 3300048917 Bacteria 238645
612 Ga0496114_0002130 3300048917 Bacteria 15055
613 Ga0496114_0003715 3300048917 Bacteria 11751
614 Ga0496114_0026280 3300048917 Bacteria 4764
615 Ga0496116_0017050 3300048919 Bacteria 5657
616 Ga0496124_0000115 3300048927 Bacteria 164929
617 Ga0501031_0000133 3300049568 Bacteria 41137
618 Ga0501034_0021828 3300049571 Bacteria 6522
619 Ga0501036_0007242 3300049572 Bacteria 9033
620 Ga0501036_0008524 3300049572 Bacteria 8404
621 Ga0501038_0016982 3300049574 Bacteria 6586
622 Ga0501039_0031982 3300049575 Bacteria 4056
623 Ga0501039_0082967 3300049575 Bacteria 2496
624 Ga0501040_0006107 3300049576 Bacteria 7814
625 Ga0501040_0007347 3300049576 Bacteria 7136
626 Ga0501041_0006178 3300049577 Bacteria 7001
627 Ga0501041_0022155 3300049577 Bacteria 3804
628 Ga0501042_0008684 3300049578 Bacteria 6735
629 Ga0501042_0010389 3300049578 Bacteria 6241
630 Ga0501042_0021669 3300049578 Bacteria 4481
631 Ga0501042_0077171 3300049578 Bacteria 2385
632 Ga0501046_0027727 3300049580 Bacteria 4618
633 Ga0501046_0057586 3300049580 Bacteria 3048
634 Ga0501048_0043297 3300049582 Bacteria 3223
635 Ga0501067_0051951 3300049583 Bacteria 2271
636 Ga0501068_0064774 3300049584 Bacteria 2224
637 Ga0501071_0004658 3300049587 Bacteria 8712
638 Ga0501071_0008592 3300049587 Bacteria 6750
639 Ga0501071_0019115 3300049587 Bacteria 4754
640 Ga0501071_0061608 3300049587 Bacteria 2717
641 Ga0501071_0120085 3300049587 Bacteria 1948
642 Ga0501072_0019775 3300049588 Bacteria 5209
643 Ga0501072_0025135 3300049588 Bacteria 4637
644 Ga0501072_0036086 3300049588 Bacteria 3875
645 Ga0501073_0029110 3300049589 Bacteria 3946
646 Ga0501075_0001743 3300049591 Bacteria 14308
647 Ga0501075_0004287 3300049591 Bacteria 9641
648 Ga0501075_0013262 3300049591 Bacteria 5879
649 Ga0501075_0027763 3300049591 Bacteria 4173
650 Ga0501076_0000735 3300049592 Bacteria 21183
651 Ga0501076_0004937 3300049592 Bacteria 9547
652 Ga0501076_0018666 3300049592 Bacteria 5292
653 Ga0501077_0000206 3300049593 Bacteria 34300
654 Ga0501077_0008036 3300049593 Bacteria 6521
655 Ga0501077_0008969 3300049593 Bacteria 6203
656 Ga0501079_0009838 3300049741 Bacteria 7253
657 Ga0501080_0034608 3300049742 Bacteria 4717
658 Ga0501080_0065414 3300049742 Bacteria 3382
659 Ga0501080_0065709 3300049742 Bacteria 3374
660 Ga0501081_0003310 3300049743 Bacteria 10239
661 Ga0501081_0016140 3300049743 Bacteria 4932
662 Ga0501083_0007845 3300049744 Bacteria 7562
663 Ga0501035_0055937 3300049822 Bacteria 3522
664 Ga0501045_0007245 3300049824 Bacteria 7700
665 nmdc:mga0yw44_54155_c1 3300050492 Bacteria 2437
666 nmdc:mga0k408_8449_c1 3300050493 Bacteria 5528
667 nmdc:mga07m45_2243_c2 3300050496 Bacteria 8377
668 nmdc:mga05p37_116964_c1 3300050507 Bacteria 3277
669 nmdc:mga05p37_12451_c1 3300050507 Bacteria 10159
670 nmdc:mga05p37_17027_c1 3300050507 Bacteria 8766
671 nmdc:mga05p37_17769_c1 3300050507 Bacteria 8582
672 nmdc:mga05p37_33304_c1 3300050507 Bacteria 6311
673 nmdc:mga05p37_35507_c1 3300050507 Bacteria 6113
674 nmdc:mga05p37_7314_c1 3300050507 Bacteria 13029
675 nmdc:mga05p37_76295_c2 3300050507 Bacteria 3378
676 nmdc:mga09592_117865_c1 3300050508 Bacteria 2279
677 nmdc:mga09592_1527_c1 3300050508 Bacteria 18657
678 nmdc:mga09592_15514_c1 3300050508 Bacteria 6227
679 nmdc:mga09592_54214_c1 3300050508 Bacteria 3387
680 nmdc:mga09592_67230_c1 3300050508 Bacteria 3039
681 nmdc:mga09592_74464_c1 3300050508 Bacteria 2885
682 nmdc:mga09592_93784_c1 3300050508 Bacteria 2567
683 nmdc:mga0qj67_23614_c1 3300050509 Bacteria 4732
684 nmdc:mga0qj67_4864_c2 3300050509 Bacteria 9271
685 nmdc:mga0qj67_5865_c1 3300050509 Bacteria 8994
686 nmdc:mga06r32_1445_c1 3300050510 Bacteria 21463
687 nmdc:mga06r32_219004_c1 3300050510 Bacteria 1892
688 nmdc:mga06r32_39938_c1 3300050510 Bacteria 4454
689 nmdc:mga06r32_49833_c1 3300050510 Bacteria 4006
690 nmdc:mga06r32_67060_c1 3300050510 Bacteria 3464
691 nmdc:mga08y16_12746_c1 3300050511 Bacteria 8847
692 nmdc:mga08y16_18590_c1 3300050511 Bacteria 7322
693 nmdc:mga08y16_73139_c1 3300050511 Bacteria 3572
694 nmdc:mga08y16_7357_c1 3300050511 Bacteria 11549
695 nmdc:mga08y16_77603_c1 3300050511 Bacteria 3464
696 nmdc:mga08y16_7_c1 3300050511 Bacteria 610289
697 nmdc:mga0n895_118143_c1 3300050512 Bacteria 2671
698 nmdc:mga0n895_123078_c1 3300050512 Bacteria 2616
699 nmdc:mga0n895_23617_c1 3300050512 Bacteria 5782
700 nmdc:mga0n895_2440_c1 3300050512 Bacteria 14517
701 nmdc:mga0n895_3804_c1 3300050512 Bacteria 12226
702 nmdc:mga0n895_39045_c1 3300050512 Bacteria 4603
703 nmdc:mga0n895_45134_c1 3300050512 Bacteria 4299
704 nmdc:mga0n895_58225_c1 3300050512 Bacteria 3809
705 nmdc:mga0rr50_127864_c1 3300050513 Bacteria 2031
706 nmdc:mga0rr50_133690_c1 3300050513 Bacteria 1989
707 nmdc:mga0rr50_31421_c1 3300050513 Bacteria 3770
708 nmdc:mga0rr50_542_c1 3300050513 Bacteria 20249
709 nmdc:mga0rr50_7901_c1 3300050513 Bacteria 6598
710 nmdc:mga08x19_1124_c1 3300050514 Bacteria 16670
711 nmdc:mga08x19_6281_c1 3300050514 Bacteria 7033
712 nmdc:mga0a205_10361_c1 3300050515 Bacteria 8567
713 nmdc:mga0a205_13084_c1 3300050515 Bacteria 7707
714 nmdc:mga0a205_134057_c1 3300050515 Bacteria 2377
715 nmdc:mga0a205_293_c2 3300050515 Bacteria 34916
716 nmdc:mga0a205_36064_c1 3300050515 Bacteria 4751
717 nmdc:mga0a205_65360_c1 3300050515 Bacteria 3514
718 nmdc:mga0a205_9784_c1 3300050515 Bacteria 8789
719 Ga0500635_0000113 3300053080 Bacteria 49202
720 Ga0495655_0000117 3300053083 Bacteria 14650
721 Ga0495655_0007332 3300053083 Bacteria 2045
722 Ga0500641_0000973 3300053096 Bacteria 10189
723 Ga0500568_0006841 3300053139 Bacteria 5678
724 Ga0501084_0005639 3300054114 Bacteria 10280
725 Ga0501084_0009502 3300054114 Bacteria 8046
726 Ga0587111_0000631 3300060346 Bacteria 3576
727 Ga0501082_0000005 3300060353 Bacteria 133412
728 Ga0466962_0005278 3300061719 Bacteria 6207
729 Ga0530510_0009755 3300061734 Bacteria 6738

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0037772 Ga0373931_0037772_1090_2502 429
2 3300044842 Ga0466957_0082110 Ga0466957_0082110_673_1983 436
3 3300046535 Ga0495586_0038429 Ga0495586_0038429_1200_2546 447
4 3300035116 Ga0373945_0032559 Ga0373945_0032559_467_1828 452
5 3300046526 Ga0495666_0015944 Ga0495666_0015944_2340_3701 452
6 3300044712 Ga0453684_0138564 Ga0453684_0138564_19_1635 477
7 3300048913 Ga0496110_0063628 Ga0496110_0063628_883_2553 478
8 3300036401 Ga0373937_0000993 Ga0373937_0000993_21663_23273 481
9 3300014326 Ga0157380_10023538 Ga0157380_100235386 483
10 3300050508 nmdc:mga09592_93784_c1 nmdc:mga09592_93784_c1_10_1632 486
11 3300006852 Ga0075433_10025564 Ga0075433_100255642 487
12 3300006871 Ga0075434_100003683 Ga0075434_1000036837 487
13 3300009176 Ga0105242_10043311 Ga0105242_100433112 491
14 3300050507 nmdc:mga05p37_76295_c2 nmdc:mga05p37_76295_c2_1043_2653 491
15 3300027907 Ga0207428_10101471 Ga0207428_101014711 493
16 3300049587 Ga0501071_0120085 Ga0501071_0120085_288_1934 495
17 3300003781 Ga0055536_1011983 Ga0055536_10119831 496
18 3300005331 Ga0070670_100056141 Ga0070670_1000561412 496
19 3300005336 Ga0070680_100017974 Ga0070680_1000179744 496
20 3300005336 Ga0070680_100080323 Ga0070680_1000803232 496
21 3300005341 Ga0070691_10008765 Ga0070691_100087656 496
22 3300005344 Ga0070661_100041487 Ga0070661_1000414874 496
23 3300005345 Ga0070692_10020165 Ga0070692_100201653 496
24 3300005347 Ga0070668_100020167 Ga0070668_1000201675 496
25 3300005355 Ga0070671_100021909 Ga0070671_1000219092 496
26 3300005366 Ga0070659_100044061 Ga0070659_1000440612 496
27 3300005440 Ga0070705_100025872 Ga0070705_1000258722 496
28 3300005455 Ga0070663_100026338 Ga0070663_1000263384 496
29 3300005458 Ga0070681_10145485 Ga0070681_101454851 496
30 3300005466 Ga0070685_10078232 Ga0070685_100782322 496
31 3300005530 Ga0070679_100040799 Ga0070679_1000407992 496
32 3300005535 Ga0070684_100014736 Ga0070684_1000147366 496
33 3300005549 Ga0070704_100016965 Ga0070704_1000169652 496
34 3300005577 Ga0068857_100206113 Ga0068857_1002061132 496
35 3300005578 Ga0068854_100014117 Ga0068854_1000141172 496
36 3300005617 Ga0068859_100018501 Ga0068859_1000185015 496
37 3300005840 Ga0068870_10008070 Ga0068870_100080702 496
38 3300005841 Ga0068863_100061686 Ga0068863_1000616861 496
39 3300005842 Ga0068858_100032311 Ga0068858_1000323115 496
40 3300005843 Ga0068860_100040049 Ga0068860_1000400495 496
41 3300005844 Ga0068862_100035927 Ga0068862_1000359273 496
42 3300005937 Ga0081455_10094323 Ga0081455_100943232 496
43 3300006058 Ga0075432_10012695 Ga0075432_100126952 496
44 3300006844 Ga0075428_100000756 Ga0075428_10000075628 496
45 3300006844 Ga0075428_100042186 Ga0075428_1000421862 496
46 3300006852 Ga0075433_10087674 Ga0075433_100876742 496
47 3300006880 Ga0075429_100060377 Ga0075429_1000603774 496
48 3300006931 Ga0097620_100018501 Ga0097620_1000185016 496
49 3300009094 Ga0111539_10077981 Ga0111539_100779812 496
50 3300009098 Ga0105245_10004050 Ga0105245_100040504 496
51 3300009101 Ga0105247_10012624 Ga0105247_100126244 496
52 3300009148 Ga0105243_10006051 Ga0105243_100060513 496
53 3300010375 Ga0105239_10014607 Ga0105239_100146076 496
54 3300013104 Ga0157370_10052371 Ga0157370_100523712 496
55 3300013296 Ga0157374_10088530 Ga0157374_100885302 496
56 3300013307 Ga0157372_10085983 Ga0157372_100859834 496
57 3300013308 Ga0157375_10022636 Ga0157375_100226367 496
58 3300014326 Ga0157380_10015368 Ga0157380_100153685 496
59 3300014969 Ga0157376_10042351 Ga0157376_100423512 496
60 3300017792 Ga0163161_10040039 Ga0163161_100400394 496
61 3300025292 Ga0209676_1000307 Ga0209676_100030782 496
62 3300025298 Ga0209050_1003024 Ga0209050_10030248 496
63 3300025303 Ga0209051_1001868 Ga0209051_100186814 496
64 3300025321 Ga0207656_10026684 Ga0207656_100266842 496
65 3300025728 Ga0207655_1025199 Ga0207655_10251991 496
66 3300025900 Ga0207710_10004767 Ga0207710_100047676 496
67 3300025907 Ga0207645_10041262 Ga0207645_100412622 496
68 3300025908 Ga0207643_10013262 Ga0207643_100132622 496
69 3300025909 Ga0207705_10088662 Ga0207705_100886622 496
70 3300025912 Ga0207707_10124841 Ga0207707_101248412 496
71 3300025917 Ga0207660_10013073 Ga0207660_100130734 496
72 3300025917 Ga0207660_10026023 Ga0207660_100260233 496
73 3300025918 Ga0207662_10023915 Ga0207662_100239153 496
74 3300025919 Ga0207657_10023809 Ga0207657_100238093 496
75 3300025924 Ga0207694_10034754 Ga0207694_100347544 496
76 3300025927 Ga0207687_10048475 Ga0207687_100484752 496
77 3300025932 Ga0207690_10061452 Ga0207690_100614522 496
78 3300025935 Ga0207709_10035654 Ga0207709_100356543 496
79 3300025937 Ga0207669_10039479 Ga0207669_100394792 496
80 3300025940 Ga0207691_10010200 Ga0207691_100102006 496
81 3300025941 Ga0207711_10039269 Ga0207711_100392694 496
82 3300025944 Ga0207661_10002360 Ga0207661_1000236011 496
83 3300025944 Ga0207661_10139443 Ga0207661_101394432 496
84 3300025944 Ga0207661_10152895 Ga0207661_101528952 496
85 3300025972 Ga0207668_10045064 Ga0207668_100450642 496
86 3300025981 Ga0207640_10098101 Ga0207640_100981012 496
87 3300026023 Ga0207677_10014291 Ga0207677_100142913 496
88 3300026067 Ga0207678_10022747 Ga0207678_100227472 496
89 3300026075 Ga0207708_10010152 Ga0207708_100101526 496
90 3300026095 Ga0207676_10059727 Ga0207676_100597272 496
91 3300026116 Ga0207674_10110549 Ga0207674_101105492 496
92 3300026118 Ga0207675_100103433 Ga0207675_1001034332 496
93 3300027907 Ga0207428_10000525 Ga0207428_1000052533 496
94 3300027907 Ga0207428_10122484 Ga0207428_101224841 496
95 3300027907 Ga0207428_10130140 Ga0207428_101301402 496
96 3300048905 Ga0496102_0063325 Ga0496102_0063325_886_2535 496
97 3300048907 Ga0496104_0071226 Ga0496104_0071226_1353_2999 496
98 3300048908 Ga0496105_0034676 Ga0496105_0034676_1580_3229 496
99 3300048911 Ga0496108_0026526 Ga0496108_0026526_1257_2906 496
100 3300048911 Ga0496108_0058422 Ga0496108_0058422_325_1971 496
101 3300048912 Ga0496109_0117816 Ga0496109_0117816_172_1818 496
102 3300048913 Ga0496110_0006233 Ga0496110_0006233_5548_7194 496
103 3300048913 Ga0496110_0021523 Ga0496110_0021523_1638_3287 496
104 3300048914 Ga0496111_0004949 Ga0496111_0004949_1400_3046 496
105 3300048917 Ga0496114_0026280 Ga0496114_0026280_1897_3546 496
106 3300049572 Ga0501036_0007242 Ga0501036_0007242_5491_7137 496
107 3300049574 Ga0501038_0016982 Ga0501038_0016982_1321_2967 496
108 3300049575 Ga0501039_0031982 Ga0501039_0031982_682_2328 496
109 3300049576 Ga0501040_0007347 Ga0501040_0007347_3089_4735 496
110 3300049577 Ga0501041_0022155 Ga0501041_0022155_1360_3006 496
111 3300049578 Ga0501042_0008684 Ga0501042_0008684_1341_2987 496
112 3300049580 Ga0501046_0057586 Ga0501046_0057586_52_1698 496
113 3300049583 Ga0501067_0051951 Ga0501067_0051951_196_1842 496
114 3300049584 Ga0501068_0064774 Ga0501068_0064774_53_1699 496
115 3300049587 Ga0501071_0004658 Ga0501071_0004658_2705_4351 496
116 3300049587 Ga0501071_0061608 Ga0501071_0061608_615_2261 496
117 3300049588 Ga0501072_0019775 Ga0501072_0019775_246_1892 496
118 3300049588 Ga0501072_0025135 Ga0501072_0025135_2070_3716 496
119 3300049591 Ga0501075_0013262 Ga0501075_0013262_331_1977 496
120 3300049592 Ga0501076_0000735 Ga0501076_0000735_6423_8069 496
121 3300049592 Ga0501076_0018666 Ga0501076_0018666_330_1976 496
122 3300049593 Ga0501077_0008969 Ga0501077_0008969_2588_4234 496
123 3300049741 Ga0501079_0009838 Ga0501079_0009838_2879_4525 496
124 3300049742 Ga0501080_0034608 Ga0501080_0034608_1750_3396 496
125 3300049743 Ga0501081_0016140 Ga0501081_0016140_1611_3257 496
126 3300049744 Ga0501083_0007845 Ga0501083_0007845_3107_4753 496
127 3300049822 Ga0501035_0055937 Ga0501035_0055937_633_2279 496
128 3300049824 Ga0501045_0007245 Ga0501045_0007245_2906_4552 496
129 3300050508 nmdc:mga09592_117865_c1 nmdc:mga09592_117865_c1_44_1690 496
130 3300050511 nmdc:mga08y16_77603_c1 nmdc:mga08y16_77603_c1_1132_2778 496
131 3300050515 nmdc:mga0a205_134057_c1 nmdc:mga0a205_134057_c1_348_1994 496
132 3300054114 Ga0501084_0005639 Ga0501084_0005639_8062_9708 496
133 3300061734 Ga0530510_0009755 Ga0530510_0009755_1300_2946 496
134 3300005355 Ga0070671_100054204 Ga0070671_1000542042 497
135 3300005456 Ga0070678_100034564 Ga0070678_1000345642 497
136 3300009551 Ga0105238_10065270 Ga0105238_100652703 497
137 3300031731 Ga0307405_10034459 Ga0307405_100344593 497
138 3300032002 Ga0307416_100026833 Ga0307416_1000268333 497
139 3300032126 Ga0307415_100011908 Ga0307415_1000119082 497
140 3300005563 Ga0068855_100004160 Ga0068855_1000041603 498
141 3300025912 Ga0207707_10001945 Ga0207707_1000194520 498
142 3300025913 Ga0207695_10003505 Ga0207695_100035054 498
143 3300025921 Ga0207652_10001697 Ga0207652_100016977 498
144 3300025949 Ga0207667_10003700 Ga0207667_100037003 498
145 3300005458 Ga0070681_10084357 Ga0070681_100843572 499
146 3300025912 Ga0207707_10056114 Ga0207707_100561143 499
147 3300025913 Ga0207695_10017072 Ga0207695_100170723 499
148 3300025931 Ga0207644_10051072 Ga0207644_100510722 499
149 3300025941 Ga0207711_10115276 Ga0207711_101152762 499
150 3300050492 nmdc:mga0yw44_54155_c1 nmdc:mga0yw44_54155_c1_168_1931 499
151 3300005289 Ga0065704_10010850 Ga0065704_100108501 500
152 3300005347 Ga0070668_100003090 Ga0070668_1000030902 500
153 3300005456 Ga0070678_100010305 Ga0070678_1000103054 500
154 3300021358 Ga0213873_10000002 Ga0213873_10000002245 500
155 3300021384 Ga0213876_10000001 Ga0213876_10000001328 500
156 3300025935 Ga0207709_10003953 Ga0207709_100039534 500
157 3300026121 Ga0207683_10031823 Ga0207683_100318233 500
158 3300039437 Ga0436365_0332720 Ga0436365_0332720_147969_149834 500
159 3300039453 Ga0436362_0660519 Ga0436362_0660519_690790_692655 500
160 3300048919 Ga0496116_0017050 Ga0496116_0017050_3153_4760 500
161 3300003771 Ga0055526_1007422 Ga0055526_10074223 501
162 3300003773 Ga0055537_1000177 Ga0055537_10001773 501
163 3300003775 Ga0055524_1004106 Ga0055524_10041063 501
164 3300003784 Ga0055534_1002897 Ga0055534_10028976 501
165 3300003790 Ga0055528_1000045 Ga0055528_10000453 501
166 3300006038 Ga0075365_10087655 Ga0075365_100876552 501
167 3300017792 Ga0163161_10067418 Ga0163161_100674183 501
168 3300025263 Ga0209565_1000037 Ga0209565_1000037252 501
169 3300025273 Ga0209673_1000494 Ga0209673_100049445 501
170 3300025291 Ga0209675_1000020 Ga0209675_1000020287 501
171 3300025295 Ga0209564_1000993 Ga0209564_100099315 501
172 3300025299 Ga0209256_1008116 Ga0209256_10081162 501
173 3300025304 Ga0209257_1004202 Ga0209257_10042026 501
174 3300028800 Ga0265338_10020079 Ga0265338_100200793 501
175 3300031548 Ga0307408_100029498 Ga0307408_1000294982 501
176 3300047320 Ga0495672_0001004 Ga0495672_0001004_12776_14386 501
177 3300005441 Ga0070700_100000104 Ga0070700_10000010422 502
178 3300005467 Ga0070706_100017295 Ga0070706_1000172956 502
179 3300025910 Ga0207684_10004441 Ga0207684_1000444110 502
180 3300025942 Ga0207689_10014485 Ga0207689_100144854 502
181 3300026075 Ga0207708_10000012 Ga0207708_10000012132 502
182 3300039437 Ga0436365_0741332 Ga0436365_0741332_1226_2968 502
183 3300039437 Ga0436365_1089890 Ga0436365_1089890_3977_5707 502
184 3300025920 Ga0207649_10043513 Ga0207649_100435132 503
185 3300053083 Ga0495655_0007332 Ga0495655_0007332_216_1988 503
186 3300009093 Ga0105240_10018998 Ga0105240_100189988 504
187 3300025913 Ga0207695_10046498 Ga0207695_100464983 504
188 3300039437 Ga0436365_1342523 Ga0436365_1342523_4515_6251 504
189 3300005466 Ga0070685_10059000 Ga0070685_100590002 505
190 3300005467 Ga0070706_100101580 Ga0070706_1001015802 505
191 3300006871 Ga0075434_100041707 Ga0075434_1000417071 505
192 3300039437 Ga0436365_1912664 Ga0436365_1912664_3329_5080 505
193 3300042435 Ga0439434_0018522 Ga0439434_0018522_305_2029 505
194 3300025304 Ga0209257_1000091 Ga0209257_100009185 506
195 3300047471 Ga0495684_0087390 Ga0495684_0087390_247_1947 506
196 3300005330 Ga0070690_100025032 Ga0070690_1000250324 507
197 3300005331 Ga0070670_100012630 Ga0070670_1000126301 507
198 3300005438 Ga0070701_10004769 Ga0070701_100047692 507
199 3300005459 Ga0068867_100000995 Ga0068867_1000009957 507
200 3300005518 Ga0070699_100005984 Ga0070699_1000059842 507
201 3300005543 Ga0070672_100009930 Ga0070672_1000099304 507
202 3300005544 Ga0070686_100083119 Ga0070686_1000831192 507
203 3300005549 Ga0070704_100013674 Ga0070704_1000136743 507
204 3300005564 Ga0070664_100008165 Ga0070664_1000081656 507
205 3300005577 Ga0068857_100018875 Ga0068857_1000188754 507
206 3300005617 Ga0068859_100010679 Ga0068859_1000106796 507
207 3300005719 Ga0068861_100068431 Ga0068861_1000684312 507
208 3300005840 Ga0068870_10000244 Ga0068870_1000024418 507
209 3300006931 Ga0097620_100010682 Ga0097620_1000106826 507
210 3300009094 Ga0111539_10168068 Ga0111539_101680682 507
211 3300009553 Ga0105249_10012001 Ga0105249_100120014 507
212 3300013297 Ga0157378_10118480 Ga0157378_101184802 507
213 3300013308 Ga0157375_10028477 Ga0157375_100284774 507
214 3300021384 Ga0213876_10008103 Ga0213876_100081032 507
215 3300025908 Ga0207643_10016159 Ga0207643_100161592 507
216 3300025926 Ga0207659_10000617 Ga0207659_100006179 507
217 3300025936 Ga0207670_10041302 Ga0207670_100413024 507
218 3300025936 Ga0207670_10051769 Ga0207670_100517692 507
219 3300025940 Ga0207691_10009037 Ga0207691_100090375 507
220 3300025940 Ga0207691_10010403 Ga0207691_100104034 507
221 3300025942 Ga0207689_10112758 Ga0207689_101127582 507
222 3300025972 Ga0207668_10038784 Ga0207668_100387842 507
223 3300026035 Ga0207703_10082081 Ga0207703_100820812 507
224 3300026089 Ga0207648_10000375 Ga0207648_1000037529 507
225 3300026095 Ga0207676_10044867 Ga0207676_100448672 507
226 3300026116 Ga0207674_10043028 Ga0207674_100430285 507
227 3300026118 Ga0207675_100005097 Ga0207675_10000509713 507
228 3300026121 Ga0207683_10043872 Ga0207683_100438722 507
229 3300027907 Ga0207428_10060949 Ga0207428_100609493 507
230 3300028380 Ga0268265_10000263 Ga0268265_1000026339 507
231 3300028381 Ga0268264_10002400 Ga0268264_1000240012 507
232 3300028800 Ga0265338_10025006 Ga0265338_100250066 507
233 3300031251 Ga0265327_10000005 Ga0265327_10000005166 507
234 3300037853 Ga0436364_0822442 Ga0436364_0822442_2752_4509 507
235 3300039437 Ga0436365_0264177 Ga0436365_0264177_892_2646 507
236 3300039437 Ga0436365_1281712 Ga0436365_1281712_812_2569 507
237 3300045976 Ga0466967_0055360 Ga0466967_0055360_734_2428 507
238 3300046683 Ga0495658_0024804 Ga0495658_0024804_701_2407 507
239 3300047321 Ga0495676_0066783 Ga0495676_0066783_624_2330 507
240 3300050509 nmdc:mga0qj67_4864_c2 nmdc:mga0qj67_4864_c2_7327_9036 507
241 3300050512 nmdc:mga0n895_45134_c1 nmdc:mga0n895_45134_c1_699_2402 507
242 3300050513 nmdc:mga0rr50_133690_c1 nmdc:mga0rr50_133690_c1_79_1782 507
243 3300006844 Ga0075428_100055111 Ga0075428_1000551115 508
244 3300009094 Ga0111539_10011408 Ga0111539_100114086 508
245 3300025918 Ga0207662_10047449 Ga0207662_100474492 508
246 3300036401 Ga0373937_0276078 Ga0373937_0276078_32_1561 508
247 3300005618 Ga0068864_100006309 Ga0068864_1000063093 509
248 3300006844 Ga0075428_100014173 Ga0075428_1000141733 509
249 3300009093 Ga0105240_10005108 Ga0105240_1000510819 509
250 3300014325 Ga0163163_10046487 Ga0163163_100464871 509
251 3300021384 Ga0213876_10004239 Ga0213876_100042394 509
252 3300026041 Ga0207639_10000006 Ga0207639_10000006280 509
253 3300026095 Ga0207676_10016261 Ga0207676_100162617 509
254 3300027907 Ga0207428_10025102 Ga0207428_100251024 509
255 3300031240 Ga0265320_10007095 Ga0265320_100070955 509
256 3300050511 nmdc:mga08y16_73139_c1 nmdc:mga08y16_73139_c1_1485_3152 509
257 3300050512 nmdc:mga0n895_23617_c1 nmdc:mga0n895_23617_c1_1479_3185 509
258 3300009094 Ga0111539_10000903 Ga0111539_1000090326 510
259 3300050508 nmdc:mga09592_54214_c1 nmdc:mga09592_54214_c1_19_1731 510
260 3300005335 Ga0070666_10003449 Ga0070666_100034499 511
261 3300005458 Ga0070681_10011770 Ga0070681_100117708 511
262 3300005468 Ga0070707_100073024 Ga0070707_1000730245 511
263 3300005536 Ga0070697_100017194 Ga0070697_1000171944 511
264 3300006028 Ga0070717_10087829 Ga0070717_100878291 511
265 3300006844 Ga0075428_100008399 Ga0075428_1000083995 511
266 3300006852 Ga0075433_10088274 Ga0075433_100882743 511
267 3300009147 Ga0114129_10005112 Ga0114129_100051125 511
268 3300025922 Ga0207646_10005844 Ga0207646_1000584410 511
269 3300025922 Ga0207646_10006832 Ga0207646_1000683210 511
270 3300046454 Ga0495592_0000008 Ga0495592_0000008_78804_80606 511
271 3300046476 Ga0495662_0034466 Ga0495662_0034466_369_2171 511
272 3300046514 Ga0495618_0019297 Ga0495618_0019297_1581_3383 511
273 3300046516 Ga0495628_0000166 Ga0495628_0000166_52771_54573 511
274 3300046543 Ga0495645_0002948 Ga0495645_0002948_9562_11364 511
275 3300046678 Ga0495599_0029239 Ga0495599_0029239_266_2068 511
276 3300050507 nmdc:mga05p37_17027_c1 nmdc:mga05p37_17027_c1_5569_7335 511
277 3300050508 nmdc:mga09592_74464_c1 nmdc:mga09592_74464_c1_47_1813 511
278 3300050512 nmdc:mga0n895_39045_c1 nmdc:mga0n895_39045_c1_979_2745 511
279 3300050515 nmdc:mga0a205_36064_c1 nmdc:mga0a205_36064_c1_2911_4677 511
280 3300060346 Ga0587111_0000631 Ga0587111_0000631_1393_3156 511
281 3300005445 Ga0070708_100018452 Ga0070708_1000184527 512
282 3300005518 Ga0070699_100052736 Ga0070699_1000527363 512
283 3300032137 Ga0316585_10006452 Ga0316585_100064524 512
284 3300036647 Ga0316582_0008553 Ga0316582_0008553_1706_3253 512
285 3300036712 Ga0316584_0005118 Ga0316584_0005118_1881_3428 512
286 3300005340 Ga0070689_100065113 Ga0070689_1000651132 513
287 3300005355 Ga0070671_100010669 Ga0070671_1000106691 513
288 3300005457 Ga0070662_100047990 Ga0070662_1000479902 513
289 3300005544 Ga0070686_100006734 Ga0070686_1000067346 513
290 3300009147 Ga0114129_10010106 Ga0114129_1001010613 513
291 3300010375 Ga0105239_10174007 Ga0105239_101740072 513
292 3300028381 Ga0268264_10029986 Ga0268264_100299864 513
293 3300031665 Ga0316575_10026250 Ga0316575_100262502 513
294 3300045051 Ga0451576_0012996 Ga0451576_0012996_2657_4387 513
295 3300050507 nmdc:mga05p37_35507_c1 nmdc:mga05p37_35507_c1_2030_3793 513
296 3300050515 nmdc:mga0a205_13084_c1 nmdc:mga0a205_13084_c1_5151_6914 513
297 3300005354 Ga0070675_100035290 Ga0070675_1000352903 514
298 3300005456 Ga0070678_100062516 Ga0070678_1000625162 514
299 3300005548 Ga0070665_100024772 Ga0070665_1000247725 514
300 3300005843 Ga0068860_100033594 Ga0068860_1000335948 514
301 3300006358 Ga0068871_100011956 Ga0068871_1000119566 514
302 3300006844 Ga0075428_100012862 Ga0075428_10001286210 514
303 3300006881 Ga0068865_100025251 Ga0068865_1000252513 514
304 3300009093 Ga0105240_10007177 Ga0105240_100071778 514
305 3300009098 Ga0105245_10008265 Ga0105245_100082654 514
306 3300013102 Ga0157371_10012102 Ga0157371_1001210210 514
307 3300025926 Ga0207659_10045938 Ga0207659_100459382 514
308 3300025927 Ga0207687_10005201 Ga0207687_100052016 514
309 3300028381 Ga0268264_10000914 Ga0268264_1000091435 514
310 3300028558 Ga0265326_10001276 Ga0265326_100012768 514
311 3300028563 Ga0265319_1000747 Ga0265319_10007477 514
312 3300028577 Ga0265318_10003207 Ga0265318_100032072 514
313 3300028653 Ga0265323_10000215 Ga0265323_100002153 514
314 3300028654 Ga0265322_10000089 Ga0265322_1000008935 514
315 3300028666 Ga0265336_10000432 Ga0265336_1000043220 514
316 3300028800 Ga0265338_10002460 Ga0265338_1000246011 514
317 3300028800 Ga0265338_10006237 Ga0265338_1000623711 514
318 3300028800 Ga0265338_10006702 Ga0265338_1000670210 514
319 3300029957 Ga0265324_10000589 Ga0265324_1000058916 514
320 3300031235 Ga0265330_10001621 Ga0265330_100016213 514
321 3300031238 Ga0265332_10001623 Ga0265332_1000162312 514
322 3300031239 Ga0265328_10018376 Ga0265328_100183761 514
323 3300031240 Ga0265320_10000653 Ga0265320_1000065323 514
324 3300031240 Ga0265320_10014031 Ga0265320_100140312 514
325 3300031241 Ga0265325_10024796 Ga0265325_100247961 514
326 3300031242 Ga0265329_10000272 Ga0265329_1000027214 514
327 3300031247 Ga0265340_10003766 Ga0265340_100037662 514
328 3300031247 Ga0265340_10013223 Ga0265340_100132236 514
329 3300031249 Ga0265339_10000624 Ga0265339_1000062414 514
330 3300031250 Ga0265331_10001631 Ga0265331_100016316 514
331 3300031344 Ga0265316_10001836 Ga0265316_1000183616 514
332 3300031595 Ga0265313_10003911 Ga0265313_100039117 514
333 3300031595 Ga0265313_10031810 Ga0265313_100318103 514
334 3300031711 Ga0265314_10001492 Ga0265314_1000149214 514
335 3300031712 Ga0265342_10000142 Ga0265342_1000014214 514
336 3300031712 Ga0265342_10011896 Ga0265342_100118966 514
337 3300035170 Ga0373943_0022261 Ga0373943_0022261_326_2098 514
338 3300035692 Ga0373935_0028222 Ga0373935_0028222_496_2268 514
339 3300037068 Ga0373925_0001450 Ga0373925_0001450_17244_19013 514
340 3300046459 Ga0495629_0000024 Ga0495629_0000024_39320_41089 514
341 3300046526 Ga0495666_0000017 Ga0495666_0000017_64925_66694 514
342 3300046535 Ga0495586_0000120 Ga0495586_0000120_37141_38910 514
343 3300046663 Ga0495635_0000629 Ga0495635_0000629_18669_20441 514
344 3300046663 Ga0495635_0048401 Ga0495635_0048401_679_2451 514
345 3300047321 Ga0495676_0005941 Ga0495676_0005941_2642_4411 514
346 3300047322 Ga0495680_0001604 Ga0495680_0001604_22162_23934 514
347 3300047471 Ga0495684_0002350 Ga0495684_0002350_4031_5803 514
348 3300048904 Ga0496101_0000685 Ga0496101_0000685_17968_19740 514
349 3300048905 Ga0496102_0003011 Ga0496102_0003011_10070_11821 514
350 3300048917 Ga0496114_0002130 Ga0496114_0002130_13081_14853 514
351 3300049591 Ga0501075_0004287 Ga0501075_0004287_1546_3309 514
352 3300049593 Ga0501077_0000206 Ga0501077_0000206_14105_15868 514
353 3300050509 nmdc:mga0qj67_23614_c1 nmdc:mga0qj67_23614_c1_1701_3458 514
354 3300050512 nmdc:mga0n895_118143_c1 nmdc:mga0n895_118143_c1_806_2545 514
355 3300060353 Ga0501082_0000005 Ga0501082_0000005_97271_99034 514
356 3300009094 Ga0111539_10010083 Ga0111539_1001008311 515
357 3300026035 Ga0207703_10093545 Ga0207703_100935452 515
358 3300042876 Ga0451577_0022548 Ga0451577_0022548_2936_4726 515
359 3300044673 Ga0453683_0001132 Ga0453683_0001132_15050_16819 515
360 3300049576 Ga0501040_0006107 Ga0501040_0006107_2907_4700 515
361 3300049577 Ga0501041_0006178 Ga0501041_0006178_2100_3893 515
362 3300049578 Ga0501042_0010389 Ga0501042_0010389_862_2655 515
363 3300049587 Ga0501071_0008592 Ga0501071_0008592_2516_4309 515
364 3300049591 Ga0501075_0001743 Ga0501075_0001743_1838_3631 515
365 3300049593 Ga0501077_0008036 Ga0501077_0008036_1617_3410 515
366 3300049742 Ga0501080_0065414 Ga0501080_0065414_162_1955 515
367 3300049743 Ga0501081_0003310 Ga0501081_0003310_15_1808 515
368 3300050511 nmdc:mga08y16_12746_c1 nmdc:mga08y16_12746_c1_1669_3423 515
369 3300054114 Ga0501084_0009502 Ga0501084_0009502_5974_7767 515
370 3300005331 Ga0070670_100009318 Ga0070670_1000093184 516
371 3300025925 Ga0207650_10007091 Ga0207650_100070916 516
372 3300031728 Ga0316578_10014768 Ga0316578_100147682 516
373 3300031733 Ga0316577_10040013 Ga0316577_100400133 516
374 3300032133 Ga0316583_10004894 Ga0316583_100048943 516
375 3300032137 Ga0316585_10004587 Ga0316585_100045875 516
376 3300032168 Ga0316593_10000001 Ga0316593_1000000122 516
377 3300036647 Ga0316582_0000223 Ga0316582_0000223_14939_16525 516
378 3300003775 Ga0055524_1006970 Ga0055524_10069702 517
379 3300009147 Ga0114129_10019320 Ga0114129_100193209 517
380 3300014326 Ga0157380_10002857 Ga0157380_1000285710 517
381 3300025900 Ga0207710_10020698 Ga0207710_100206983 517
382 3300031691 Ga0316579_10062792 Ga0316579_100627921 517
383 3300032168 Ga0316593_10000372 Ga0316593_1000037210 517
384 3300049580 Ga0501046_0027727 Ga0501046_0027727_2072_3832 517
385 3300049588 Ga0501072_0036086 Ga0501072_0036086_1665_3425 517
386 3300050507 nmdc:mga05p37_33304_c1 nmdc:mga05p37_33304_c1_47_1810 517
387 3300050511 nmdc:mga08y16_18590_c1 nmdc:mga08y16_18590_c1_1938_3704 517
388 iso_pu_bacteria 2524614729 2525556322 517
389 iso_pu_bacteria 2894414249 2894414928 517
390 iso_pu_bacteria 2919513703 2919514193 517
391 iso_pu_bacteria 2919675420 2919676032 517
392 3300005288 Ga0065714_10068777 Ga0065714_100687772 518
393 3300005290 Ga0065712_10000389 Ga0065712_100003898 518
394 3300005290 Ga0065712_10002078 Ga0065712_100020782 518
395 3300005293 Ga0065715_10000231 Ga0065715_1000023112 518
396 3300005293 Ga0065715_10090395 Ga0065715_100903958 518
397 3300005293 Ga0065715_10103076 Ga0065715_101030761 518
398 3300005295 Ga0065707_10099691 Ga0065707_100996912 518
399 3300005329 Ga0070683_100000649 Ga0070683_1000006493 518
400 3300005331 Ga0070670_100018281 Ga0070670_1000182812 518
401 3300005336 Ga0070680_100045014 Ga0070680_1000450145 518
402 3300005338 Ga0068868_100002860 Ga0068868_10000286015 518
403 3300005345 Ga0070692_10008886 Ga0070692_100088864 518
404 3300005353 Ga0070669_100000352 Ga0070669_10000035219 518
405 3300005354 Ga0070675_100027987 Ga0070675_1000279877 518
406 3300005355 Ga0070671_100094732 Ga0070671_1000947321 518
407 3300005364 Ga0070673_100037962 Ga0070673_1000379622 518
408 3300005365 Ga0070688_100013815 Ga0070688_1000138156 518
409 3300005436 Ga0070713_100011224 Ga0070713_1000112245 518
410 3300005455 Ga0070663_100007029 Ga0070663_1000070298 518
411 3300005456 Ga0070678_100001166 Ga0070678_1000011663 518
412 3300005466 Ga0070685_10008340 Ga0070685_100083406 518
413 3300005535 Ga0070684_100003804 Ga0070684_10000380410 518
414 3300005545 Ga0070695_100057158 Ga0070695_1000571582 518
415 3300005577 Ga0068857_100159388 Ga0068857_1001593882 518
416 3300005617 Ga0068859_100007636 Ga0068859_1000076364 518
417 3300005618 Ga0068864_100044184 Ga0068864_1000441846 518
418 3300005844 Ga0068862_100005826 Ga0068862_10000582611 518
419 3300005985 Ga0081539_10000122 Ga0081539_1000012211 518
420 3300006042 Ga0075368_10019550 Ga0075368_100195502 518
421 3300006178 Ga0075367_10016574 Ga0075367_100165745 518
422 3300006178 Ga0075367_10049906 Ga0075367_100499062 518
423 3300006195 Ga0075366_10047802 Ga0075366_100478022 518
424 3300006844 Ga0075428_100005221 Ga0075428_10000522112 518
425 3300006847 Ga0075431_100039477 Ga0075431_1000394772 518
426 3300006852 Ga0075433_10000236 Ga0075433_1000023631 518
427 3300006852 Ga0075433_10004565 Ga0075433_100045655 518
428 3300006871 Ga0075434_100003430 Ga0075434_1000034306 518
429 3300006871 Ga0075434_100008145 Ga0075434_1000081458 518
430 3300006931 Ga0097620_100007636 Ga0097620_10000763611 518
431 3300007076 Ga0075435_100116643 Ga0075435_1001166432 518
432 3300009094 Ga0111539_10008858 Ga0111539_100088585 518
433 3300009147 Ga0114129_10006350 Ga0114129_100063509 518
434 3300009147 Ga0114129_10023573 Ga0114129_100235736 518
435 3300009177 Ga0105248_10021610 Ga0105248_100216104 518
436 3300014325 Ga0163163_10024047 Ga0163163_100240472 518
437 3300014325 Ga0163163_10024812 Ga0163163_100248125 518
438 3300014326 Ga0157380_10018808 Ga0157380_100188085 518
439 3300014326 Ga0157380_10120663 Ga0157380_101206632 518
440 3300014745 Ga0157377_10000260 Ga0157377_1000026018 518
441 3300025315 Ga0207697_10002245 Ga0207697_100022454 518
442 3300025901 Ga0207688_10010922 Ga0207688_100109226 518
443 3300025907 Ga0207645_10026691 Ga0207645_100266913 518
444 3300025908 Ga0207643_10049313 Ga0207643_100493132 518
445 3300025918 Ga0207662_10023471 Ga0207662_100234713 518
446 3300025919 Ga0207657_10010713 Ga0207657_100107138 518
447 3300025925 Ga0207650_10035554 Ga0207650_100355542 518
448 3300025925 Ga0207650_10036772 Ga0207650_100367726 518
449 3300025928 Ga0207700_10015684 Ga0207700_100156845 518
450 3300025933 Ga0207706_10066020 Ga0207706_100660202 518
451 3300025937 Ga0207669_10007218 Ga0207669_100072183 518
452 3300025941 Ga0207711_10015048 Ga0207711_100150486 518
453 3300025944 Ga0207661_10002465 Ga0207661_100024656 518
454 3300025945 Ga0207679_10017579 Ga0207679_100175792 518
455 3300025960 Ga0207651_10006179 Ga0207651_100061793 518
456 3300026023 Ga0207677_10000002 Ga0207677_10000002236 518
457 3300026067 Ga0207678_10017965 Ga0207678_100179657 518
458 3300026075 Ga0207708_10058240 Ga0207708_100582402 518
459 3300026089 Ga0207648_10013213 Ga0207648_100132132 518
460 3300026095 Ga0207676_10020445 Ga0207676_100204452 518
461 3300026116 Ga0207674_10050794 Ga0207674_100507942 518
462 3300026118 Ga0207675_100017249 Ga0207675_1000172498 518
463 3300026121 Ga0207683_10017830 Ga0207683_100178303 518
464 3300027907 Ga0207428_10001048 Ga0207428_1000104814 518
465 3300027907 Ga0207428_10125684 Ga0207428_101256842 518
466 3300028380 Ga0268265_10018414 Ga0268265_100184148 518
467 3300028380 Ga0268265_10034336 Ga0268265_100343363 518
468 3300028558 Ga0265326_10004659 Ga0265326_100046596 518
469 3300031251 Ga0265327_10000580 Ga0265327_1000058032 518
470 3300031251 Ga0265327_10016399 Ga0265327_100163994 518
471 3300031344 Ga0265316_10000234 Ga0265316_1000023454 518
472 3300032005 Ga0307411_10063644 Ga0307411_100636442 518
473 3300035112 Ga0373932_0000070 Ga0373932_0000070_11968_13884 518
474 3300035118 Ga0373954_0000506 Ga0373954_0000506_4678_6270 518
475 3300035118 Ga0373954_0003169 Ga0373954_0003169_1172_2761 518
476 3300037068 Ga0373925_0002115 Ga0373925_0002115_1468_3234 518
477 3300046454 Ga0495592_0000978 Ga0495592_0000978_6237_7826 518
478 3300046516 Ga0495628_0000681 Ga0495628_0000681_6259_7848 518
479 3300046543 Ga0495645_0003396 Ga0495645_0003396_2636_4225 518
480 3300048905 Ga0496102_0128752 Ga0496102_0128752_319_2082 518
481 3300048907 Ga0496104_0040764 Ga0496104_0040764_2251_4014 518
482 3300048911 Ga0496108_0030232 Ga0496108_0030232_443_2206 518
483 3300048912 Ga0496109_0002159 Ga0496109_0002159_8489_10252 518
484 3300048912 Ga0496109_0004351 Ga0496109_0004351_2108_3871 518
485 3300048913 Ga0496110_0005001 Ga0496110_0005001_4260_6023 518
486 3300048913 Ga0496110_0047217 Ga0496110_0047217_303_2066 518
487 3300048914 Ga0496111_0059782 Ga0496111_0059782_932_2695 518
488 3300048915 Ga0496112_0006706 Ga0496112_0006706_1678_3441 518
489 3300048915 Ga0496112_0008524 Ga0496112_0008524_1626_3389 518
490 3300048916 Ga0496113_0119496 Ga0496113_0119496_92_1855 518
491 3300048917 Ga0496114_0003715 Ga0496114_0003715_5193_6956 518
492 3300048927 Ga0496124_0000115 Ga0496124_0000115_139229_140845 518
493 3300049571 Ga0501034_0021828 Ga0501034_0021828_2965_4728 518
494 3300049572 Ga0501036_0008524 Ga0501036_0008524_2469_4241 518
495 3300049575 Ga0501039_0082967 Ga0501039_0082967_403_2166 518
496 3300049578 Ga0501042_0021669 Ga0501042_0021669_2508_4280 518
497 3300049578 Ga0501042_0077171 Ga0501042_0077171_559_2319 518
498 3300049582 Ga0501048_0043297 Ga0501048_0043297_1383_3155 518
499 3300049587 Ga0501071_0019115 Ga0501071_0019115_169_1941 518
500 3300049591 Ga0501075_0027763 Ga0501075_0027763_1135_2907 518
501 3300049592 Ga0501076_0004937 Ga0501076_0004937_1261_3033 518
502 3300050493 nmdc:mga0k408_8449_c1 nmdc:mga0k408_8449_c1_1987_3750 518
503 3300050507 nmdc:mga05p37_116964_c1 nmdc:mga05p37_116964_c1_360_2123 518
504 3300050507 nmdc:mga05p37_12451_c1 nmdc:mga05p37_12451_c1_4507_6273 518
505 3300050507 nmdc:mga05p37_17769_c1 nmdc:mga05p37_17769_c1_1313_3079 518
506 3300050507 nmdc:mga05p37_7314_c1 nmdc:mga05p37_7314_c1_7010_8770 518
507 3300050508 nmdc:mga09592_1527_c1 nmdc:mga09592_1527_c1_6590_8353 518
508 3300050508 nmdc:mga09592_67230_c1 nmdc:mga09592_67230_c1_167_1930 518
509 3300050509 nmdc:mga0qj67_5865_c1 nmdc:mga0qj67_5865_c1_5137_6900 518
510 3300050510 nmdc:mga06r32_219004_c1 nmdc:mga06r32_219004_c1_38_1801 518
511 3300050510 nmdc:mga06r32_67060_c1 nmdc:mga06r32_67060_c1_821_2584 518
512 3300050511 nmdc:mga08y16_7357_c1 nmdc:mga08y16_7357_c1_795_2558 518
513 3300050512 nmdc:mga0n895_123078_c1 nmdc:mga0n895_123078_c1_836_2602 518
514 3300050512 nmdc:mga0n895_2440_c1 nmdc:mga0n895_2440_c1_7346_9106 518
515 3300050512 nmdc:mga0n895_58225_c1 nmdc:mga0n895_58225_c1_1171_2934 518
516 3300050513 nmdc:mga0rr50_127864_c1 nmdc:mga0rr50_127864_c1_193_1959 518
517 3300050513 nmdc:mga0rr50_7901_c1 nmdc:mga0rr50_7901_c1_4276_6036 518
518 3300050515 nmdc:mga0a205_10361_c1 nmdc:mga0a205_10361_c1_4774_6537 518
519 3300050515 nmdc:mga0a205_293_c2 nmdc:mga0a205_293_c2_5430_7190 518
520 3300050515 nmdc:mga0a205_9784_c1 nmdc:mga0a205_9784_c1_3368_5128 518
521 3300053096 Ga0500641_0000973 Ga0500641_0000973_408_2171 518
522 3300053139 Ga0500568_0006841 Ga0500568_0006841_2189_3949 518
523 iso_pu_bacteria 2545555834 2545679529 518
524 iso_pu_bacteria 2824600985 2824602316 518
525 iso_pu_bacteria 2824609381 2824610590 518
526 iso_pu_bacteria 2824653114 2824654284 518
527 iso_pu_bacteria 2888419890 2888424964 518
528 iso_pu_bacteria 641522639 641644058 518
529 iso_pu_bacteria 643348564 643600090 518
530 iso_pu_bacteria 8006964411 8006965326 518
531 iso_pu_bacteria 8006994254 8006996760 518
532 3300005295 Ga0065707_10088172 Ga0065707_100881723 519
533 3300005327 Ga0070658_10006034 Ga0070658_100060343 519
534 3300005331 Ga0070670_100000094 Ga0070670_10000009415 519
535 3300005334 Ga0068869_100007312 Ga0068869_1000073124 519
536 3300005338 Ga0068868_100000245 Ga0068868_10000024520 519
537 3300005340 Ga0070689_100002543 Ga0070689_10000254314 519
538 3300005340 Ga0070689_100105692 Ga0070689_1001056922 519
539 3300005353 Ga0070669_100000348 Ga0070669_10000034829 519
540 3300005354 Ga0070675_100000020 Ga0070675_10000002084 519
541 3300005445 Ga0070708_100124786 Ga0070708_1001247862 519
542 3300005467 Ga0070706_100018329 Ga0070706_1000183298 519
543 3300005518 Ga0070699_100005764 Ga0070699_1000057641 519
544 3300005518 Ga0070699_100064587 Ga0070699_1000645872 519
545 3300005535 Ga0070684_100001971 Ga0070684_1000019714 519
546 3300005536 Ga0070697_100015122 Ga0070697_1000151223 519
547 3300005543 Ga0070672_100000242 Ga0070672_1000002422 519
548 3300005547 Ga0070693_100019125 Ga0070693_1000191252 519
549 3300005578 Ga0068854_100002935 Ga0068854_1000029354 519
550 3300005578 Ga0068854_100033338 Ga0068854_1000333383 519
551 3300005615 Ga0070702_100004921 Ga0070702_1000049218 519
552 3300005618 Ga0068864_100000013 Ga0068864_10000001318 519
553 3300005842 Ga0068858_100000011 Ga0068858_10000001137 519
554 3300005844 Ga0068862_100000275 Ga0068862_1000002754 519
555 3300006028 Ga0070717_10000046 Ga0070717_1000004613 519
556 3300006847 Ga0075431_100001877 Ga0075431_10000187719 519
557 3300006847 Ga0075431_100036608 Ga0075431_1000366083 519
558 3300006871 Ga0075434_100035219 Ga0075434_1000352197 519
559 3300006880 Ga0075429_100038415 Ga0075429_1000384153 519
560 3300006914 Ga0075436_100000808 Ga0075436_1000008087 519
561 3300006914 Ga0075436_100004058 Ga0075436_1000040586 519
562 3300006914 Ga0075436_100011107 Ga0075436_1000111076 519
563 3300007076 Ga0075435_100000784 Ga0075435_1000007846 519
564 3300009036 Ga0105244_10006538 Ga0105244_100065383 519
565 3300009093 Ga0105240_10167631 Ga0105240_101676311 519
566 3300009094 Ga0111539_10000031 Ga0111539_1000003135 519
567 3300009098 Ga0105245_10000727 Ga0105245_1000072717 519
568 3300009098 Ga0105245_10001167 Ga0105245_1000116719 519
569 3300009551 Ga0105238_10000030 Ga0105238_1000003087 519
570 3300013105 Ga0157369_10000404 Ga0157369_1000040430 519
571 3300013296 Ga0157374_10000020 Ga0157374_10000020186 519
572 3300013297 Ga0157378_10003050 Ga0157378_1000305011 519
573 3300013297 Ga0157378_10009761 Ga0157378_100097613 519
574 3300013308 Ga0157375_10000024 Ga0157375_10000024126 519
575 3300013308 Ga0157375_10000389 Ga0157375_1000038920 519
576 3300014745 Ga0157377_10000031 Ga0157377_1000003130 519
577 3300014969 Ga0157376_10000003 Ga0157376_1000000382 519
578 3300021384 Ga0213876_10000135 Ga0213876_1000013536 519
579 3300025909 Ga0207705_10047196 Ga0207705_100471963 519
580 3300025917 Ga0207660_10005193 Ga0207660_100051934 519
581 3300025923 Ga0207681_10000305 Ga0207681_1000030511 519
582 3300025924 Ga0207694_10000002 Ga0207694_100000021012 519
583 3300025924 Ga0207694_10000003 Ga0207694_1000000388 519
584 3300025925 Ga0207650_10000101 Ga0207650_1000010115 519
585 3300025926 Ga0207659_10000035 Ga0207659_1000003518 519
586 3300025927 Ga0207687_10000024 Ga0207687_1000002438 519
587 3300025927 Ga0207687_10000301 Ga0207687_1000030110 519
588 3300025936 Ga0207670_10001271 Ga0207670_1000127116 519
589 3300025939 Ga0207665_10035772 Ga0207665_100357721 519
590 3300025940 Ga0207691_10000444 Ga0207691_1000044412 519
591 3300025942 Ga0207689_10006141 Ga0207689_100061412 519
592 3300025944 Ga0207661_10000022 Ga0207661_10000022171 519
593 3300025981 Ga0207640_10004476 Ga0207640_100044762 519
594 3300026023 Ga0207677_10000264 Ga0207677_1000026430 519
595 3300026035 Ga0207703_10000004 Ga0207703_10000004323 519
596 3300026095 Ga0207676_10000030 Ga0207676_10000030146 519
597 3300026118 Ga0207675_100140367 Ga0207675_1001403671 519
598 3300027876 Ga0209974_10003969 Ga0209974_100039692 519
599 3300027907 Ga0207428_10000012 Ga0207428_1000001271 519
600 3300028380 Ga0268265_10000191 Ga0268265_1000019124 519
601 3300028563 Ga0265319_1000001 Ga0265319_1000001466 519
602 3300028654 Ga0265322_10000224 Ga0265322_1000022410 519
603 3300028800 Ga0265338_10000111 Ga0265338_1000011196 519
604 3300028800 Ga0265338_10000607 Ga0265338_100006079 519
605 3300028800 Ga0265338_10027459 Ga0265338_100274598 519
606 3300029957 Ga0265324_10000978 Ga0265324_100009786 519
607 3300031240 Ga0265320_10003110 Ga0265320_100031103 519
608 3300031251 Ga0265327_10024010 Ga0265327_100240103 519
609 3300031595 Ga0265313_10000870 Ga0265313_1000087011 519
610 3300035241 Ga0373961_0000401 Ga0373961_0000401_15796_17565 519
611 3300039437 Ga0436365_0832427 Ga0436365_0832427_66817_68694 519
612 3300039453 Ga0436362_0086070 Ga0436362_0086070_3127_5004 519
613 3300045051 Ga0451576_0001932 Ga0451576_0001932_13761_15554 519
614 3300046459 Ga0495629_0085355 Ga0495629_0085355_369_2153 519
615 3300046515 Ga0495620_0000745 Ga0495620_0000745_14348_16216 519
616 3300046557 Ga0495622_0018006 Ga0495622_0018006_768_2552 519
617 3300047315 Ga0495581_0014274 Ga0495581_0014274_833_2617 519
618 3300048917 Ga0496114_0000020 Ga0496114_0000020_49975_51744 519
619 3300049589 Ga0501073_0029110 Ga0501073_0029110_485_2347 519
620 3300049742 Ga0501080_0065709 Ga0501080_0065709_767_2605 519
621 3300050508 nmdc:mga09592_15514_c1 nmdc:mga09592_15514_c1_824_2683 519
622 3300050510 nmdc:mga06r32_1445_c1 nmdc:mga06r32_1445_c1_6400_8262 519
623 3300050510 nmdc:mga06r32_39938_c1 nmdc:mga06r32_39938_c1_1358_3187 519
624 3300050510 nmdc:mga06r32_49833_c1 nmdc:mga06r32_49833_c1_2014_3888 519
625 3300050511 nmdc:mga08y16_7_c1 nmdc:mga08y16_7_c1_134590_136449 519
626 3300050512 nmdc:mga0n895_3804_c1 nmdc:mga0n895_3804_c1_7571_9337 519
627 3300050513 nmdc:mga0rr50_31421_c1 nmdc:mga0rr50_31421_c1_875_2797 519
628 3300050513 nmdc:mga0rr50_542_c1 nmdc:mga0rr50_542_c1_6818_8689 519
629 3300050514 nmdc:mga08x19_1124_c1 nmdc:mga08x19_1124_c1_7741_9612 519
630 3300050514 nmdc:mga08x19_6281_c1 nmdc:mga08x19_6281_c1_4672_6441 519
631 3300050515 nmdc:mga0a205_65360_c1 nmdc:mga0a205_65360_c1_194_1948 519
632 3300053083 Ga0495655_0000117 Ga0495655_0000117_7929_9800 519
633 3300005544 Ga0070686_100074646 Ga0070686_1000746461 520
634 3300005937 Ga0081455_10026507 Ga0081455_100265073 520
635 3300006844 Ga0075428_100123777 Ga0075428_1001237772 520
636 3300009094 Ga0111539_10259863 Ga0111539_102598631 520
637 3300009147 Ga0114129_10103609 Ga0114129_101036091 520
638 3300013306 Ga0163162_10023217 Ga0163162_100232171 520
639 3300025922 Ga0207646_10027865 Ga0207646_100278652 520
640 3300028556 Ga0265337_1013714 Ga0265337_10137142 520
641 3300028800 Ga0265338_10011992 Ga0265338_100119927 520
642 3300029957 Ga0265324_10004432 Ga0265324_100044326 520
643 3300031711 Ga0265314_10001680 Ga0265314_1000168011 520
644 3300031711 Ga0265314_10071646 Ga0265314_100716461 520
645 3300035117 Ga0373953_0005805 Ga0373953_0005805_1779_3368 520
646 3300035118 Ga0373954_0007174 Ga0373954_0007174_1166_2755 520
647 3300035120 Ga0373957_0020329 Ga0373957_0020329_325_1914 520
648 3300035692 Ga0373935_0016410 Ga0373935_0016410_2654_4243 520
649 3300036401 Ga0373937_0022242 Ga0373937_0022242_1477_3282 520
650 3300037068 Ga0373925_0013654 Ga0373925_0013654_4247_5836 520
651 3300042156 Ga0439446_0005265 Ga0439446_0005265_459_2111 520
652 3300042876 Ga0451577_0043672 Ga0451577_0043672_215_2032 520
653 3300045051 Ga0451576_0030186 Ga0451576_0030186_1201_3030 520
654 3300046463 Ga0495653_0015810 Ga0495653_0015810_2226_3815 520
655 3300046472 Ga0495580_0075543 Ga0495580_0075543_83_1672 520
656 3300046516 Ga0495628_0014263 Ga0495628_0014263_855_2444 520
657 3300046517 Ga0495630_0009382 Ga0495630_0009382_4317_5906 520
658 3300046559 Ga0495667_0033781 Ga0495667_0033781_735_2324 520
659 3300046675 Ga0495657_0010602 Ga0495657_0010602_1221_2810 520
660 3300046683 Ga0495658_0080398 Ga0495658_0080398_239_1828 520
661 3300046809 Ga0495600_0015122 Ga0495600_0015122_1520_3109 520
662 3300047317 Ga0495604_0037893 Ga0495604_0037893_24_1613 520
663 3300047319 Ga0495674_0001483 Ga0495674_0001483_544_2133 520
664 3300047471 Ga0495684_0011475 Ga0495684_0011475_1715_3304 520
665 3300005981 Ga0081538_10030223 Ga0081538_100302231 521
666 3300006173 Ga0070716_100009457 Ga0070716_1000094573 521
667 3300007265 Ga0099794_10048342 Ga0099794_100483422 521
668 3300007788 Ga0099795_10011555 Ga0099795_100115553 521
669 3300010159 Ga0099796_10005087 Ga0099796_100050873 521
670 3300017792 Ga0163161_10091016 Ga0163161_100910162 521
671 3300025939 Ga0207665_10040660 Ga0207665_100406605 521
672 3300025972 Ga0207668_10051730 Ga0207668_100517303 521
673 3300035086 Ga0373934_0001195 Ga0373934_0001195_3081_4670 521
674 3300035119 Ga0373956_0000019 Ga0373956_0000019_24325_25914 521
675 3300035119 Ga0373956_0031830 Ga0373956_0031830_260_2122 521
676 3300035120 Ga0373957_0001675 Ga0373957_0001675_245_1834 521
677 3300035172 Ga0373955_0010696 Ga0373955_0010696_1040_2629 521
678 3300035724 Ga0373933_0001818 Ga0373933_0001818_10205_11794 521
679 3300037466 Ga0395898_0163807 Ga0395898_0163807_185_1954 521
680 3300046460 Ga0495638_0011225 Ga0495638_0011225_2499_4244 521
681 3300046462 Ga0495651_0000147 Ga0495651_0000147_34108_35697 521
682 3300046514 Ga0495618_0002272 Ga0495618_0002272_8047_9909 521
683 3300046535 Ga0495586_0000768 Ga0495586_0000768_12835_14697 521
684 3300046642 Ga0495634_0001642 Ga0495634_0001642_10935_12797 521
685 3300049568 Ga0501031_0000133 Ga0501031_0000133_37665_39533 521
686 3300037312 Ga0395899_0001243 Ga0395899_0001243_1663_3315 522
687 3300037418 Ga0395900_0005627 Ga0395900_0005627_4413_6065 522
688 3300037466 Ga0395898_0008569 Ga0395898_0008569_4120_5772 522
689 3300037471 Ga0395905_0014228 Ga0395905_0014228_3608_5260 522
690 3300045051 Ga0451576_0021397 Ga0451576_0021397_567_2213 522
691 3300035089 Ga0373944_0000152 Ga0373944_0000152_552_2462 523
692 3300002772 JGI25164J39214_1002626 JGI25164J39214_10026262 525
693 3300003756 Ga0055533_1000033 Ga0055533_1000033150 525
694 3300003759 Ga0055525_1000767 Ga0055525_10007678 525
695 3300006353 Ga0075370_10002711 Ga0075370_100027114 525
696 3300025226 Ga0209674_100064 Ga0209674_10006498 525
697 3300025230 Ga0209563_100099 Ga0209563_10009998 525
698 3300025231 Ga0207427_101039 Ga0207427_10103912 525
699 3300025253 Ga0209677_100175 Ga0209677_10017539 525
700 3300025919 Ga0207657_10061516 Ga0207657_100615163 525
701 3300050496 nmdc:mga07m45_2243_c2 nmdc:mga07m45_2243_c2_3564_5195 525
702 3300005327 Ga0070658_10050821 Ga0070658_100508212 526
703 3300025253 Ga0209677_104320 Ga0209677_1043203 526
704 3300030521 Ga0307511_10056147 Ga0307511_100561473 526
705 3300046506 Ga0495583_0000046 Ga0495583_0000046_65656_67287 526
706 3300025256 Ga0209759_1002013 Ga0209759_10020134 527
707 3300003761 Ga0055535_1000307 Ga0055535_100030725 528
708 3300003763 Ga0055529_1000488 Ga0055529_100048823 528
709 3300003792 Ga0055540_1008475 Ga0055540_10084755 528
710 3300025242 Ga0209258_100319 Ga0209258_10031950 528
711 3300025256 Ga0209759_1001175 Ga0209759_10011757 528
712 3300025272 Ga0209455_1000157 Ga0209455_100015789 528
713 3300025303 Ga0209051_1002067 Ga0209051_100206712 528
714 3300047472 Ga0495686_0017170 Ga0495686_0017170_500_2131 528
715 3300053080 Ga0500635_0000113 Ga0500635_0000113_34872_36509 528
716 3300006195 Ga0075366_10078940 Ga0075366_100789402 529
717 3300025942 Ga0207689_10006852 Ga0207689_100068523 529
718 3300002705 JGI25156J39149_1000740 JGI25156J39149_100074010 530
719 3300002738 JGI25154J39366_1003058 JGI25154J39366_10030581 530
720 3300002741 JGI25157J39369_1000021 JGI25157J39369_100002113 530
721 3300002741 JGI25157J39369_1000351 JGI25157J39369_10003514 530
722 3300025242 Ga0209258_100699 Ga0209258_1006994 530
723 3300025246 Ga0209646_1000060 Ga0209646_1000060146 530
724 3300025250 Ga0209026_1000049 Ga0209026_1000049144 530
725 3300025253 Ga0209677_100782 Ga0209677_10078214 530
726 3300025256 Ga0209759_1000069 Ga0209759_1000069144 530
727 3300025913 Ga0207695_10009579 Ga0207695_100095792 530
728 3300026078 Ga0207702_10005245 Ga0207702_1000524512 530
729 3300028666 Ga0265336_10000040 Ga0265336_1000004035 530
730 3300029957 Ga0265324_10034373 Ga0265324_100343731 530
731 3300031730 Ga0307516_10003164 Ga0307516_1000316424 530
732 3300037312 Ga0395899_0005394 Ga0395899_0005394_4128_5849 530
733 3300037466 Ga0395898_0025434 Ga0395898_0025434_659_2296 530
734 3300038443 Ga0395901_0003173 Ga0395901_0003173_6809_8446 530
735 3300044683 Ga0466965_0003310 Ga0466965_0003310_2615_4243 530
736 3300044684 Ga0466966_0009059 Ga0466966_0009059_2411_4039 530
737 3300044693 Ga0466961_0025989 Ga0466961_0025989_943_2571 530
738 3300044706 Ga0466964_0004084 Ga0466964_0004084_1345_2973 530
739 3300044719 Ga0466971_0004547 Ga0466971_0004547_2732_4360 530
740 3300045049 Ga0466959_0026708 Ga0466959_0026708_2045_3673 530
741 3300045836 Ga0466958_0007306 Ga0466958_0007306_2431_4059 530
742 3300061719 Ga0466962_0005278 Ga0466962_0005278_3509_5137 530

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

55

539

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oma-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation 0.9839 17 514
6pw1-assembly2.cif.gz_C cytochrome c oxidase delta 16 0.9839 16 511
3omi-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation 0.9833 17 511
1m57-assembly2.cif.gz_G structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant)) 0.9825 12 520
3ehb-assembly1.cif.gz_A a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate 0.9804 12 517
ID Description Score Start End Superfamily
af_Q9ZZX1_1_342_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9812 15 335 1.20.210.10
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9787 15 475 1.20.210.10
af_O21042_10_509_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9731 16 482 1.20.210.10
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9668 14 522 1.20.210.10
af_P03878_1_258_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.966 15 257 1.20.210.10
ID Description Score Start End GO Terms
AF-S5MDM5-F1-model_v4 Cytochrome c oxidase subunit I 0.994 31 314 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A090SML1-F1-model_v4 deleted 0.9928 38 353
AF-A0A1M7HXD2-F1-model_v4 Cytochrome c oxidase subunit 1 0.9921 11 464 GO:0004129
GO:0009060
GO:0015990
GO:0020037
GO:0022904
GO:0045277
AF-A0A097ZNF2-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.992 152 350 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872
AF-B4XVT4-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9919 157 366 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map