F478575

General Info

Members Datasets Scaffolds Average Seq Length
741 400 685 221

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100002265|Ga0068864_10000226512
Length 260
Sequence MLRFDEPVLAFAAPCSSGATLSIRARLFLTAPARMRKNQSVTKPDAIAAARDPEPPRDCPICPRLVAYREVNRAEHPDWFNGPAPSFGDPQARLLVAGLAPGRQGANRTGRPFTGDFAGVLLYDTLLKLGFARGRYQARPDDGLELVDCMVSNAVRCAPPGNKPETSEEANCRPFLTARIAALPRLKVIVTLGDVSRRNVLRALGLKASAGIAGHGSEFQAGPYTVLNSYHCSRLNTNTGRLTPAMFEAVFVRAKALIDG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
13 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
14 2643221640 Caulobacter sp. Root342 Isolate Unclassified
15 2643221642 Caulobacter sp. Root343 Isolate Unclassified
16 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
17 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
18 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
19 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
32 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
33 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
34 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
35 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
36 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
37 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
38 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
39 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
40 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
41 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
42 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
221 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
222 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
223 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
224 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
225 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
226 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
227 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
348 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
349 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
350 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
351 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
354 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
355 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
356 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
357 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
358 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
364 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
365 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
366 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
367 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
371 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
372 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
373 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
374 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
375 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
376 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
377 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
378 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
381 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
382 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
387 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
388 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
389 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
390 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
391 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
392 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
393 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
394 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
395 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
396 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
397 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
398 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
399 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
400 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 0
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.35
Nodule 3.64
Rhizoplane 2.83
Rhizosphere 67.07
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1024640 3300003775 Bacteria 1902
2 Ga0055536_1001488 3300003781 Bacteria 14090
3 Ga0055536_1001673 3300003781 Bacteria 13162
4 Ga0055530_10003799 3300003791 Bacteria 8314
5 Ga0055530_10004881 3300003791 Bacteria 6680
6 Ga0055530_10028365 3300003791 Bacteria 1512
7 Ga0055531_10000799 3300003794 Bacteria 26105
8 Ga0055531_10000833 3300003794 Bacteria 25467
9 Ga0055531_10001352 3300003794 Bacteria 18278
10 Ga0055531_10033561 3300003794 Bacteria 1650
11 Ga0055531_10059501 3300003794 Bacteria 943
12 Ga0065165_1000210 3300005262 Bacteria 101721
13 Ga0065165_1001007 3300005262 Bacteria 34394
14 Ga0065165_1024553 3300005262 Bacteria 2022
15 Ga0065712_10020657 3300005290 Bacteria 1346
16 Ga0070658_10174440 3300005327 Bacteria 1807
17 Ga0070658_10562888 3300005327 Bacteria 987
18 Ga0070670_100000062 3300005331 Bacteria 112560
19 Ga0070670_100057708 3300005331 Bacteria 3332
20 Ga0068869_100521118 3300005334 Bacteria 995
21 Ga0070680_100113772 3300005336 Bacteria 2254
22 Ga0070680_100715920 3300005336 Bacteria 861
23 Ga0070682_100218252 3300005337 Bacteria 1355
24 Ga0070660_100098447 3300005339 Bacteria 2315
25 Ga0070660_100230085 3300005339 Bacteria 1508
26 Ga0070660_100530192 3300005339 Bacteria 981
27 Ga0070691_10081842 3300005341 Bacteria 1582
28 Ga0070661_100068188 3300005344 Bacteria 2614
29 Ga0070668_100001523 3300005347 Bacteria 16727
30 Ga0070668_100002210 3300005347 Bacteria 14287
31 Ga0070668_100002583 3300005347 Bacteria 13311
32 Ga0070668_100009206 3300005347 Bacteria 7323
33 Ga0070668_100016286 3300005347 Bacteria 5560
34 Ga0070669_100002957 3300005353 Bacteria 12250
35 Ga0070669_100164119 3300005353 Bacteria 1728
36 Ga0070671_100159057 3300005355 Bacteria 1909
37 Ga0070673_100808575 3300005364 Bacteria 866
38 Ga0070659_100000250 3300005366 Bacteria 42505
39 Ga0070659_100005883 3300005366 Bacteria 8836
40 Ga0070659_100032958 3300005366 Bacteria 4023
41 Ga0070667_100000178 3300005367 Bacteria 77450
42 Ga0070667_100004563 3300005367 Bacteria 11642
43 Ga0070667_100020319 3300005367 Bacteria 5512
44 Ga0070667_100171046 3300005367 Bacteria 1918
45 Ga0070714_100004266 3300005435 Bacteria 10767
46 Ga0070681_10002207 3300005458 Bacteria 17748
47 Ga0070681_10038255 3300005458 Bacteria 4810
48 Ga0070681_10177574 3300005458 Bacteria 2051
49 Ga0070706_100005625 3300005467 Bacteria 11923
50 Ga0070699_100006239 3300005518 Bacteria 10397
51 Ga0070679_100030766 3300005530 Bacteria 5302
52 Ga0070679_100614193 3300005530 Bacteria 1030
53 Ga0070697_100010902 3300005536 Bacteria 7099
54 Ga0068853_100126552 3300005539 Bacteria 2283
55 Ga0068853_100144638 3300005539 Bacteria 2136
56 Ga0070665_100000121 3300005548 Bacteria 147683
57 Ga0070665_100002121 3300005548 Bacteria 22148
58 Ga0070665_100002649 3300005548 Bacteria 19471
59 Ga0070665_100066641 3300005548 Bacteria 3612
60 Ga0070665_100376492 3300005548 Bacteria 1427
61 Ga0070665_100790429 3300005548 Bacteria 962
62 Ga0068855_100020193 3300005563 Bacteria 8000
63 Ga0068855_100117313 3300005563 Bacteria 3050
64 Ga0068855_100150193 3300005563 Bacteria 2649
65 Ga0068855_100298262 3300005563 Bacteria 1785
66 Ga0068855_100362370 3300005563 Bacteria 1595
67 Ga0068855_100586354 3300005563 Bacteria 1204
68 Ga0068856_100377011 3300005614 Bacteria 1438
69 Ga0068856_100620614 3300005614 Bacteria 1102
70 Ga0068852_100185943 3300005616 Bacteria 1957
71 Ga0068859_100000320 3300005617 Bacteria 48067
72 Ga0068859_100066598 3300005617 Bacteria 3637
73 Ga0068859_101524412 3300005617 Bacteria 738
74 Ga0068864_100000126 3300005618 Bacteria 74385
75 Ga0068864_100002265 3300005618 Bacteria 15913
76 Ga0068864_100033979 3300005618 Bacteria 4336
77 Ga0068864_100210318 3300005618 Bacteria 1791
78 Ga0068866_10029999 3300005718 Bacteria 2606
79 Ga0068863_100000282 3300005841 Bacteria 52485
80 Ga0068863_100001015 3300005841 Bacteria 28103
81 Ga0068863_100001240 3300005841 Bacteria 25427
82 Ga0068863_100013356 3300005841 Bacteria 7918
83 Ga0068863_100278321 3300005841 Bacteria 1621
84 Ga0068858_100000493 3300005842 Bacteria 41212
85 Ga0068858_100002660 3300005842 Bacteria 17976
86 Ga0068858_100027605 3300005842 Bacteria 5273
87 Ga0068858_100601581 3300005842 Bacteria 1066
88 Ga0068860_100000145 3300005843 Bacteria 115830
89 Ga0068860_100002315 3300005843 Bacteria 20018
90 Ga0068860_100022099 3300005843 Bacteria 6158
91 Ga0068860_100096149 3300005843 Bacteria 2823
92 Ga0068862_100001903 3300005844 Bacteria 18951
93 Ga0068862_100007746 3300005844 Bacteria 8882
94 Ga0068862_100017518 3300005844 Bacteria 5966
95 Ga0068862_100030692 3300005844 Bacteria 4531
96 Ga0068862_100033184 3300005844 Bacteria 4361
97 Ga0068862_100075652 3300005844 Bacteria 2913
98 Ga0068862_100098213 3300005844 Bacteria 2558
99 Ga0068862_100352022 3300005844 Bacteria 1367
100 Ga0081540_1007651 3300005983 Bacteria 7664
101 Ga0081540_1010892 3300005983 Bacteria 6107
102 Ga0081540_1014384 3300005983 Bacteria 5070
103 Ga0070717_10888716 3300006028 Bacteria 811
104 Ga0075363_100084385 3300006048 Bacteria 1741
105 Ga0075364_10001440 3300006051 Bacteria 12901
106 Ga0075367_10074765 3300006178 Bacteria 2043
107 Ga0075369_10007966 3300006186 Bacteria 4059
108 Ga0075369_10088847 3300006186 Bacteria 1377
109 Ga0075366_10010660 3300006195 Bacteria 5165
110 Ga0075366_10019261 3300006195 Bacteria 3946
111 Ga0075370_10048162 3300006353 Bacteria 2414
112 Ga0075370_10207398 3300006353 Bacteria 1157
113 Ga0075430_100029675 3300006846 Bacteria 4642
114 Ga0068865_100000993 3300006881 Bacteria 16269
115 Ga0097620_100000320 3300006931 Bacteria 48067
116 Ga0097620_100066595 3300006931 Bacteria 3637
117 Ga0097620_101523913 3300006931 Bacteria 738
118 Ga0105240_10000535 3300009093 Bacteria 70216
119 Ga0105240_10002167 3300009093 Bacteria 32035
120 Ga0105240_10050691 3300009093 Bacteria 5231
121 Ga0105247_10063666 3300009101 Bacteria 2290
122 Ga0105243_10773435 3300009148 Bacteria 944
123 Ga0105241_10205375 3300009174 Bacteria 1648
124 Ga0105248_10000963 3300009177 Bacteria 32061
125 Ga0105248_10021645 3300009177 Bacteria 7121
126 Ga0105248_10077474 3300009177 Bacteria 3737
127 Ga0105238_10022615 3300009551 Bacteria 6408
128 Ga0105238_10045390 3300009551 Bacteria 4439
129 Ga0105238_10172164 3300009551 Bacteria 2141
130 Ga0105249_10010885 3300009553 Bacteria 7994
131 Ga0105239_10050787 3300010375 Bacteria 4547
132 Ga0105239_10088694 3300010375 Bacteria 3410
133 Ga0105239_10426207 3300010375 Bacteria 1503
134 Ga0157373_10000266 3300013100 Bacteria 42156
135 Ga0157373_10012438 3300013100 Bacteria 6256
136 Ga0157373_10305715 3300013100 Bacteria 1129
137 Ga0157370_10017504 3300013104 Bacteria 7230
138 Ga0157370_10318028 3300013104 Bacteria 1436
139 Ga0157369_10132230 3300013105 Bacteria 2644
140 Ga0163162_10687387 3300013306 Bacteria 1145
141 Ga0163163_10021896 3300014325 Bacteria 6041
142 Ga0163163_10126113 3300014325 Bacteria 2598
143 Ga0163163_10212084 3300014325 Bacteria 1986
144 Ga0163163_10432077 3300014325 Bacteria 1376
145 Ga0182008_10110733 3300014497 Bacteria 1361
146 Ga0157379_10033986 3300014968 Bacteria 4545
147 Ga0157379_10063806 3300014968 Bacteria 3293
148 Ga0157379_10422682 3300014968 Bacteria 1227
149 Ga0157379_10620627 3300014968 Bacteria 1010
150 Ga0213874_10042953 3300021377 Bacteria 1360
151 Ga0213876_10000129 3300021384 Bacteria 82128
152 Ga0213876_10010289 3300021384 Bacteria 5025
153 Ga0213875_10066582 3300021388 Bacteria 1683
154 Ga0213875_10096715 3300021388 Bacteria 1377
155 Ga0209026_1001124 3300025250 Bacteria 12639
156 Ga0209026_1011705 3300025250 Bacteria 1562
157 Ga0209233_1029535 3300025261 Bacteria 1302
158 Ga0209565_1002061 3300025263 Bacteria 7698
159 Ga0209455_1036323 3300025272 Bacteria 784
160 Ga0209673_1000807 3300025273 Bacteria 41435
161 Ga0209675_1009368 3300025291 Bacteria 3468
162 Ga0209676_1000200 3300025292 Bacteria 133793
163 Ga0209676_1000477 3300025292 Bacteria 66211
164 Ga0209025_1120097 3300025294 Bacteria 786
165 Ga0209564_1001886 3300025295 Bacteria 18859
166 Ga0209564_1013771 3300025295 Bacteria 3408
167 Ga0209564_1034144 3300025295 Bacteria 1497
168 Ga0209564_1035626 3300025295 Bacteria 1437
169 Ga0209758_1001528 3300025297 Bacteria 26711
170 Ga0209758_1003270 3300025297 Bacteria 15024
171 Ga0209758_1009767 3300025297 Bacteria 5884
172 Ga0209050_1000057 3300025298 Bacteria 326289
173 Ga0209050_1000101 3300025298 Bacteria 230076
174 Ga0209050_1000696 3300025298 Bacteria 49982
175 Ga0209050_1026171 3300025298 Bacteria 1960
176 Ga0209256_1004238 3300025299 Bacteria 9190
177 Ga0209256_1005142 3300025299 Bacteria 7733
178 Ga0209256_1011164 3300025299 Bacteria 3632
179 Ga0209257_1000220 3300025304 Bacteria 135116
180 Ga0209257_1000223 3300025304 Bacteria 134337
181 Ga0209257_1000702 3300025304 Bacteria 51789
182 Ga0209257_1001456 3300025304 Bacteria 27971
183 Ga0209257_1027610 3300025304 Bacteria 1887
184 Ga0207710_10059959 3300025900 Bacteria 1723
185 Ga0207643_10383791 3300025908 Bacteria 886
186 Ga0207705_10154627 3300025909 Bacteria 1720
187 Ga0207705_10593200 3300025909 Bacteria 861
188 Ga0207684_10506669 3300025910 Bacteria 1034
189 Ga0207654_10200661 3300025911 Bacteria 1313
190 Ga0207707_10302312 3300025912 Bacteria 1383
191 Ga0207707_10323004 3300025912 Bacteria 1332
192 Ga0207707_10451428 3300025912 Bacteria 1100
193 Ga0207695_10002212 3300025913 Bacteria 29262
194 Ga0207695_10003013 3300025913 Bacteria 24211
195 Ga0207695_10010454 3300025913 Bacteria 11349
196 Ga0207695_10244486 3300025913 Bacteria 1695
197 Ga0207695_10514152 3300025913 Bacteria 1079
198 Ga0207671_10076810 3300025914 Bacteria 2499
199 Ga0207660_10020290 3300025917 Bacteria 4456
200 Ga0207660_10021174 3300025917 Bacteria 4371
201 Ga0207657_10000621 3300025919 Bacteria 37675
202 Ga0207657_10446961 3300025919 Bacteria 1014
203 Ga0207649_10250205 3300025920 Bacteria 1276
204 Ga0207652_10097512 3300025921 Bacteria 2591
205 Ga0207652_10221969 3300025921 Bacteria 1703
206 Ga0207681_10011486 3300025923 Bacteria 5442
207 Ga0207681_10141169 3300025923 Bacteria 1794
208 Ga0207694_10024478 3300025924 Bacteria 4585
209 Ga0207694_10110731 3300025924 Bacteria 2184
210 Ga0207650_10000084 3300025925 Bacteria 125773
211 Ga0207650_10043649 3300025925 Bacteria 3292
212 Ga0207650_10237696 3300025925 Bacteria 1471
213 Ga0207650_10318639 3300025925 Bacteria 1273
214 Ga0207664_10022011 3300025929 Bacteria 4752
215 Ga0207644_10000767 3300025931 Bacteria 20321
216 Ga0207644_10072980 3300025931 Bacteria 2515
217 Ga0207644_10290774 3300025931 Bacteria 1314
218 Ga0207690_10000760 3300025932 Bacteria 20828
219 Ga0207690_10036903 3300025932 Bacteria 3169
220 Ga0207690_10088127 3300025932 Bacteria 2185
221 Ga0207686_10343883 3300025934 Bacteria 1121
222 Ga0207704_10006609 3300025938 Bacteria 5425
223 Ga0207691_10039738 3300025940 Bacteria 4351
224 Ga0207711_10000903 3300025941 Bacteria 28567
225 Ga0207711_10004902 3300025941 Bacteria 11362
226 Ga0207711_10065255 3300025941 Bacteria 3147
227 Ga0207689_10018685 3300025942 Bacteria 5847
228 Ga0207667_10047475 3300025949 Bacteria 4545
229 Ga0207667_10048351 3300025949 Bacteria 4498
230 Ga0207667_10141969 3300025949 Bacteria 2473
231 Ga0207667_10194007 3300025949 Bacteria 2084
232 Ga0207667_10201573 3300025949 Bacteria 2041
233 Ga0207667_10447478 3300025949 Bacteria 1313
234 Ga0207712_10001180 3300025961 Bacteria 18078
235 Ga0207668_10000007 3300025972 Bacteria 190613
236 Ga0207668_10000036 3300025972 Bacteria 117190
237 Ga0207668_10002156 3300025972 Bacteria 11478
238 Ga0207668_10009936 3300025972 Bacteria 5723
239 Ga0207668_10067141 3300025972 Bacteria 2545
240 Ga0207668_10339547 3300025972 Bacteria 1252
241 Ga0207640_10154041 3300025981 Bacteria 1692
242 Ga0207658_10000427 3300025986 Bacteria 39977
243 Ga0207658_10018889 3300025986 Bacteria 4767
244 Ga0207658_10033269 3300025986 Bacteria 3676
245 Ga0207658_10036818 3300025986 Bacteria 3510
246 Ga0207677_10089437 3300026023 Bacteria 2235
247 Ga0207703_10000658 3300026035 Bacteria 34612
248 Ga0207703_10001840 3300026035 Bacteria 18897
249 Ga0207703_10002382 3300026035 Bacteria 16346
250 Ga0207703_10444047 3300026035 Bacteria 1211
251 Ga0207639_10016913 3300026041 Bacteria 5168
252 Ga0207639_10338312 3300026041 Bacteria 1341
253 Ga0207702_10260853 3300026078 Bacteria 1631
254 Ga0207702_10305214 3300026078 Bacteria 1512
255 Ga0207641_10000376 3300026088 Bacteria 53079
256 Ga0207641_10025693 3300026088 Bacteria 4855
257 Ga0207641_10029022 3300026088 Bacteria 4573
258 Ga0207641_10032627 3300026088 Bacteria 4324
259 Ga0207676_10000102 3300026095 Bacteria 77065
260 Ga0207676_10000332 3300026095 Bacteria 40676
261 Ga0207676_10053643 3300026095 Bacteria 3156
262 Ga0207676_10067837 3300026095 Bacteria 2850
263 Ga0207676_10315414 3300026095 Bacteria 1433
264 Ga0207674_10103734 3300026116 Bacteria 2822
265 Ga0207675_100074798 3300026118 Bacteria 3170
266 Ga0207698_10140852 3300026142 Bacteria 2078
267 Ga0210000_1007493 3300027462 Bacteria 1597
268 Ga0209983_1007314 3300027665 Bacteria 2264
269 Ga0268266_10000106 3300028379 Bacteria 175109
270 Ga0268266_10001586 3300028379 Bacteria 26564
271 Ga0268266_10008574 3300028379 Bacteria 9082
272 Ga0268266_10053286 3300028379 Bacteria 3475
273 Ga0268266_10633972 3300028379 Bacteria 1028
274 Ga0268266_10672195 3300028379 Bacteria 997
275 Ga0268265_10000635 3300028380 Bacteria 35008
276 Ga0268265_10000993 3300028380 Bacteria 25767
277 Ga0268265_10006750 3300028380 Bacteria 7766
278 Ga0268265_10016051 3300028380 Bacteria 5138
279 Ga0268265_10047063 3300028380 Bacteria 3229
280 Ga0268265_10114078 3300028380 Bacteria 2212
281 Ga0268265_10177033 3300028380 Bacteria 1829
282 Ga0268264_10000046 3300028381 Bacteria 364597
283 Ga0268264_10000284 3300028381 Bacteria 85451
284 Ga0268264_10014579 3300028381 Bacteria 6457
285 Ga0268264_10034278 3300028381 Bacteria 4174
286 Ga0268264_10368881 3300028381 Bacteria 1372
287 Ga0265337_1035268 3300028556 Bacteria 1466
288 Ga0265326_10022823 3300028558 Bacteria 1790
289 Ga0265319_1073375 3300028563 Bacteria 1094
290 Ga0265334_10023209 3300028573 Bacteria 2524
291 Ga0265323_10000888 3300028653 Bacteria 15825
292 Ga0265322_10019908 3300028654 Bacteria 1924
293 Ga0265336_10000188 3300028666 Bacteria 43129
294 Ga0307517_10002627 3300028786 Bacteria 28638
295 Ga0307517_10026693 3300028786 Bacteria 6979
296 Ga0307515_10016872 3300028794 Bacteria 13347
297 Ga0307515_10038196 3300028794 Bacteria 7690
298 Ga0265338_10000393 3300028800 Bacteria 78303
299 Ga0265338_10038308 3300028800 Bacteria 4545
300 Ga0265338_10076076 3300028800 Bacteria 2845
301 Ga0265338_10121948 3300028800 Bacteria 2076
302 Ga0265338_10159013 3300028800 Bacteria 1747
303 Ga0265324_10031494 3300029957 Bacteria 1857
304 Ga0307511_10019931 3300030521 Bacteria 6367
305 Ga0265340_10037300 3300031247 Bacteria 2408
306 Ga0265327_10000525 3300031251 Bacteria 66250
307 Ga0265327_10000998 3300031251 Bacteria 40192
308 Ga0265327_10002139 3300031251 Bacteria 21826
309 Ga0307513_10000856 3300031456 Bacteria 44279
310 Ga0307513_10006491 3300031456 Bacteria 15275
311 Ga0307513_10008912 3300031456 Bacteria 12755
312 Ga0307513_10009474 3300031456 Bacteria 12316
313 Ga0307513_10431032 3300031456 Bacteria 1047
314 Ga0307408_100012797 3300031548 Bacteria 5563
315 Ga0307408_100016161 3300031548 Bacteria 4976
316 Ga0307408_100030506 3300031548 Bacteria 3745
317 Ga0307408_100150163 3300031548 Bacteria 1838
318 Ga0307516_10000154 3300031730 Bacteria 85753
319 Ga0307405_10060255 3300031731 Bacteria 2394
320 Ga0307405_10061773 3300031731 Bacteria 2369
321 Ga0307405_10069541 3300031731 Bacteria 2257
322 Ga0307413_10029163 3300031824 Bacteria 3083
323 Ga0307413_10200539 3300031824 Bacteria 1441
324 Ga0307413_10233552 3300031824 Bacteria 1352
325 Ga0307410_10004398 3300031852 Bacteria 7280
326 Ga0307410_10362203 3300031852 Bacteria 1161
327 Ga0307410_10372764 3300031852 Unclassified 1146
328 Ga0307410_10595615 3300031852 Bacteria 921
329 Ga0307406_10090299 3300031901 Bacteria 2061
330 Ga0307406_10136120 3300031901 Bacteria 1731
331 Ga0307406_10340398 3300031901 Bacteria 1168
332 Ga0307407_10002410 3300031903 Bacteria 7310
333 Ga0307407_10044779 3300031903 Bacteria 2496
334 Ga0307412_10008188 3300031911 Bacteria 5959
335 Ga0307412_10028012 3300031911 Bacteria 3520
336 Ga0307409_100008921 3300031995 Bacteria 6124
337 Ga0307409_100315718 3300031995 Unclassified 1460
338 Ga0307409_100404387 3300031995 Bacteria 1305
339 Ga0307416_100011899 3300032002 Bacteria 5836
340 Ga0307416_100021809 3300032002 Bacteria 4607
341 Ga0307416_100153594 3300032002 Bacteria 2115
342 Ga0307414_10030100 3300032004 Bacteria 3542
343 Ga0307414_10030170 3300032004 Bacteria 3539
344 Ga0307414_10068341 3300032004 Bacteria 2549
345 Ga0307414_10084627 3300032004 Bacteria 2333
346 Ga0307414_10107210 3300032004 Bacteria 2116
347 Ga0307414_10131123 3300032004 Bacteria 1946
348 Ga0307414_10279377 3300032004 Bacteria 1402
349 Ga0307414_10292151 3300032004 Bacteria 1374
350 Ga0307414_10481680 3300032004 Bacteria 1094
351 Ga0307414_10504936 3300032004 Bacteria 1070
352 Ga0307414_10625208 3300032004 Bacteria 968
353 Ga0307411_10048064 3300032005 Bacteria 2763
354 Ga0307411_10127110 3300032005 Bacteria 1856
355 Ga0307411_10638003 3300032005 Bacteria 920
356 Ga0307415_100010695 3300032126 Bacteria 5210
357 Ga0307415_100134890 3300032126 Bacteria 1875
358 Ga0307510_10045878 3300033180 Bacteria 4708
359 Ga0307510_10085000 3300033180 Bacteria 3044
360 Ga0373944_0086867 3300035089 Bacteria 1040
361 Ga0373923_0048700 3300035111 Bacteria 1770
362 Ga0373936_0002829 3300035113 Bacteria 6472
363 Ga0373936_0036367 3300035113 Bacteria 1963
364 Ga0373953_0134639 3300035117 Bacteria 1055
365 Ga0373943_0247930 3300035170 Bacteria 999
366 Ga0373946_0028601 3300035171 Bacteria 2212
367 Ga0373946_0051928 3300035171 Bacteria 1717
368 Ga0373935_0001033 3300035692 Bacteria 15137
369 Ga0373935_0057146 3300035692 Bacteria 2489
370 Ga0373927_0002069 3300035695 Bacteria 14824
371 Ga0373927_0013172 3300035695 Bacteria 5500
372 Ga0373933_0039652 3300035724 Bacteria 2772
373 Ga0373933_0376234 3300035724 Bacteria 925
374 Ga0373947_0000940 3300035725 Bacteria 17726
375 Ga0373947_0247322 3300035725 Bacteria 1178
376 Ga0373937_0338970 3300036401 Bacteria 1424
377 Ga0373925_0000380 3300037068 Bacteria 46083
378 Ga0373925_0001317 3300037068 Bacteria 21738
379 Ga0395899_0000100 3300037312 Bacteria 151710
380 Ga0395899_0000251 3300037312 Bacteria 71228
381 Ga0395899_0427810 3300037312 Bacteria 871
382 Ga0395900_0000009 3300037418 Bacteria 476249
383 Ga0395900_0000084 3300037418 Bacteria 172593
384 Ga0395900_0053314 3300037418 Bacteria 4162
385 Ga0395900_0062202 3300037418 Bacteria 3837
386 Ga0395898_0000021 3300037466 Bacteria 393971
387 Ga0395898_0007526 3300037466 Bacteria 11574
388 Ga0395898_0114090 3300037466 Bacteria 2589
389 Ga0395898_0477877 3300037466 Bacteria 1186
390 Ga0395905_0000006 3300037471 Bacteria 549428
391 Ga0395905_0019183 3300037471 Bacteria 6485
392 Ga0395905_0200845 3300037471 Bacteria 1869
393 Ga0436364_0357555 3300037853 Bacteria 2930
394 Ga0436364_0537472 3300037853 Bacteria 1476
395 Ga0395901_0000014 3300038443 Bacteria 375100
396 Ga0395901_0009640 3300038443 Bacteria 9795
397 Ga0395901_0491127 3300038443 Bacteria 1251
398 Ga0436365_0042009 3300039437 Bacteria 49154
399 Ga0436365_0478530 3300039437 Bacteria 3253
400 Ga0436365_1871972 3300039437 Bacteria 3710
401 Ga0436360_0388057 3300039438 Bacteria 946
402 Ga0436360_1174836 3300039438 Bacteria 1278
403 Ga0436361_0139917 3300039447 Bacteria 13997
404 Ga0436363_1278549 3300039450 Bacteria 786
405 Ga0439461_0015626 3300041410 Bacteria 1456
406 Ga0439465_0028587 3300041413 Bacteria 1769
407 Ga0451793_0789003 3300041452 Bacteria 1275
408 Ga0451804_0466473 3300041463 Bacteria 831
409 Ga0439433_0013436 3300041999 Bacteria 1798
410 Ga0439441_004484 3300042001 Bacteria 2119
411 Ga0439443_009465 3300042003 Bacteria 1397
412 Ga0439456_021541 3300042013 Bacteria 1364
413 Ga0450912_010423 3300042116 Bacteria 796
414 Ga0450923_015668 3300042125 Bacteria 1420
415 Ga0450895_000202 3300042132 Bacteria 2943
416 Ga0450896_001567 3300042133 Bacteria 2844
417 Ga0450896_013424 3300042133 Bacteria 1165
418 Ga0450898_016893 3300042134 Bacteria 1250
419 Ga0450910_008678 3300042147 Bacteria 1431
420 Ga0439446_0001545 3300042156 Bacteria 5277
421 Ga0450908_003099 3300042184 Bacteria 3232
422 Ga0450908_003553 3300042184 Bacteria 3037
423 Ga0439434_0004123 3300042435 Bacteria 4246
424 Ga0439435_0001364 3300042436 Bacteria 4472
425 Ga0450918_004852 3300042531 Bacteria 2433
426 Ga0450918_009143 3300042531 Bacteria 1740
427 Ga0466965_0070402 3300044683 Bacteria 1758
428 Ga0466958_0466795 3300045836 Bacteria 818
429 Ga0466967_0027665 3300045976 Bacteria 4719
430 Ga0495617_146954 3300046452 Bacteria 751
431 Ga0495627_000679 3300046453 Bacteria 26196
432 Ga0495592_0017678 3300046454 Bacteria 5418
433 Ga0495603_0019746 3300046455 Bacteria 4079
434 Ga0495590_0001078 3300046457 Bacteria 12019
435 Ga0495638_0000410 3300046460 Bacteria 52445
436 Ga0495638_0000579 3300046460 Bacteria 41378
437 Ga0495638_0002568 3300046460 Bacteria 14695
438 Ga0495638_0006216 3300046460 Bacteria 8717
439 Ga0495638_0077710 3300046460 Bacteria 2020
440 Ga0495641_0003365 3300046461 Bacteria 12005
441 Ga0495650_0000269 3300046471 Bacteria 99675
442 Ga0495582_0000528 3300046473 Bacteria 21108
443 Ga0495639_0000044 3300046475 Bacteria 55019
444 Ga0495662_0049212 3300046476 Bacteria 2034
445 Ga0495664_0104697 3300046477 Bacteria 1705
446 Ga0495594_0000351 3300046499 Bacteria 23112
447 Ga0495583_0000029 3300046506 Bacteria 255536
448 Ga0495606_0048734 3300046507 Bacteria 2783
449 Ga0495606_0118206 3300046507 Bacteria 1590
450 Ga0495610_0000225 3300046512 Bacteria 60452
451 Ga0495610_0001127 3300046512 Bacteria 24387
452 Ga0495616_0000160 3300046513 Bacteria 58888
453 Ga0495618_0107808 3300046514 Bacteria 1784
454 Ga0495620_0041011 3300046515 Bacteria 2033
455 Ga0495628_0087630 3300046516 Bacteria 2413
456 Ga0495630_0002975 3300046517 Bacteria 11767
457 Ga0495631_0010545 3300046518 Bacteria 4569
458 Ga0495632_0001474 3300046519 Bacteria 19561
459 Ga0495637_0017261 3300046520 Bacteria 3368
460 Ga0495637_0039278 3300046520 Bacteria 2044
461 Ga0495637_0057569 3300046520 Bacteria 1605
462 Ga0495643_0117928 3300046522 Bacteria 1343
463 Ga0495648_0001017 3300046524 Bacteria 28697
464 Ga0495648_0009026 3300046524 Bacteria 7783
465 Ga0495648_0250447 3300046524 Bacteria 855
466 Ga0495663_0078905 3300046525 Bacteria 1058
467 Ga0495642_0006227 3300046528 Bacteria 4580
468 Ga0495642_0135809 3300046528 Bacteria 1060
469 Ga0495652_0102548 3300046529 Bacteria 2318
470 Ga0495654_0000123 3300046530 Bacteria 86159
471 Ga0495654_0070310 3300046530 Bacteria 1660
472 Ga0495665_0000397 3300046531 Bacteria 22124
473 Ga0495640_0010991 3300046533 Bacteria 6973
474 Ga0495609_0060471 3300046538 Bacteria 1675
475 Ga0495597_0023219 3300046542 Bacteria 2870
476 Ga0495622_0001316 3300046557 Bacteria 12733
477 Ga0495622_0004304 3300046557 Bacteria 6630
478 Ga0495633_0005300 3300046558 Bacteria 7929
479 Ga0495667_0062069 3300046559 Bacteria 2449
480 Ga0495668_0000014 3300046616 Bacteria 442055
481 Ga0495668_0008784 3300046616 Bacteria 6263
482 Ga0495668_0023540 3300046616 Bacteria 3510
483 Ga0495668_0119174 3300046616 Bacteria 1443
484 Ga0495668_0190222 3300046616 Bacteria 1124
485 Ga0495668_0308982 3300046616 Bacteria 867
486 Ga0495634_0000252 3300046642 Bacteria 50709
487 Ga0495611_0015649 3300046648 Bacteria 3242
488 Ga0495625_0000816 3300046660 Bacteria 42972
489 Ga0495625_0016984 3300046660 Bacteria 5707
490 Ga0495625_0039662 3300046660 Bacteria 3437
491 Ga0495625_0073606 3300046660 Bacteria 2394
492 Ga0495625_0076704 3300046660 Bacteria 2336
493 Ga0495625_0250084 3300046660 Bacteria 1151
494 Ga0495625_0328611 3300046660 Bacteria 972
495 Ga0495625_0388926 3300046660 Bacteria 873
496 Ga0495635_0001901 3300046663 Bacteria 14193
497 Ga0495588_0016278 3300046674 Bacteria 3593
498 Ga0495647_0004913 3300046681 Bacteria 4374
499 Ga0495669_0000003 3300046684 Bacteria 267741
500 Ga0495669_0000739 3300046684 Bacteria 14058
501 Ga0495669_0148706 3300046684 Bacteria 1108
502 Ga0495613_0000505 3300046689 Bacteria 32926
503 Ga0495613_0002632 3300046689 Bacteria 13497
504 Ga0495624_0002748 3300046690 Bacteria 13214
505 Ga0495670_0202800 3300046691 Bacteria 1051
506 Ga0495589_0165085 3300046794 Bacteria 1054
507 Ga0495660_0005019 3300046810 Bacteria 7962
508 Ga0495581_0001351 3300047315 Bacteria 13558
509 Ga0495674_0003317 3300047319 Bacteria 15641
510 Ga0495672_0001824 3300047320 Bacteria 20383
511 Ga0495672_0049555 3300047320 Bacteria 2485
512 Ga0495676_0034005 3300047321 Bacteria 4282
513 Ga0495687_032417 3300047443 Bacteria 2385
514 Ga0495677_0067308 3300047445 Bacteria 1333
515 Ga0495677_0072055 3300047445 Bacteria 1288
516 Ga0495673_0000094 3300047469 Bacteria 183868
517 Ga0495673_0000461 3300047469 Bacteria 44189
518 Ga0495673_0002213 3300047469 Bacteria 14001
519 Ga0495686_0000825 3300047472 Bacteria 39868
520 Ga0495686_0008370 3300047472 Bacteria 7593
521 Ga0495686_0014578 3300047472 Bacteria 5407
522 Ga0495686_0024859 3300047472 Bacteria 3930
523 Ga0495686_0055016 3300047472 Bacteria 2490
524 Ga0495686_0102508 3300047472 Bacteria 1724
525 Ga0495686_0204304 3300047472 Bacteria 1132
526 Ga0495593_0009579 3300047673 Bacteria 5623
527 Ga0495602_0549830 3300048088 Bacteria 800
528 Ga0495614_0032524 3300048089 Bacteria 2245
529 Ga0495615_0010390 3300048090 Bacteria 1859
530 Ga0496101_0114088 3300048904 Bacteria 2037
531 Ga0496102_0017868 3300048905 Bacteria 6220
532 Ga0496102_0166327 3300048905 Bacteria 2075
533 Ga0496102_0305549 3300048905 Bacteria 1499
534 Ga0496103_0429472 3300048906 Bacteria 848
535 Ga0496106_0042247 3300048909 Bacteria 3419
536 Ga0496106_0641039 3300048909 Bacteria 849
537 Ga0496107_0000349 3300048910 Bacteria 25181
538 Ga0496107_0073438 3300048910 Bacteria 2488
539 Ga0496108_0126721 3300048911 Bacteria 2192
540 Ga0496108_0629361 3300048911 Bacteria 934
541 Ga0496108_0815728 3300048911 Bacteria 804
542 Ga0496109_0015380 3300048912 Bacteria 6668
543 Ga0496110_0220212 3300048913 Bacteria 1726
544 Ga0496112_0267968 3300048915 Bacteria 1656
545 Ga0496112_0617383 3300048915 Bacteria 1015
546 Ga0496113_0305916 3300048916 Bacteria 1273
547 Ga0496115_0000450 3300048918 Bacteria 33063
548 Ga0496115_0003100 3300048918 Bacteria 11940
549 Ga0496116_0011917 3300048919 Bacteria 7147
550 Ga0496117_0013087 3300048920 Bacteria 7264
551 Ga0496119_0030141 3300048922 Bacteria 3664
552 Ga0496121_0000009 3300048924 Bacteria 836971
553 Ga0496121_0034294 3300048924 Bacteria 4570
554 Ga0496121_0053001 3300048924 Bacteria 3401
555 Ga0496122_0037841 3300048925 Bacteria 3876
556 Ga0496122_0215371 3300048925 Bacteria 1108
557 Ga0496123_0001110 3300048926 Bacteria 40337
558 Ga0496124_0014468 3300048927 Bacteria 7628
559 Ga0496125_0000598 3300048928 Bacteria 61438
560 Ga0496125_0023238 3300048928 Bacteria 5728
561 Ga0496125_0050843 3300048928 Bacteria 3426
562 Ga0496125_0183100 3300048928 Bacteria 1393
563 Ga0496126_0006062 3300048929 Bacteria 13569
564 Ga0496126_0494994 3300048929 Bacteria 978
565 Ga0495678_000723 3300049459 Bacteria 29969
566 Ga0501032_0051544 3300049569 Bacteria 2775
567 Ga0501033_0002932 3300049570 Bacteria 14266
568 Ga0501033_0058011 3300049570 Bacteria 2860
569 Ga0501034_0049189 3300049571 Bacteria 4254
570 Ga0501034_0198238 3300049571 Bacteria 1967
571 Ga0501036_0214694 3300049572 Bacteria 1616
572 Ga0501036_0353676 3300049572 Bacteria 1227
573 Ga0501037_0138129 3300049573 Bacteria 1745
574 Ga0501037_0161542 3300049573 Bacteria 1597
575 Ga0501039_0257411 3300049575 Bacteria 1372
576 Ga0501040_0330863 3300049576 Bacteria 1090
577 Ga0501042_0275588 3300049578 Bacteria 1215
578 Ga0501043_0510388 3300049579 Bacteria 897
579 Ga0501046_0227479 3300049580 Bacteria 1379
580 Ga0501047_0000790 3300049581 Bacteria 33132
581 Ga0501047_0122348 3300049581 Bacteria 2484
582 Ga0501047_0123297 3300049581 Bacteria 2472
583 Ga0501047_0311271 3300049581 Bacteria 1415
584 Ga0501047_0390664 3300049581 Bacteria 1225
585 Ga0501047_0474535 3300049581 Bacteria 1079
586 Ga0501067_0047740 3300049583 Bacteria 2375
587 Ga0501069_0040201 3300049585 Bacteria 2585
588 Ga0501072_0033810 3300049588 Bacteria 4006
589 Ga0501073_0093747 3300049589 Bacteria 2086
590 Ga0501074_0046448 3300049590 Bacteria 3140
591 Ga0501080_0008405 3300049742 Bacteria 9349
592 Ga0501083_0116867 3300049744 Bacteria 1751
593 Ga0501035_0156068 3300049822 Bacteria 1978
594 Ga0501044_0001087 3300049823 Bacteria 32422
595 Ga0501044_0019170 3300049823 Bacteria 7323
596 Ga0501044_0114986 3300049823 Bacteria 2696
597 nmdc:mga03683_16002_c1 3300050489 Bacteria 2117
598 nmdc:mga03n38_65448_c1 3300050490 Bacteria 1667
599 nmdc:mga00v17_2096_c1 3300050491 Bacteria 10260
600 nmdc:mga0k408_18392_c1 3300050493 Bacteria 3901
601 nmdc:mga04h51_30748_c1 3300050495 Bacteria 1692
602 nmdc:mga07m45_17228_c1 3300050496 Bacteria 3877
603 nmdc:mga07m45_212359_c1 3300050496 Bacteria 1126
604 nmdc:mga07m45_31708_c1 3300050496 Bacteria 2929
605 Ga0500635_0000288 3300053080 Bacteria 18543
606 Ga0500578_0001050 3300053086 Bacteria 30142
607 Ga0500578_0288190 3300053086 Bacteria 977
608 Ga0500643_001504 3300053087 Bacteria 13345
609 Ga0500643_001586 3300053087 Bacteria 12865
610 Ga0500643_001950 3300053087 Bacteria 11190
611 Ga0500643_008450 3300053087 Bacteria 4042
612 Ga0500643_010475 3300053087 Bacteria 3448
613 Ga0500644_0000261 3300053088 Bacteria 29859
614 Ga0500646_0115185 3300053090 Bacteria 859
615 Ga0500583_0043556 3300053092 Bacteria 2051
616 Ga0500583_0255370 3300053092 Bacteria 865
617 Ga0500566_0151246 3300053094 Bacteria 1220
618 Ga0500566_0197638 3300053094 Bacteria 1018
619 Ga0500641_0000646 3300053096 Bacteria 12569
620 Ga0500641_0006915 3300053096 Bacteria 4034
621 Ga0500554_002053 3300053102 Bacteria 3900
622 Ga0500555_000871 3300053103 Bacteria 10753
623 Ga0500556_0000583 3300053104 Bacteria 24043
624 Ga0500556_0002738 3300053104 Bacteria 5438
625 Ga0500556_0003686 3300053104 Bacteria 4456
626 Ga0500556_0027079 3300053104 Bacteria 1911
627 Ga0500556_0115541 3300053104 Bacteria 1044
628 Ga0500557_000001 3300053105 Bacteria 241298
629 Ga0500562_000833 3300053108 Bacteria 7485
630 Ga0500562_001521 3300053108 Bacteria 5735
631 Ga0500562_002292 3300053108 Bacteria 4795
632 Ga0500562_005155 3300053108 Bacteria 3283
633 Ga0500562_016591 3300053108 Bacteria 1894
634 Ga0500572_000035 3300053111 Bacteria 42615
635 Ga0500594_0000084 3300053118 Bacteria 28710
636 Ga0500595_003680 3300053119 Bacteria 7081
637 Ga0500595_008288 3300053119 Bacteria 4253
638 Ga0500595_022228 3300053119 Bacteria 2249
639 Ga0500597_056673 3300053120 Bacteria 1678
640 Ga0500597_203053 3300053120 Bacteria 831
641 Ga0500607_094802 3300053121 Bacteria 1494
642 Ga0500608_000101 3300053122 Bacteria 34992
643 Ga0500608_001518 3300053122 Bacteria 8300
644 Ga0500614_001563 3300053123 Bacteria 5417
645 Ga0500614_016705 3300053123 Bacteria 1650
646 Ga0500618_000255 3300053125 Bacteria 41984
647 Ga0500642_0000170 3300053130 Bacteria 26891
648 Ga0500652_111389 3300053131 Bacteria 1144
649 Ga0500655_023857 3300053133 Bacteria 1157
650 Ga0500658_0040526 3300053134 Bacteria 1865
651 Ga0500559_0000035 3300053136 Bacteria 110851
652 Ga0500559_0000243 3300053136 Bacteria 43046
653 Ga0500559_0003669 3300053136 Bacteria 7498
654 Ga0500559_0008182 3300053136 Bacteria 4598
655 Ga0500559_0026157 3300053136 Bacteria 2484
656 Ga0500559_0334722 3300053136 Bacteria 709
657 Ga0500564_000062 3300053138 Bacteria 29161
658 Ga0500577_0001545 3300053142 Bacteria 5872
659 Ga0500577_0125666 3300053142 Bacteria 1071
660 Ga0500590_019664 3300053148 Bacteria 3501
661 Ga0500604_0117237 3300053151 Bacteria 888
662 Ga0500616_0001309 3300053153 Bacteria 24602
663 Ga0500616_0022947 3300053153 Bacteria 3481
664 Ga0500622_0001061 3300053156 Bacteria 22910
665 Ga0500622_0002619 3300053156 Bacteria 12798
666 Ga0500622_0003125 3300053156 Bacteria 11383
667 Ga0500622_0006366 3300053156 Bacteria 6875
668 Ga0500622_0016359 3300053156 Bacteria 3964
669 Ga0500622_0042460 3300053156 Bacteria 2362
670 Ga0500622_0127640 3300053156 Bacteria 1226
671 Ga0500627_0217706 3300053158 Bacteria 853
672 Ga0500637_0137549 3300053178 Bacteria 1414
673 Ga0500637_0201334 3300053178 Bacteria 1133
674 Ga0500576_041884 3300053725 Bacteria 2058
675 Ga0500625_009359 3300053729 Bacteria 4369
676 Ga0500625_016435 3300053729 Bacteria 3446
677 Ga0500645_000433 3300053730 Bacteria 28666
678 Ga0500645_001713 3300053730 Bacteria 10672
679 Ga0500645_002033 3300053730 Bacteria 9436
680 Ga0500645_003312 3300053730 Bacteria 6620
681 Ga0500645_015734 3300053730 Bacteria 2392
682 Ga0500609_000644 3300053731 Bacteria 5311
683 Ga0501084_0137919 3300054114 Bacteria 2053
684 Ga0501082_0041303 3300060353 Bacteria 3976
685 Ga0501082_0087090 3300060353 Bacteria 2694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10372764 Ga0307410_103727642 189
2 3300031901 Ga0307406_10090299 Ga0307406_100902992 189
3 3300049575 Ga0501039_0257411 Ga0501039_0257411_354_926 189
4 3300049578 Ga0501042_0275588 Ga0501042_0275588_213_785 189
5 3300032005 Ga0307411_10127110 Ga0307411_101271103 202
6 3300049576 Ga0501040_0330863 Ga0501040_0330863_325_996 204
7 3300039438 Ga0436360_0388057 Ga0436360_0388057_195_824 209
8 3300005341 Ga0070691_10081842 Ga0070691_100818422 210
9 3300013306 Ga0163162_10687387 Ga0163162_106873872 210
10 3300025921 Ga0207652_10097512 Ga0207652_100975122 210
11 3300025924 Ga0207694_10110731 Ga0207694_101107312 210
12 3300027462 Ga0210000_1007493 Ga0210000_10074932 210
13 3300027665 Ga0209983_1007314 Ga0209983_10073143 210
14 3300048090 Ga0495615_0010390 Ga0495615_0010390_23_655 210
15 3300048911 Ga0496108_0815728 Ga0496108_0815728_71_730 210
16 3300048915 Ga0496112_0267968 Ga0496112_0267968_56_688 210
17 3300048928 Ga0496125_0050843 Ga0496125_0050843_1903_2562 210
18 3300049572 Ga0501036_0214694 Ga0501036_0214694_488_1120 210
19 3300049580 Ga0501046_0227479 Ga0501046_0227479_646_1278 210
20 3300049581 Ga0501047_0000790 Ga0501047_0000790_14041_14673 210
21 iso_pu_bacteria 2643221663 2644352107 210
22 iso_pu_bacteria 2941485952 2941487336 210
23 3300005334 Ga0068869_100521118 Ga0068869_1005211182 211
24 3300009093 Ga0105240_10002167 Ga0105240_100021676 211
25 3300013104 Ga0157370_10318028 Ga0157370_103180282 211
26 3300021384 Ga0213876_10000129 Ga0213876_1000012912 211
27 3300021388 Ga0213875_10066582 Ga0213875_100665823 211
28 3300025942 Ga0207689_10018685 Ga0207689_100186851 211
29 3300026078 Ga0207702_10305214 Ga0207702_103052142 211
30 3300037853 Ga0436364_0357555 Ga0436364_0357555_1305_1943 211
31 3300039437 Ga0436365_0042009 Ga0436365_0042009_23006_23644 211
32 3300046558 Ga0495633_0005300 Ga0495633_0005300_462_1097 211
33 3300049570 Ga0501033_0058011 Ga0501033_0058011_218_856 211
34 3300049573 Ga0501037_0161542 Ga0501037_0161542_369_1007 211
35 3300049579 Ga0501043_0510388 Ga0501043_0510388_155_793 211
36 3300049581 Ga0501047_0311271 Ga0501047_0311271_108_746 211
37 3300049581 Ga0501047_0474535 Ga0501047_0474535_428_1069 211
38 3300049822 Ga0501035_0156068 Ga0501035_0156068_536_1174 211
39 3300049823 Ga0501044_0001087 Ga0501044_0001087_23660_24298 211
40 iso_pu_bacteria 2643221598 2644000394 211
41 iso_pu_bacteria 2643221614 2644084843 211
42 iso_pu_bacteria 2643221661 2644342395 211
43 iso_pu_bacteria 2643221666 2644365695 211
44 3300006846 Ga0075430_100029675 Ga0075430_1000296755 212
45 3300013104 Ga0157370_10017504 Ga0157370_100175045 212
46 3300013105 Ga0157369_10132230 Ga0157369_101322303 212
47 3300028556 Ga0265337_1035268 Ga0265337_10352681 212
48 3300028800 Ga0265338_10038308 Ga0265338_100383086 212
49 3300028800 Ga0265338_10121948 Ga0265338_101219483 212
50 3300032004 Ga0307414_10504936 Ga0307414_105049362 212
51 3300035692 Ga0373935_0057146 Ga0373935_0057146_1743_2381 212
52 3300035725 Ga0373947_0247322 Ga0373947_0247322_74_712 212
53 3300048925 Ga0496122_0037841 Ga0496122_0037841_1932_2570 212
54 3300048926 Ga0496123_0001110 Ga0496123_0001110_32782_33420 212
55 3300005467 Ga0070706_100005625 Ga0070706_1000056252 213
56 3300005518 Ga0070699_100006239 Ga0070699_1000062392 213
57 3300005536 Ga0070697_100010902 Ga0070697_1000109027 213
58 3300005616 Ga0068852_100185943 Ga0068852_1001859432 213
59 3300026142 Ga0207698_10140852 Ga0207698_101408522 213
60 3300031548 Ga0307408_100150163 Ga0307408_1001501632 213
61 3300031731 Ga0307405_10061773 Ga0307405_100617733 213
62 3300031824 Ga0307413_10233552 Ga0307413_102335522 213
63 3300031852 Ga0307410_10595615 Ga0307410_105956152 213
64 3300031911 Ga0307412_10028012 Ga0307412_100280124 213
65 3300031995 Ga0307409_100315718 Ga0307409_1003157182 213
66 3300032002 Ga0307416_100021809 Ga0307416_1000218094 213
67 3300032004 Ga0307414_10030100 Ga0307414_100301006 213
68 3300032004 Ga0307414_10030170 Ga0307414_100301702 213
69 3300032004 Ga0307414_10084627 Ga0307414_100846272 213
70 3300032004 Ga0307414_10279377 Ga0307414_102793771 213
71 3300032004 Ga0307414_10481680 Ga0307414_104816802 213
72 3300032004 Ga0307414_10625208 Ga0307414_106252081 213
73 3300032005 Ga0307411_10638003 Ga0307411_106380031 213
74 3300032126 Ga0307415_100010695 Ga0307415_1000106952 213
75 3300037466 Ga0395898_0477877 Ga0395898_0477877_322_972 213
76 3300039438 Ga0436360_1174836 Ga0436360_1174836_184_825 213
77 3300039447 Ga0436361_0139917 Ga0436361_0139917_2981_3625 213
78 3300039450 Ga0436363_1278549 Ga0436363_1278549_22_663 213
79 3300041410 Ga0439461_0015626 Ga0439461_0015626_36_689 213
80 3300041999 Ga0439433_0013436 Ga0439433_0013436_963_1616 213
81 3300042001 Ga0439441_004484 Ga0439441_004484_1183_1836 213
82 3300042003 Ga0439443_009465 Ga0439443_009465_523_1176 213
83 3300042013 Ga0439456_021541 Ga0439456_021541_618_1271 213
84 3300042116 Ga0450912_010423 Ga0450912_010423_21_674 213
85 3300042125 Ga0450923_015668 Ga0450923_015668_126_779 213
86 3300042133 Ga0450896_013424 Ga0450896_013424_492_1145 213
87 3300042134 Ga0450898_016893 Ga0450898_016893_420_1073 213
88 3300042156 Ga0439446_0001545 Ga0439446_0001545_3121_3774 213
89 3300042184 Ga0450908_003099 Ga0450908_003099_2302_2955 213
90 3300042435 Ga0439434_0004123 Ga0439434_0004123_1046_1699 213
91 3300042436 Ga0439435_0001364 Ga0439435_0001364_328_981 213
92 3300045836 Ga0466958_0466795 Ga0466958_0466795_159_806 213
93 3300046684 Ga0495669_0000739 Ga0495669_0000739_11096_11737 213
94 3300049581 Ga0501047_0122348 Ga0501047_0122348_215_865 213
95 3300049589 Ga0501073_0093747 Ga0501073_0093747_232_879 213
96 3300053104 Ga0500556_0115541 Ga0500556_0115541_20_679 213
97 3300053108 Ga0500562_016591 Ga0500562_016591_1222_1863 213
98 3300053136 Ga0500559_0334722 Ga0500559_0334722_37_690 213
99 3300053153 Ga0500616_0001309 Ga0500616_0001309_15491_16150 213
100 3300053156 Ga0500622_0127640 Ga0500622_0127640_403_1062 213
101 3300005262 Ga0065165_1000210 Ga0065165_1000210101 214
102 3300005262 Ga0065165_1024553 Ga0065165_10245532 214
103 3300005366 Ga0070659_100000250 Ga0070659_10000025037 214
104 3300005548 Ga0070665_100066641 Ga0070665_1000666413 214
105 3300005983 Ga0081540_1007651 Ga0081540_10076517 214
106 3300005983 Ga0081540_1010892 Ga0081540_10108926 214
107 3300005983 Ga0081540_1014384 Ga0081540_10143843 214
108 3300014325 Ga0163163_10126113 Ga0163163_101261132 214
109 3300025931 Ga0207644_10072980 Ga0207644_100729802 214
110 3300025932 Ga0207690_10000760 Ga0207690_1000076013 214
111 3300028379 Ga0268266_10053286 Ga0268266_100532864 214
112 3300028786 Ga0307517_10026693 Ga0307517_100266937 214
113 3300031456 Ga0307513_10000856 Ga0307513_1000085633 214
114 3300031456 Ga0307513_10006491 Ga0307513_100064915 214
115 3300031901 Ga0307406_10340398 Ga0307406_103403981 214
116 3300032004 Ga0307414_10068341 Ga0307414_100683414 214
117 3300032004 Ga0307414_10131123 Ga0307414_101311233 214
118 3300033180 Ga0307510_10085000 Ga0307510_100850002 214
119 3300037418 Ga0395900_0062202 Ga0395900_0062202_2140_2793 214
120 3300046616 Ga0495668_0308982 Ga0495668_0308982_112_762 214
121 3300046648 Ga0495611_0015649 Ga0495611_0015649_2278_2928 214
122 3300046660 Ga0495625_0076704 Ga0495625_0076704_1285_1935 214
123 3300046689 Ga0495613_0000505 Ga0495613_0000505_15481_16134 214
124 3300047320 Ga0495672_0049555 Ga0495672_0049555_669_1313 214
125 3300047472 Ga0495686_0204304 Ga0495686_0204304_350_1000 214
126 3300048911 Ga0496108_0629361 Ga0496108_0629361_234_884 214
127 3300048919 Ga0496116_0011917 Ga0496116_0011917_2258_2902 214
128 3300048928 Ga0496125_0000598 Ga0496125_0000598_21177_21821 214
129 3300049572 Ga0501036_0353676 Ga0501036_0353676_188_856 214
130 3300053087 Ga0500643_001586 Ga0500643_001586_2443_3093 214
131 3300053096 Ga0500641_0006915 Ga0500641_0006915_535_1185 214
132 3300053104 Ga0500556_0002738 Ga0500556_0002738_605_1255 214
133 3300053108 Ga0500562_001521 Ga0500562_001521_4976_5626 214
134 3300053108 Ga0500562_002292 Ga0500562_002292_4076_4726 214
135 3300053133 Ga0500655_023857 Ga0500655_023857_260_910 214
136 3300053151 Ga0500604_0117237 Ga0500604_0117237_35_685 214
137 3300053153 Ga0500616_0022947 Ga0500616_0022947_61_711 214
138 3300053156 Ga0500622_0003125 Ga0500622_0003125_1195_1845 214
139 3300053158 Ga0500627_0217706 Ga0500627_0217706_159_809 214
140 3300053730 Ga0500645_000433 Ga0500645_000433_506_1156 214
141 3300053730 Ga0500645_002033 Ga0500645_002033_3429_4079 214
142 3300003794 Ga0055531_10033561 Ga0055531_100335612 215
143 3300005331 Ga0070670_100057708 Ga0070670_1000577082 215
144 3300005339 Ga0070660_100530192 Ga0070660_1005301922 215
145 3300005347 Ga0070668_100002210 Ga0070668_10000221013 215
146 3300005347 Ga0070668_100016286 Ga0070668_1000162866 215
147 3300005366 Ga0070659_100032958 Ga0070659_1000329585 215
148 3300005367 Ga0070667_100020319 Ga0070667_1000203195 215
149 3300005539 Ga0068853_100126552 Ga0068853_1001265522 215
150 3300005539 Ga0068853_100144638 Ga0068853_1001446382 215
151 3300005618 Ga0068864_100033979 Ga0068864_1000339793 215
152 3300005841 Ga0068863_100013356 Ga0068863_1000133565 215
153 3300005843 Ga0068860_100000145 Ga0068860_10000014514 215
154 3300005843 Ga0068860_100096149 Ga0068860_1000961495 215
155 3300005844 Ga0068862_100007746 Ga0068862_1000077468 215
156 3300005844 Ga0068862_100030692 Ga0068862_1000306924 215
157 3300005844 Ga0068862_100098213 Ga0068862_1000982133 215
158 3300014497 Ga0182008_10110733 Ga0182008_101107332 215
159 3300021384 Ga0213876_10010289 Ga0213876_100102895 215
160 3300025250 Ga0209026_1001124 Ga0209026_10011246 215
161 3300025304 Ga0209257_1001456 Ga0209257_10014566 215
162 3300025919 Ga0207657_10446961 Ga0207657_104469611 215
163 3300025923 Ga0207681_10011486 Ga0207681_100114864 215
164 3300025925 Ga0207650_10043649 Ga0207650_100436492 215
165 3300025932 Ga0207690_10036903 Ga0207690_100369034 215
166 3300025972 Ga0207668_10009936 Ga0207668_100099366 215
167 3300025972 Ga0207668_10067141 Ga0207668_100671414 215
168 3300025986 Ga0207658_10036818 Ga0207658_100368183 215
169 3300026041 Ga0207639_10016913 Ga0207639_100169133 215
170 3300026088 Ga0207641_10032627 Ga0207641_100326275 215
171 3300026095 Ga0207676_10053643 Ga0207676_100536434 215
172 3300028380 Ga0268265_10000993 Ga0268265_1000099325 215
173 3300028380 Ga0268265_10006750 Ga0268265_100067505 215
174 3300028380 Ga0268265_10114078 Ga0268265_101140784 215
175 3300028381 Ga0268264_10000046 Ga0268264_1000004662 215
176 3300028381 Ga0268264_10034278 Ga0268264_100342785 215
177 3300028563 Ga0265319_1073375 Ga0265319_10733752 215
178 3300028786 Ga0307517_10002627 Ga0307517_1000262720 215
179 3300028800 Ga0265338_10159013 Ga0265338_101590132 215
180 3300031247 Ga0265340_10037300 Ga0265340_100373002 215
181 3300031251 Ga0265327_10002139 Ga0265327_1000213921 215
182 3300031456 Ga0307513_10009474 Ga0307513_100094748 215
183 3300031995 Ga0307409_100404387 Ga0307409_1004043872 215
184 3300032004 Ga0307414_10292151 Ga0307414_102921512 215
185 3300033180 Ga0307510_10045878 Ga0307510_100458782 215
186 3300037312 Ga0395899_0427810 Ga0395899_0427810_202_849 215
187 3300039437 Ga0436365_0478530 Ga0436365_0478530_1685_2332 215
188 3300046452 Ga0495617_146954 Ga0495617_146954_23_670 215
189 3300047472 Ga0495686_0024859 Ga0495686_0024859_2741_3388 215
190 3300048918 Ga0496115_0000450 Ga0496115_0000450_16840_17487 215
191 3300049585 Ga0501069_0040201 Ga0501069_0040201_1910_2569 215
192 3300053730 Ga0500645_001713 Ga0500645_001713_5666_6313 215
193 3300060353 Ga0501082_0041303 Ga0501082_0041303_216_875 215
194 iso_pu_bacteria 2507262055 2507509487 215
195 iso_pu_bacteria 2935769743 2935775863 215
196 iso_pu_bacteria 2935777560 2935780711 215
197 iso_pu_bacteria 2935785616 2935791400 215
198 iso_pu_bacteria 2935793552 2935799724 215
199 iso_pu_bacteria 2935908558 2935915492 215
200 iso_pu_bacteria 2935916978 2935921406 215
201 iso_pu_bacteria 2935926038 2935932909 215
202 iso_pu_bacteria 2935934488 2935941480 215
203 iso_pu_bacteria 2935942939 2935949683 215
204 iso_pu_bacteria 2935951376 2935958378 215
205 iso_pu_bacteria 2935967501 2935974452 215
206 iso_pu_bacteria 8016522445 8016530529 215
207 iso_pu_bacteria 8016530956 8016535806 215
208 iso_pu_bacteria 8016539877 8016540088 215
209 iso_pu_bacteria 8016548790 8016553143 215
210 iso_pu_bacteria 8016557553 8016561525 215
211 iso_pu_bacteria 8016566248 8016574146 215
212 iso_pu_bacteria 8016595262 8016599369 215
213 iso_pu_bacteria 8016603502 8016611668 215
214 iso_pu_bacteria 8016613128 8016622131 215
215 iso_pu_bacteria 8016622563 8016627717 215
216 iso_pu_bacteria 8019530166 8019535535 215
217 iso_pu_bacteria 8019538911 8019543946 215
218 iso_pu_bacteria 8019547302 8019554823 215
219 iso_pu_bacteria 8019687851 8019689037 215
220 3300003791 Ga0055530_10003799 Ga0055530_100037992 216
221 3300003794 Ga0055531_10001352 Ga0055531_100013526 216
222 3300005290 Ga0065712_10020657 Ga0065712_100206571 216
223 3300005331 Ga0070670_100000062 Ga0070670_10000006224 216
224 3300005347 Ga0070668_100002583 Ga0070668_1000025834 216
225 3300005353 Ga0070669_100164119 Ga0070669_1001641192 216
226 3300005367 Ga0070667_100000178 Ga0070667_10000017848 216
227 3300005548 Ga0070665_100002121 Ga0070665_10000212120 216
228 3300005614 Ga0068856_100620614 Ga0068856_1006206142 216
229 3300005617 Ga0068859_100066598 Ga0068859_1000665984 216
230 3300005618 Ga0068864_100000126 Ga0068864_10000012671 216
231 3300005841 Ga0068863_100001240 Ga0068863_10000124010 216
232 3300005841 Ga0068863_100278321 Ga0068863_1002783212 216
233 3300005842 Ga0068858_100027605 Ga0068858_1000276053 216
234 3300005843 Ga0068860_100002315 Ga0068860_10000231510 216
235 3300005844 Ga0068862_100001903 Ga0068862_10000190310 216
236 3300006931 Ga0097620_100066595 Ga0097620_1000665954 216
237 3300009101 Ga0105247_10063666 Ga0105247_100636663 216
238 3300009174 Ga0105241_10205375 Ga0105241_102053752 216
239 3300009177 Ga0105248_10077474 Ga0105248_100774744 216
240 3300009551 Ga0105238_10045390 Ga0105238_100453903 216
241 3300009553 Ga0105249_10010885 Ga0105249_100108853 216
242 3300014325 Ga0163163_10432077 Ga0163163_104320772 216
243 3300014968 Ga0157379_10063806 Ga0157379_100638062 216
244 3300014968 Ga0157379_10620627 Ga0157379_106206272 216
245 3300025297 Ga0209758_1009767 Ga0209758_10097676 216
246 3300025298 Ga0209050_1000101 Ga0209050_100010198 216
247 3300025304 Ga0209257_1000220 Ga0209257_100022098 216
248 3300025911 Ga0207654_10200661 Ga0207654_102006612 216
249 3300025923 Ga0207681_10141169 Ga0207681_101411693 216
250 3300025925 Ga0207650_10000084 Ga0207650_1000008424 216
251 3300025961 Ga0207712_10001180 Ga0207712_1000118014 216
252 3300025972 Ga0207668_10000036 Ga0207668_1000003666 216
253 3300025986 Ga0207658_10000427 Ga0207658_1000042717 216
254 3300026035 Ga0207703_10001840 Ga0207703_1000184016 216
255 3300026078 Ga0207702_10260853 Ga0207702_102608532 216
256 3300026088 Ga0207641_10029022 Ga0207641_100290224 216
257 3300026095 Ga0207676_10000102 Ga0207676_1000010252 216
258 3300026095 Ga0207676_10315414 Ga0207676_103154142 216
259 3300028379 Ga0268266_10008574 Ga0268266_100085745 216
260 3300028380 Ga0268265_10000635 Ga0268265_100006359 216
261 3300028381 Ga0268264_10000284 Ga0268264_1000028456 216
262 3300028800 Ga0265338_10076076 Ga0265338_100760763 216
263 3300031456 Ga0307513_10431032 Ga0307513_104310322 216
264 3300031548 Ga0307408_100030506 Ga0307408_1000305061 216
265 3300031730 Ga0307516_10000154 Ga0307516_1000015478 216
266 3300035089 Ga0373944_0086867 Ga0373944_0086867_49_708 216
267 3300035171 Ga0373946_0028601 Ga0373946_0028601_1076_1735 216
268 3300035695 Ga0373927_0013172 Ga0373927_0013172_1664_2323 216
269 3300035724 Ga0373933_0376234 Ga0373933_0376234_150_803 216
270 3300037068 Ga0373925_0000380 Ga0373925_0000380_23179_23838 216
271 3300042132 Ga0450895_000202 Ga0450895_000202_1391_2056 216
272 3300042133 Ga0450896_001567 Ga0450896_001567_1977_2642 216
273 3300042147 Ga0450910_008678 Ga0450910_008678_520_1203 216
274 3300042184 Ga0450908_003553 Ga0450908_003553_732_1397 216
275 3300042531 Ga0450918_004852 Ga0450918_004852_1738_2421 216
276 3300042531 Ga0450918_009143 Ga0450918_009143_130_795 216
277 3300046522 Ga0495643_0117928 Ga0495643_0117928_516_1190 216
278 3300046530 Ga0495654_0070310 Ga0495654_0070310_66_740 216
279 3300046538 Ga0495609_0060471 Ga0495609_0060471_515_1189 216
280 3300046542 Ga0495597_0023219 Ga0495597_0023219_1600_2274 216
281 3300046557 Ga0495622_0004304 Ga0495622_0004304_4998_5672 216
282 3300046616 Ga0495668_0190222 Ga0495668_0190222_199_873 216
283 3300047443 Ga0495687_032417 Ga0495687_032417_545_1219 216
284 3300048088 Ga0495602_0549830 Ga0495602_0549830_44_718 216
285 3300048905 Ga0496102_0166327 Ga0496102_0166327_642_1352 216
286 3300048905 Ga0496102_0305549 Ga0496102_0305549_697_1371 216
287 3300048920 Ga0496117_0013087 Ga0496117_0013087_3008_3682 216
288 3300048922 Ga0496119_0030141 Ga0496119_0030141_708_1382 216
289 3300048924 Ga0496121_0000009 Ga0496121_0000009_633709_634383 216
290 3300049581 Ga0501047_0123297 Ga0501047_0123297_406_1056 216
291 3300049583 Ga0501067_0047740 Ga0501067_0047740_1586_2296 216
292 3300049588 Ga0501072_0033810 Ga0501072_0033810_2164_2841 216
293 3300049590 Ga0501074_0046448 Ga0501074_0046448_1636_2313 216
294 3300049742 Ga0501080_0008405 Ga0501080_0008405_807_1484 216
295 3300049823 Ga0501044_0114986 Ga0501044_0114986_1731_2381 216
296 3300050489 nmdc:mga03683_16002_c1 nmdc:mga03683_16002_c1_1402_2055 216
297 3300053080 Ga0500635_0000288 Ga0500635_0000288_9338_10012 216
298 3300053086 Ga0500578_0288190 Ga0500578_0288190_111_785 216
299 3300053092 Ga0500583_0043556 Ga0500583_0043556_1212_1886 216
300 3300053094 Ga0500566_0151246 Ga0500566_0151246_126_800 216
301 3300053119 Ga0500595_003680 Ga0500595_003680_2790_3464 216
302 3300053121 Ga0500607_094802 Ga0500607_094802_693_1367 216
303 3300053122 Ga0500608_001518 Ga0500608_001518_5023_5697 216
304 3300053123 Ga0500614_001563 Ga0500614_001563_1236_1910 216
305 3300053134 Ga0500658_0040526 Ga0500658_0040526_155_829 216
306 3300053136 Ga0500559_0003669 Ga0500559_0003669_1122_1796 216
307 3300053148 Ga0500590_019664 Ga0500590_019664_1113_1787 216
308 3300053178 Ga0500637_0137549 Ga0500637_0137549_556_1230 216
309 3300053178 Ga0500637_0201334 Ga0500637_0201334_163_837 216
310 3300053725 Ga0500576_041884 Ga0500576_041884_277_951 216
311 3300053729 Ga0500625_016435 Ga0500625_016435_21_695 216
312 3300054114 Ga0501084_0137919 Ga0501084_0137919_232_909 216
313 3300005327 Ga0070658_10562888 Ga0070658_105628881 217
314 3300005364 Ga0070673_100808575 Ga0070673_1008085751 217
315 3300005435 Ga0070714_100004266 Ga0070714_1000042666 217
316 3300005458 Ga0070681_10038255 Ga0070681_100382552 217
317 3300005530 Ga0070679_100030766 Ga0070679_1000307661 217
318 3300005548 Ga0070665_100000121 Ga0070665_10000012111 217
319 3300005563 Ga0068855_100020193 Ga0068855_1000201933 217
320 3300005614 Ga0068856_100377011 Ga0068856_1003770112 217
321 3300005617 Ga0068859_101524412 Ga0068859_1015244121 217
322 3300006048 Ga0075363_100084385 Ga0075363_1000843852 217
323 3300006051 Ga0075364_10001440 Ga0075364_100014407 217
324 3300006178 Ga0075367_10074765 Ga0075367_100747653 217
325 3300006186 Ga0075369_10088847 Ga0075369_100888473 217
326 3300006195 Ga0075366_10019261 Ga0075366_100192613 217
327 3300006353 Ga0075370_10048162 Ga0075370_100481624 217
328 3300006931 Ga0097620_101523913 Ga0097620_1015239131 217
329 3300009148 Ga0105243_10773435 Ga0105243_107734352 217
330 3300010375 Ga0105239_10050787 Ga0105239_100507874 217
331 3300010375 Ga0105239_10426207 Ga0105239_104262072 217
332 3300014325 Ga0163163_10021896 Ga0163163_100218965 217
333 3300025250 Ga0209026_1011705 Ga0209026_10117052 217
334 3300025272 Ga0209455_1036323 Ga0209455_10363231 217
335 3300025294 Ga0209025_1120097 Ga0209025_11200971 217
336 3300025912 Ga0207707_10451428 Ga0207707_104514282 217
337 3300025913 Ga0207695_10002212 Ga0207695_1000221227 217
338 3300025913 Ga0207695_10244486 Ga0207695_102444862 217
339 3300025913 Ga0207695_10514152 Ga0207695_105141522 217
340 3300025924 Ga0207694_10024478 Ga0207694_100244785 217
341 3300025925 Ga0207650_10318639 Ga0207650_103186392 217
342 3300025929 Ga0207664_10022011 Ga0207664_100220114 217
343 3300025934 Ga0207686_10343883 Ga0207686_103438832 217
344 3300025949 Ga0207667_10048351 Ga0207667_100483513 217
345 3300028379 Ga0268266_10000106 Ga0268266_10000106153 217
346 3300030521 Ga0307511_10019931 Ga0307511_100199314 217
347 3300031251 Ga0265327_10000998 Ga0265327_1000099839 217
348 3300031456 Ga0307513_10008912 Ga0307513_1000891214 217
349 3300031824 Ga0307413_10200539 Ga0307413_102005391 217
350 3300032005 Ga0307411_10048064 Ga0307411_100480642 217
351 3300036401 Ga0373937_0338970 Ga0373937_0338970_224_886 217
352 3300046528 Ga0495642_0135809 Ga0495642_0135809_274_927 217
353 3300046660 Ga0495625_0328611 Ga0495625_0328611_93_746 217
354 3300046684 Ga0495669_0000003 Ga0495669_0000003_60068_60721 217
355 3300046684 Ga0495669_0148706 Ga0495669_0148706_248_916 217
356 3300046691 Ga0495670_0202800 Ga0495670_0202800_302_979 217
357 3300047445 Ga0495677_0067308 Ga0495677_0067308_193_846 217
358 3300048928 Ga0496125_0183100 Ga0496125_0183100_470_1138 217
359 3300049570 Ga0501033_0002932 Ga0501033_0002932_5364_6017 217
360 3300049571 Ga0501034_0049189 Ga0501034_0049189_352_1005 217
361 3300049571 Ga0501034_0198238 Ga0501034_0198238_519_1175 217
362 3300049573 Ga0501037_0138129 Ga0501037_0138129_827_1480 217
363 3300049581 Ga0501047_0390664 Ga0501047_0390664_37_714 217
364 3300049823 Ga0501044_0019170 Ga0501044_0019170_1374_2027 217
365 3300050490 nmdc:mga03n38_65448_c1 nmdc:mga03n38_65448_c1_643_1308 217
366 3300050491 nmdc:mga00v17_2096_c1 nmdc:mga00v17_2096_c1_7393_8058 217
367 3300050493 nmdc:mga0k408_18392_c1 nmdc:mga0k408_18392_c1_572_1237 217
368 3300050495 nmdc:mga04h51_30748_c1 nmdc:mga04h51_30748_c1_337_1002 217
369 3300050496 nmdc:mga07m45_17228_c1 nmdc:mga07m45_17228_c1_1716_2381 217
370 3300050496 nmdc:mga07m45_212359_c1 nmdc:mga07m45_212359_c1_45_710 217
371 3300053087 Ga0500643_001504 Ga0500643_001504_4438_5106 217
372 3300053087 Ga0500643_001950 Ga0500643_001950_1857_2513 217
373 3300053087 Ga0500643_008450 Ga0500643_008450_989_1654 217
374 3300053092 Ga0500583_0255370 Ga0500583_0255370_107_769 217
375 3300053103 Ga0500555_000871 Ga0500555_000871_9764_10441 217
376 3300053104 Ga0500556_0003686 Ga0500556_0003686_1565_2242 217
377 3300053111 Ga0500572_000035 Ga0500572_000035_26100_26762 217
378 3300053119 Ga0500595_022228 Ga0500595_022228_1002_1655 217
379 3300053120 Ga0500597_056673 Ga0500597_056673_379_1041 217
380 3300053131 Ga0500652_111389 Ga0500652_111389_189_851 217
381 3300053136 Ga0500559_0000035 Ga0500559_0000035_79403_80065 217
382 3300005336 Ga0070680_100715920 Ga0070680_1007159201 218
383 3300005347 Ga0070668_100009206 Ga0070668_1000092067 218
384 3300005367 Ga0070667_100004563 Ga0070667_1000045634 218
385 3300005458 Ga0070681_10177574 Ga0070681_101775741 218
386 3300005548 Ga0070665_100002649 Ga0070665_10000264918 218
387 3300005563 Ga0068855_100117313 Ga0068855_1001173133 218
388 3300005563 Ga0068855_100298262 Ga0068855_1002982621 218
389 3300005618 Ga0068864_100002265 Ga0068864_10000226512 218
390 3300005841 Ga0068863_100000282 Ga0068863_1000002825 218
391 3300005842 Ga0068858_100000493 Ga0068858_10000049333 218
392 3300005844 Ga0068862_100017518 Ga0068862_1000175185 218
393 3300005844 Ga0068862_100033184 Ga0068862_1000331844 218
394 3300009093 Ga0105240_10000535 Ga0105240_1000053526 218
395 3300009093 Ga0105240_10050691 Ga0105240_100506916 218
396 3300009177 Ga0105248_10021645 Ga0105248_100216458 218
397 3300014325 Ga0163163_10212084 Ga0163163_102120842 218
398 3300014968 Ga0157379_10033986 Ga0157379_100339862 218
399 3300021388 Ga0213875_10096715 Ga0213875_100967152 218
400 3300025909 Ga0207705_10593200 Ga0207705_105932002 218
401 3300025912 Ga0207707_10323004 Ga0207707_103230042 218
402 3300025913 Ga0207695_10003013 Ga0207695_1000301322 218
403 3300025913 Ga0207695_10010454 Ga0207695_1001045411 218
404 3300025917 Ga0207660_10020290 Ga0207660_100202904 218
405 3300025925 Ga0207650_10237696 Ga0207650_102376962 218
406 3300025941 Ga0207711_10065255 Ga0207711_100652554 218
407 3300025949 Ga0207667_10047475 Ga0207667_100474752 218
408 3300025972 Ga0207668_10000007 Ga0207668_10000007127 218
409 3300025972 Ga0207668_10339547 Ga0207668_103395473 218
410 3300025986 Ga0207658_10018889 Ga0207658_100188894 218
411 3300026035 Ga0207703_10000658 Ga0207703_1000065828 218
412 3300026088 Ga0207641_10000376 Ga0207641_1000037643 218
413 3300026095 Ga0207676_10000332 Ga0207676_1000033223 218
414 3300028379 Ga0268266_10001586 Ga0268266_100015863 218
415 3300028379 Ga0268266_10633972 Ga0268266_106339722 218
416 3300028380 Ga0268265_10016051 Ga0268265_100160514 218
417 3300028380 Ga0268265_10047063 Ga0268265_100470634 218
418 3300037312 Ga0395899_0000251 Ga0395899_0000251_61759_62430 218
419 3300037418 Ga0395900_0000084 Ga0395900_0000084_144842_145513 218
420 3300037418 Ga0395900_0053314 Ga0395900_0053314_1799_2461 218
421 3300037466 Ga0395898_0000021 Ga0395898_0000021_187792_188463 218
422 3300037466 Ga0395898_0114090 Ga0395898_0114090_1114_1776 218
423 3300037471 Ga0395905_0000006 Ga0395905_0000006_404044_404715 218
424 3300037471 Ga0395905_0200845 Ga0395905_0200845_987_1649 218
425 3300037853 Ga0436364_0537472 Ga0436364_0537472_425_1090 218
426 3300038443 Ga0395901_0009640 Ga0395901_0009640_7469_8140 218
427 3300048909 Ga0496106_0641039 Ga0496106_0641039_56_736 218
428 3300053090 Ga0500646_0115185 Ga0500646_0115185_162_821 218
429 3300053104 Ga0500556_0027079 Ga0500556_0027079_425_1105 218
430 3300053108 Ga0500562_000833 Ga0500562_000833_4138_4794 218
431 3300053119 Ga0500595_008288 Ga0500595_008288_2365_3021 218
432 3300053156 Ga0500622_0002619 Ga0500622_0002619_550_1230 218
433 3300005337 Ga0070682_100218252 Ga0070682_1002182522 219
434 3300005344 Ga0070661_100068188 Ga0070661_1000681882 219
435 3300005347 Ga0070668_100001523 Ga0070668_1000015233 219
436 3300005353 Ga0070669_100002957 Ga0070669_1000029574 219
437 3300005367 Ga0070667_100171046 Ga0070667_1001710463 219
438 3300005548 Ga0070665_100376492 Ga0070665_1003764921 219
439 3300005548 Ga0070665_100790429 Ga0070665_1007904292 219
440 3300005563 Ga0068855_100586354 Ga0068855_1005863542 219
441 3300005617 Ga0068859_100000320 Ga0068859_10000032021 219
442 3300005718 Ga0068866_10029999 Ga0068866_100299994 219
443 3300005841 Ga0068863_100001015 Ga0068863_10000101527 219
444 3300005842 Ga0068858_100002660 Ga0068858_1000026606 219
445 3300005843 Ga0068860_100022099 Ga0068860_1000220994 219
446 3300005844 Ga0068862_100075652 Ga0068862_1000756524 219
447 3300006028 Ga0070717_10888716 Ga0070717_108887162 219
448 3300006931 Ga0097620_100000320 Ga0097620_10000032021 219
449 3300010375 Ga0105239_10088694 Ga0105239_100886945 219
450 3300013100 Ga0157373_10305715 Ga0157373_103057151 219
451 3300025920 Ga0207649_10250205 Ga0207649_102502052 219
452 3300025931 Ga0207644_10000767 Ga0207644_100007679 219
453 3300025940 Ga0207691_10039738 Ga0207691_100397383 219
454 3300025941 Ga0207711_10004902 Ga0207711_100049028 219
455 3300025949 Ga0207667_10194007 Ga0207667_101940073 219
456 3300025972 Ga0207668_10002156 Ga0207668_1000215610 219
457 3300025986 Ga0207658_10033269 Ga0207658_100332693 219
458 3300026035 Ga0207703_10002382 Ga0207703_1000238218 219
459 3300026088 Ga0207641_10025693 Ga0207641_100256932 219
460 3300026118 Ga0207675_100074798 Ga0207675_1000747983 219
461 3300028379 Ga0268266_10672195 Ga0268266_106721952 219
462 3300028380 Ga0268265_10177033 Ga0268265_101770333 219
463 3300028381 Ga0268264_10014579 Ga0268264_100145793 219
464 3300028558 Ga0265326_10022823 Ga0265326_100228232 219
465 3300028653 Ga0265323_10000888 Ga0265323_1000088814 219
466 3300028654 Ga0265322_10019908 Ga0265322_100199082 219
467 3300028666 Ga0265336_10000188 Ga0265336_100001886 219
468 3300028800 Ga0265338_10000393 Ga0265338_1000039351 219
469 3300029957 Ga0265324_10031494 Ga0265324_100314942 219
470 3300031251 Ga0265327_10000525 Ga0265327_1000052532 219
471 3300031548 Ga0307408_100012797 Ga0307408_1000127975 219
472 3300031731 Ga0307405_10060255 Ga0307405_100602552 219
473 3300031824 Ga0307413_10029163 Ga0307413_100291633 219
474 3300031852 Ga0307410_10004398 Ga0307410_100043984 219
475 3300031852 Ga0307410_10362203 Ga0307410_103622032 219
476 3300031901 Ga0307406_10136120 Ga0307406_101361202 219
477 3300031903 Ga0307407_10002410 Ga0307407_100024102 219
478 3300031911 Ga0307412_10008188 Ga0307412_100081883 219
479 3300031995 Ga0307409_100008921 Ga0307409_1000089215 219
480 3300032002 Ga0307416_100011899 Ga0307416_1000118992 219
481 3300032004 Ga0307414_10107210 Ga0307414_101072102 219
482 3300032126 Ga0307415_100134890 Ga0307415_1001348903 219
483 3300035111 Ga0373923_0048700 Ga0373923_0048700_567_1265 219
484 3300035113 Ga0373936_0036367 Ga0373936_0036367_796_1494 219
485 3300035117 Ga0373953_0134639 Ga0373953_0134639_317_1015 219
486 3300035170 Ga0373943_0247930 Ga0373943_0247930_188_886 219
487 3300035171 Ga0373946_0051928 Ga0373946_0051928_449_1147 219
488 3300035692 Ga0373935_0001033 Ga0373935_0001033_2534_3232 219
489 3300035695 Ga0373927_0002069 Ga0373927_0002069_10866_11564 219
490 3300035724 Ga0373933_0039652 Ga0373933_0039652_1581_2279 219
491 3300035725 Ga0373947_0000940 Ga0373947_0000940_9740_10438 219
492 3300037068 Ga0373925_0001317 Ga0373925_0001317_9808_10506 219
493 3300041413 Ga0439465_0028587 Ga0439465_0028587_610_1284 219
494 3300041452 Ga0451793_0789003 Ga0451793_0789003_140_814 219
495 3300041463 Ga0451804_0466473 Ga0451804_0466473_88_762 219
496 3300045976 Ga0466967_0027665 Ga0466967_0027665_3578_4267 219
497 3300046454 Ga0495592_0017678 Ga0495592_0017678_308_1006 219
498 3300046455 Ga0495603_0019746 Ga0495603_0019746_1456_2154 219
499 3300046461 Ga0495641_0003365 Ga0495641_0003365_444_1142 219
500 3300046473 Ga0495582_0000528 Ga0495582_0000528_11212_11910 219
501 3300046475 Ga0495639_0000044 Ga0495639_0000044_40251_40949 219
502 3300046476 Ga0495662_0049212 Ga0495662_0049212_746_1444 219
503 3300046477 Ga0495664_0104697 Ga0495664_0104697_297_995 219
504 3300046499 Ga0495594_0000351 Ga0495594_0000351_12083_12781 219
505 3300046514 Ga0495618_0107808 Ga0495618_0107808_281_979 219
506 3300046516 Ga0495628_0087630 Ga0495628_0087630_1321_2019 219
507 3300046517 Ga0495630_0002975 Ga0495630_0002975_7002_7700 219
508 3300046529 Ga0495652_0102548 Ga0495652_0102548_548_1246 219
509 3300046531 Ga0495665_0000397 Ga0495665_0000397_10201_10899 219
510 3300046533 Ga0495640_0010991 Ga0495640_0010991_244_942 219
511 3300046557 Ga0495622_0001316 Ga0495622_0001316_10824_11522 219
512 3300046559 Ga0495667_0062069 Ga0495667_0062069_564_1262 219
513 3300046642 Ga0495634_0000252 Ga0495634_0000252_35806_36504 219
514 3300046663 Ga0495635_0001901 Ga0495635_0001901_6206_6904 219
515 3300046674 Ga0495588_0016278 Ga0495588_0016278_1585_2283 219
516 3300046681 Ga0495647_0004913 Ga0495647_0004913_956_1654 219
517 3300046689 Ga0495613_0002632 Ga0495613_0002632_6494_7192 219
518 3300046690 Ga0495624_0002748 Ga0495624_0002748_7197_7895 219
519 3300047315 Ga0495581_0001351 Ga0495581_0001351_11191_11889 219
520 3300047319 Ga0495674_0003317 Ga0495674_0003317_7279_7977 219
521 3300047321 Ga0495676_0034005 Ga0495676_0034005_2131_2829 219
522 3300047673 Ga0495593_0009579 Ga0495593_0009579_136_834 219
523 3300048089 Ga0495614_0032524 Ga0495614_0032524_758_1456 219
524 3300049569 Ga0501032_0051544 Ga0501032_0051544_2060_2728 219
525 3300053094 Ga0500566_0197638 Ga0500566_0197638_239_913 219
526 3300053105 Ga0500557_000001 Ga0500557_000001_92109_92783 219
527 3300053120 Ga0500597_203053 Ga0500597_203053_59_733 219
528 3300053130 Ga0500642_0000170 Ga0500642_0000170_10905_11579 219
529 3300053729 Ga0500625_009359 Ga0500625_009359_2845_3519 219
530 3300060353 Ga0501082_0087090 Ga0501082_0087090_211_906 219
531 iso_pu_bacteria 2508501128 2509153574 219
532 3300005327 Ga0070658_10174440 Ga0070658_101744402 220
533 3300005336 Ga0070680_100113772 Ga0070680_1001137723 220
534 3300005339 Ga0070660_100098447 Ga0070660_1000984472 220
535 3300005339 Ga0070660_100230085 Ga0070660_1002300852 220
536 3300005355 Ga0070671_100159057 Ga0070671_1001590572 220
537 3300005366 Ga0070659_100005883 Ga0070659_1000058831 220
538 3300005458 Ga0070681_10002207 Ga0070681_1000220715 220
539 3300005530 Ga0070679_100614193 Ga0070679_1006141932 220
540 3300005563 Ga0068855_100150193 Ga0068855_1001501934 220
541 3300005563 Ga0068855_100362370 Ga0068855_1003623702 220
542 3300005618 Ga0068864_100210318 Ga0068864_1002103182 220
543 3300005842 Ga0068858_100601581 Ga0068858_1006015812 220
544 3300005844 Ga0068862_100352022 Ga0068862_1003520222 220
545 3300006881 Ga0068865_100000993 Ga0068865_1000009937 220
546 3300009177 Ga0105248_10000963 Ga0105248_1000096315 220
547 3300009551 Ga0105238_10022615 Ga0105238_100226156 220
548 3300009551 Ga0105238_10172164 Ga0105238_101721642 220
549 3300013100 Ga0157373_10012438 Ga0157373_100124382 220
550 3300014968 Ga0157379_10422682 Ga0157379_104226822 220
551 3300025900 Ga0207710_10059959 Ga0207710_100599592 220
552 3300025908 Ga0207643_10383791 Ga0207643_103837912 220
553 3300025909 Ga0207705_10154627 Ga0207705_101546272 220
554 3300025912 Ga0207707_10302312 Ga0207707_103023122 220
555 3300025914 Ga0207671_10076810 Ga0207671_100768104 220
556 3300025917 Ga0207660_10021174 Ga0207660_100211745 220
557 3300025919 Ga0207657_10000621 Ga0207657_100006215 220
558 3300025921 Ga0207652_10221969 Ga0207652_102219692 220
559 3300025931 Ga0207644_10290774 Ga0207644_102907742 220
560 3300025932 Ga0207690_10088127 Ga0207690_100881273 220
561 3300025938 Ga0207704_10006609 Ga0207704_100066095 220
562 3300025941 Ga0207711_10000903 Ga0207711_1000090322 220
563 3300025949 Ga0207667_10141969 Ga0207667_101419694 220
564 3300025949 Ga0207667_10201573 Ga0207667_102015733 220
565 3300025949 Ga0207667_10447478 Ga0207667_104474782 220
566 3300025981 Ga0207640_10154041 Ga0207640_101540412 220
567 3300026023 Ga0207677_10089437 Ga0207677_100894372 220
568 3300026035 Ga0207703_10444047 Ga0207703_104440472 220
569 3300026041 Ga0207639_10338312 Ga0207639_103383122 220
570 3300026095 Ga0207676_10067837 Ga0207676_100678374 220
571 3300026116 Ga0207674_10103734 Ga0207674_101037343 220
572 3300028381 Ga0268264_10368881 Ga0268264_103688812 220
573 3300031548 Ga0307408_100016161 Ga0307408_1000161613 220
574 3300031731 Ga0307405_10069541 Ga0307405_100695413 220
575 3300031903 Ga0307407_10044779 Ga0307407_100447796 220
576 3300032002 Ga0307416_100153594 Ga0307416_1001535942 220
577 3300035113 Ga0373936_0002829 Ga0373936_0002829_4056_4718 220
578 3300037312 Ga0395899_0000100 Ga0395899_0000100_3599_4264 220
579 3300037418 Ga0395900_0000009 Ga0395900_0000009_66121_66786 220
580 3300037466 Ga0395898_0007526 Ga0395898_0007526_8263_8928 220
581 3300037471 Ga0395905_0019183 Ga0395905_0019183_709_1374 220
582 3300038443 Ga0395901_0000014 Ga0395901_0000014_17343_18008 220
583 3300038443 Ga0395901_0491127 Ga0395901_0491127_477_1157 220
584 3300039437 Ga0436365_1871972 Ga0436365_1871972_41_712 220
585 3300044683 Ga0466965_0070402 Ga0466965_0070402_329_997 220
586 3300046528 Ga0495642_0006227 Ga0495642_0006227_1722_2384 220
587 3300047445 Ga0495677_0072055 Ga0495677_0072055_591_1253 220
588 3300048904 Ga0496101_0114088 Ga0496101_0114088_602_1270 220
589 3300048905 Ga0496102_0017868 Ga0496102_0017868_2975_3643 220
590 3300048906 Ga0496103_0429472 Ga0496103_0429472_24_695 220
591 3300048910 Ga0496107_0073438 Ga0496107_0073438_479_1147 220
592 3300048911 Ga0496108_0126721 Ga0496108_0126721_653_1321 220
593 3300048912 Ga0496109_0015380 Ga0496109_0015380_1693_2361 220
594 3300048913 Ga0496110_0220212 Ga0496110_0220212_179_847 220
595 3300048915 Ga0496112_0617383 Ga0496112_0617383_285_953 220
596 3300048916 Ga0496113_0305916 Ga0496113_0305916_341_1009 220
597 iso_pu_bacteria 2791355048 2792459605 220
598 iso_pu_bacteria 2843744320 2843747260 220
599 iso_pu_bacteria 2849560528 2849560799 220
600 iso_pu_bacteria 2849573788 2849574317 220
601 iso_pu_bacteria 2851153111 2851158057 220
602 iso_pu_bacteria 2898329390 2898333429 220
603 3300025261 Ga0209233_1029535 Ga0209233_10295352 221
604 iso_pu_bacteria 2510917020 2511124616 221
605 iso_pu_bacteria 2582581280 2585155459 221
606 iso_pu_bacteria 2582581293 2585199245 221
607 iso_pu_bacteria 2585428106 2587919680 221
608 iso_pu_bacteria 2643221545 2643747922 221
609 iso_pu_bacteria 2643221552 2643781906 221
610 iso_pu_bacteria 2643221583 2643926163 221
611 iso_pu_bacteria 2643221584 2643931571 221
612 iso_pu_bacteria 2643221640 2644226386 221
613 iso_pu_bacteria 2643221642 2644235874 221
614 iso_pu_bacteria 2643221691 2644507974 221
615 iso_pu_bacteria 2818991435 2819536790 221
616 iso_pu_bacteria 2818991454 2819645951 221
617 iso_pu_bacteria 2857504554 2857506702 221
618 iso_pu_bacteria 2884960567 2884963916 221
619 iso_pu_bacteria 2928531327 2928534471 221
620 3300013100 Ga0157373_10000266 Ga0157373_100002662 222
621 3300028573 Ga0265334_10023209 Ga0265334_100232094 222
622 3300049744 Ga0501083_0116867 Ga0501083_0116867_344_1027 222
623 3300053096 Ga0500641_0000646 Ga0500641_0000646_7993_8661 222
624 3300053142 Ga0500577_0125666 Ga0500577_0125666_222_890 222
625 3300025299 Ga0209256_1005142 Ga0209256_10051426 223
626 iso_pu_bacteria 2582581279 2585150119 223
627 3300003781 Ga0055536_1001488 Ga0055536_10014889 224
628 3300003791 Ga0055530_10004881 Ga0055530_100048816 224
629 3300003794 Ga0055531_10059501 Ga0055531_100595012 224
630 3300025292 Ga0209676_1000200 Ga0209676_100020067 224
631 3300025298 Ga0209050_1000057 Ga0209050_1000057184 224
632 3300025304 Ga0209257_1027610 Ga0209257_10276102 224
633 3300025910 Ga0207684_10506669 Ga0207684_105066692 224
634 3300048909 Ga0496106_0042247 Ga0496106_0042247_2097_2771 224
635 3300048910 Ga0496107_0000349 Ga0496107_0000349_8260_8934 224
636 3300048924 Ga0496121_0034294 Ga0496121_0034294_36_710 224
637 3300053122 Ga0500608_000101 Ga0500608_000101_10527_11201 224
638 3300053136 Ga0500559_0026157 Ga0500559_0026157_91_765 224
639 3300003775 Ga0055524_1024640 Ga0055524_10246402 225
640 3300003781 Ga0055536_1001673 Ga0055536_10016735 225
641 3300003791 Ga0055530_10028365 Ga0055530_100283652 225
642 3300003794 Ga0055531_10000799 Ga0055531_1000079919 225
643 3300003794 Ga0055531_10000833 Ga0055531_1000083323 225
644 3300005262 Ga0065165_1001007 Ga0065165_100100715 225
645 3300006186 Ga0075369_10007966 Ga0075369_100079664 225
646 3300006195 Ga0075366_10010660 Ga0075366_100106606 225
647 3300006353 Ga0075370_10207398 Ga0075370_102073982 225
648 3300021377 Ga0213874_10042953 Ga0213874_100429532 225
649 3300025263 Ga0209565_1002061 Ga0209565_10020617 225
650 3300025273 Ga0209673_1000807 Ga0209673_100080718 225
651 3300025291 Ga0209675_1009368 Ga0209675_10093683 225
652 3300025292 Ga0209676_1000477 Ga0209676_100047760 225
653 3300025295 Ga0209564_1001886 Ga0209564_10018865 225
654 3300025295 Ga0209564_1013771 Ga0209564_10137712 225
655 3300025295 Ga0209564_1034144 Ga0209564_10341441 225
656 3300025295 Ga0209564_1035626 Ga0209564_10356262 225
657 3300025297 Ga0209758_1001528 Ga0209758_100152810 225
658 3300025297 Ga0209758_1003270 Ga0209758_10032708 225
659 3300025298 Ga0209050_1000696 Ga0209050_10006969 225
660 3300025298 Ga0209050_1026171 Ga0209050_10261713 225
661 3300025299 Ga0209256_1004238 Ga0209256_10042385 225
662 3300025299 Ga0209256_1011164 Ga0209256_10111644 225
663 3300025304 Ga0209257_1000223 Ga0209257_1000223119 225
664 3300025304 Ga0209257_1000702 Ga0209257_100070231 225
665 3300028794 Ga0307515_10016872 Ga0307515_1001687210 225
666 3300028794 Ga0307515_10038196 Ga0307515_100381965 225
667 3300046453 Ga0495627_000679 Ga0495627_000679_15585_16262 225
668 3300046457 Ga0495590_0001078 Ga0495590_0001078_3320_4003 225
669 3300046460 Ga0495638_0000410 Ga0495638_0000410_10736_11419 225
670 3300046460 Ga0495638_0000579 Ga0495638_0000579_13883_14560 225
671 3300046460 Ga0495638_0002568 Ga0495638_0002568_2974_3651 225
672 3300046460 Ga0495638_0006216 Ga0495638_0006216_2284_2961 225
673 3300046460 Ga0495638_0077710 Ga0495638_0077710_86_763 225
674 3300046471 Ga0495650_0000269 Ga0495650_0000269_55892_56569 225
675 3300046506 Ga0495583_0000029 Ga0495583_0000029_16782_17459 225
676 3300046507 Ga0495606_0048734 Ga0495606_0048734_727_1404 225
677 3300046507 Ga0495606_0118206 Ga0495606_0118206_663_1340 225
678 3300046512 Ga0495610_0000225 Ga0495610_0000225_4903_5580 225
679 3300046512 Ga0495610_0001127 Ga0495610_0001127_11199_11882 225
680 3300046513 Ga0495616_0000160 Ga0495616_0000160_42604_43281 225
681 3300046515 Ga0495620_0041011 Ga0495620_0041011_800_1477 225
682 3300046518 Ga0495631_0010545 Ga0495631_0010545_3539_4222 225
683 3300046519 Ga0495632_0001474 Ga0495632_0001474_9563_10240 225
684 3300046520 Ga0495637_0017261 Ga0495637_0017261_1464_2141 225
685 3300046520 Ga0495637_0039278 Ga0495637_0039278_819_1502 225
686 3300046520 Ga0495637_0057569 Ga0495637_0057569_422_1105 225
687 3300046524 Ga0495648_0001017 Ga0495648_0001017_18110_18793 225
688 3300046524 Ga0495648_0009026 Ga0495648_0009026_2936_3613 225
689 3300046524 Ga0495648_0250447 Ga0495648_0250447_96_773 225
690 3300046525 Ga0495663_0078905 Ga0495663_0078905_62_739 225
691 3300046530 Ga0495654_0000123 Ga0495654_0000123_56878_57555 225
692 3300046616 Ga0495668_0000014 Ga0495668_0000014_337912_338589 225
693 3300046616 Ga0495668_0008784 Ga0495668_0008784_4450_5127 225
694 3300046616 Ga0495668_0023540 Ga0495668_0023540_2342_3025 225
695 3300046616 Ga0495668_0119174 Ga0495668_0119174_107_784 225
696 3300046660 Ga0495625_0000816 Ga0495625_0000816_24256_24933 225
697 3300046660 Ga0495625_0016984 Ga0495625_0016984_2421_3098 225
698 3300046660 Ga0495625_0039662 Ga0495625_0039662_341_1018 225
699 3300046660 Ga0495625_0073606 Ga0495625_0073606_670_1350 225
700 3300046660 Ga0495625_0250084 Ga0495625_0250084_104_787 225
701 3300046660 Ga0495625_0388926 Ga0495625_0388926_43_720 225
702 3300046794 Ga0495589_0165085 Ga0495589_0165085_166_846 225
703 3300046810 Ga0495660_0005019 Ga0495660_0005019_1687_2364 225
704 3300047320 Ga0495672_0001824 Ga0495672_0001824_18639_19316 225
705 3300047469 Ga0495673_0000094 Ga0495673_0000094_26385_27062 225
706 3300047469 Ga0495673_0000461 Ga0495673_0000461_24055_24738 225
707 3300047469 Ga0495673_0002213 Ga0495673_0002213_9205_9882 225
708 3300047472 Ga0495686_0000825 Ga0495686_0000825_20520_21203 225
709 3300047472 Ga0495686_0008370 Ga0495686_0008370_638_1315 225
710 3300047472 Ga0495686_0014578 Ga0495686_0014578_4284_4967 225
711 3300047472 Ga0495686_0055016 Ga0495686_0055016_1688_2371 225
712 3300047472 Ga0495686_0102508 Ga0495686_0102508_458_1135 225
713 3300048918 Ga0496115_0003100 Ga0496115_0003100_11154_11831 225
714 3300048924 Ga0496121_0053001 Ga0496121_0053001_1435_2112 225
715 3300048925 Ga0496122_0215371 Ga0496122_0215371_211_888 225
716 3300048927 Ga0496124_0014468 Ga0496124_0014468_6277_6954 225
717 3300048928 Ga0496125_0023238 Ga0496125_0023238_4171_4848 225
718 3300048929 Ga0496126_0006062 Ga0496126_0006062_11301_11978 225
719 3300048929 Ga0496126_0494994 Ga0496126_0494994_58_735 225
720 3300049459 Ga0495678_000723 Ga0495678_000723_10508_11191 225
721 3300050496 nmdc:mga07m45_31708_c1 nmdc:mga07m45_31708_c1_429_1106 225
722 3300053086 Ga0500578_0001050 Ga0500578_0001050_10344_11027 225
723 3300053087 Ga0500643_010475 Ga0500643_010475_690_1373 225
724 3300053088 Ga0500644_0000261 Ga0500644_0000261_11531_12214 225
725 3300053102 Ga0500554_002053 Ga0500554_002053_1285_1962 225
726 3300053104 Ga0500556_0000583 Ga0500556_0000583_7248_7925 225
727 3300053108 Ga0500562_005155 Ga0500562_005155_2360_3043 225
728 3300053118 Ga0500594_0000084 Ga0500594_0000084_11146_11829 225
729 3300053123 Ga0500614_016705 Ga0500614_016705_584_1261 225
730 3300053125 Ga0500618_000255 Ga0500618_000255_18851_19528 225
731 3300053136 Ga0500559_0000243 Ga0500559_0000243_23367_24044 225
732 3300053136 Ga0500559_0008182 Ga0500559_0008182_3236_3913 225
733 3300053138 Ga0500564_000062 Ga0500564_000062_10145_10828 225
734 3300053142 Ga0500577_0001545 Ga0500577_0001545_2754_3431 225
735 3300053156 Ga0500622_0001061 Ga0500622_0001061_18777_19460 225
736 3300053156 Ga0500622_0006366 Ga0500622_0006366_3303_3980 225
737 3300053156 Ga0500622_0016359 Ga0500622_0016359_1148_1825 225
738 3300053156 Ga0500622_0042460 Ga0500622_0042460_75_755 225
739 3300053730 Ga0500645_003312 Ga0500645_003312_3133_3810 225
740 3300053730 Ga0500645_015734 Ga0500645_015734_1468_2145 225
741 3300053731 Ga0500609_000644 Ga0500609_000644_2812_3489 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

85

255

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9112 22 216
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8121 22 216
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.812 20 222
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7805 20 216
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7716 20 222
ID Description Score Start End Superfamily
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9116 22 212 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8891 20 216 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8067 20 222 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7961 22 212 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7942 20 216 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7T8NWG6-F1-model_v4 deleted 0.9937 16 216
AF-A0A3D2L3Z4-F1-model_v4 Uracil-DNA glycosylase 0.9936 27 155 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A519WZQ7-F1-model_v4 deleted 0.993 16 219
AF-A0A257PF37-F1-model_v4 Uracil-DNA glycosylase 0.9908 17 126 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A258DPB5-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9906 17 219 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
94.42 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map