F478575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 741 | 400 | 685 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100002265|Ga0068864_10000226512 |
| Length | 260 |
| Sequence | MLRFDEPVLAFAAPCSSGATLSIRARLFLTAPARMRKNQSVTKPDAIAAARDPEPPRDCPICPRLVAYREVNRAEHPDWFNGPAPSFGDPQARLLVAGLAPGRQGANRTGRPFTGDFAGVLLYDTLLKLGFARGRYQARPDDGLELVDCMVSNAVRCAPPGNKPETSEEANCRPFLTARIAALPRLKVIVTLGDVSRRNVLRALGLKASAGIAGHGSEFQAGPYTVLNSYHCSRLNTNTGRLTPAMFEAVFVRAKALIDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 4 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 5 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 6 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 7 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 8 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 9 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 10 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 11 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 12 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 13 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 14 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 15 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 16 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 17 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 18 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 19 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 20 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 21 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 22 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 23 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 24 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 25 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 26 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 27 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 28 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 29 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 30 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 31 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 32 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 33 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 34 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 35 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 36 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 37 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 38 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 39 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 40 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 41 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 42 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 221 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 222 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 223 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 224 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 225 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 226 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 227 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 228 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 229 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 230 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 231 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 234 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 348 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 349 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 350 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 352 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 353 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 355 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 356 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 359 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 365 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 367 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 376 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 379 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 381 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 382 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 383 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 388 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 389 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 390 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 391 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 392 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 393 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 394 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 395 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 396 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 397 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 398 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 399 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 400 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.44 |
| Metatranscriptomes | 0 |
| Isolates | 7.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.35 |
| Nodule | 3.64 |
| Rhizoplane | 2.83 |
| Rhizosphere | 67.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055524_1024640 | 3300003775 | Bacteria | 1902 |
| 2 | Ga0055536_1001488 | 3300003781 | Bacteria | 14090 |
| 3 | Ga0055536_1001673 | 3300003781 | Bacteria | 13162 |
| 4 | Ga0055530_10003799 | 3300003791 | Bacteria | 8314 |
| 5 | Ga0055530_10004881 | 3300003791 | Bacteria | 6680 |
| 6 | Ga0055530_10028365 | 3300003791 | Bacteria | 1512 |
| 7 | Ga0055531_10000799 | 3300003794 | Bacteria | 26105 |
| 8 | Ga0055531_10000833 | 3300003794 | Bacteria | 25467 |
| 9 | Ga0055531_10001352 | 3300003794 | Bacteria | 18278 |
| 10 | Ga0055531_10033561 | 3300003794 | Bacteria | 1650 |
| 11 | Ga0055531_10059501 | 3300003794 | Bacteria | 943 |
| 12 | Ga0065165_1000210 | 3300005262 | Bacteria | 101721 |
| 13 | Ga0065165_1001007 | 3300005262 | Bacteria | 34394 |
| 14 | Ga0065165_1024553 | 3300005262 | Bacteria | 2022 |
| 15 | Ga0065712_10020657 | 3300005290 | Bacteria | 1346 |
| 16 | Ga0070658_10174440 | 3300005327 | Bacteria | 1807 |
| 17 | Ga0070658_10562888 | 3300005327 | Bacteria | 987 |
| 18 | Ga0070670_100000062 | 3300005331 | Bacteria | 112560 |
| 19 | Ga0070670_100057708 | 3300005331 | Bacteria | 3332 |
| 20 | Ga0068869_100521118 | 3300005334 | Bacteria | 995 |
| 21 | Ga0070680_100113772 | 3300005336 | Bacteria | 2254 |
| 22 | Ga0070680_100715920 | 3300005336 | Bacteria | 861 |
| 23 | Ga0070682_100218252 | 3300005337 | Bacteria | 1355 |
| 24 | Ga0070660_100098447 | 3300005339 | Bacteria | 2315 |
| 25 | Ga0070660_100230085 | 3300005339 | Bacteria | 1508 |
| 26 | Ga0070660_100530192 | 3300005339 | Bacteria | 981 |
| 27 | Ga0070691_10081842 | 3300005341 | Bacteria | 1582 |
| 28 | Ga0070661_100068188 | 3300005344 | Bacteria | 2614 |
| 29 | Ga0070668_100001523 | 3300005347 | Bacteria | 16727 |
| 30 | Ga0070668_100002210 | 3300005347 | Bacteria | 14287 |
| 31 | Ga0070668_100002583 | 3300005347 | Bacteria | 13311 |
| 32 | Ga0070668_100009206 | 3300005347 | Bacteria | 7323 |
| 33 | Ga0070668_100016286 | 3300005347 | Bacteria | 5560 |
| 34 | Ga0070669_100002957 | 3300005353 | Bacteria | 12250 |
| 35 | Ga0070669_100164119 | 3300005353 | Bacteria | 1728 |
| 36 | Ga0070671_100159057 | 3300005355 | Bacteria | 1909 |
| 37 | Ga0070673_100808575 | 3300005364 | Bacteria | 866 |
| 38 | Ga0070659_100000250 | 3300005366 | Bacteria | 42505 |
| 39 | Ga0070659_100005883 | 3300005366 | Bacteria | 8836 |
| 40 | Ga0070659_100032958 | 3300005366 | Bacteria | 4023 |
| 41 | Ga0070667_100000178 | 3300005367 | Bacteria | 77450 |
| 42 | Ga0070667_100004563 | 3300005367 | Bacteria | 11642 |
| 43 | Ga0070667_100020319 | 3300005367 | Bacteria | 5512 |
| 44 | Ga0070667_100171046 | 3300005367 | Bacteria | 1918 |
| 45 | Ga0070714_100004266 | 3300005435 | Bacteria | 10767 |
| 46 | Ga0070681_10002207 | 3300005458 | Bacteria | 17748 |
| 47 | Ga0070681_10038255 | 3300005458 | Bacteria | 4810 |
| 48 | Ga0070681_10177574 | 3300005458 | Bacteria | 2051 |
| 49 | Ga0070706_100005625 | 3300005467 | Bacteria | 11923 |
| 50 | Ga0070699_100006239 | 3300005518 | Bacteria | 10397 |
| 51 | Ga0070679_100030766 | 3300005530 | Bacteria | 5302 |
| 52 | Ga0070679_100614193 | 3300005530 | Bacteria | 1030 |
| 53 | Ga0070697_100010902 | 3300005536 | Bacteria | 7099 |
| 54 | Ga0068853_100126552 | 3300005539 | Bacteria | 2283 |
| 55 | Ga0068853_100144638 | 3300005539 | Bacteria | 2136 |
| 56 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 57 | Ga0070665_100002121 | 3300005548 | Bacteria | 22148 |
| 58 | Ga0070665_100002649 | 3300005548 | Bacteria | 19471 |
| 59 | Ga0070665_100066641 | 3300005548 | Bacteria | 3612 |
| 60 | Ga0070665_100376492 | 3300005548 | Bacteria | 1427 |
| 61 | Ga0070665_100790429 | 3300005548 | Bacteria | 962 |
| 62 | Ga0068855_100020193 | 3300005563 | Bacteria | 8000 |
| 63 | Ga0068855_100117313 | 3300005563 | Bacteria | 3050 |
| 64 | Ga0068855_100150193 | 3300005563 | Bacteria | 2649 |
| 65 | Ga0068855_100298262 | 3300005563 | Bacteria | 1785 |
| 66 | Ga0068855_100362370 | 3300005563 | Bacteria | 1595 |
| 67 | Ga0068855_100586354 | 3300005563 | Bacteria | 1204 |
| 68 | Ga0068856_100377011 | 3300005614 | Bacteria | 1438 |
| 69 | Ga0068856_100620614 | 3300005614 | Bacteria | 1102 |
| 70 | Ga0068852_100185943 | 3300005616 | Bacteria | 1957 |
| 71 | Ga0068859_100000320 | 3300005617 | Bacteria | 48067 |
| 72 | Ga0068859_100066598 | 3300005617 | Bacteria | 3637 |
| 73 | Ga0068859_101524412 | 3300005617 | Bacteria | 738 |
| 74 | Ga0068864_100000126 | 3300005618 | Bacteria | 74385 |
| 75 | Ga0068864_100002265 | 3300005618 | Bacteria | 15913 |
| 76 | Ga0068864_100033979 | 3300005618 | Bacteria | 4336 |
| 77 | Ga0068864_100210318 | 3300005618 | Bacteria | 1791 |
| 78 | Ga0068866_10029999 | 3300005718 | Bacteria | 2606 |
| 79 | Ga0068863_100000282 | 3300005841 | Bacteria | 52485 |
| 80 | Ga0068863_100001015 | 3300005841 | Bacteria | 28103 |
| 81 | Ga0068863_100001240 | 3300005841 | Bacteria | 25427 |
| 82 | Ga0068863_100013356 | 3300005841 | Bacteria | 7918 |
| 83 | Ga0068863_100278321 | 3300005841 | Bacteria | 1621 |
| 84 | Ga0068858_100000493 | 3300005842 | Bacteria | 41212 |
| 85 | Ga0068858_100002660 | 3300005842 | Bacteria | 17976 |
| 86 | Ga0068858_100027605 | 3300005842 | Bacteria | 5273 |
| 87 | Ga0068858_100601581 | 3300005842 | Bacteria | 1066 |
| 88 | Ga0068860_100000145 | 3300005843 | Bacteria | 115830 |
| 89 | Ga0068860_100002315 | 3300005843 | Bacteria | 20018 |
| 90 | Ga0068860_100022099 | 3300005843 | Bacteria | 6158 |
| 91 | Ga0068860_100096149 | 3300005843 | Bacteria | 2823 |
| 92 | Ga0068862_100001903 | 3300005844 | Bacteria | 18951 |
| 93 | Ga0068862_100007746 | 3300005844 | Bacteria | 8882 |
| 94 | Ga0068862_100017518 | 3300005844 | Bacteria | 5966 |
| 95 | Ga0068862_100030692 | 3300005844 | Bacteria | 4531 |
| 96 | Ga0068862_100033184 | 3300005844 | Bacteria | 4361 |
| 97 | Ga0068862_100075652 | 3300005844 | Bacteria | 2913 |
| 98 | Ga0068862_100098213 | 3300005844 | Bacteria | 2558 |
| 99 | Ga0068862_100352022 | 3300005844 | Bacteria | 1367 |
| 100 | Ga0081540_1007651 | 3300005983 | Bacteria | 7664 |
| 101 | Ga0081540_1010892 | 3300005983 | Bacteria | 6107 |
| 102 | Ga0081540_1014384 | 3300005983 | Bacteria | 5070 |
| 103 | Ga0070717_10888716 | 3300006028 | Bacteria | 811 |
| 104 | Ga0075363_100084385 | 3300006048 | Bacteria | 1741 |
| 105 | Ga0075364_10001440 | 3300006051 | Bacteria | 12901 |
| 106 | Ga0075367_10074765 | 3300006178 | Bacteria | 2043 |
| 107 | Ga0075369_10007966 | 3300006186 | Bacteria | 4059 |
| 108 | Ga0075369_10088847 | 3300006186 | Bacteria | 1377 |
| 109 | Ga0075366_10010660 | 3300006195 | Bacteria | 5165 |
| 110 | Ga0075366_10019261 | 3300006195 | Bacteria | 3946 |
| 111 | Ga0075370_10048162 | 3300006353 | Bacteria | 2414 |
| 112 | Ga0075370_10207398 | 3300006353 | Bacteria | 1157 |
| 113 | Ga0075430_100029675 | 3300006846 | Bacteria | 4642 |
| 114 | Ga0068865_100000993 | 3300006881 | Bacteria | 16269 |
| 115 | Ga0097620_100000320 | 3300006931 | Bacteria | 48067 |
| 116 | Ga0097620_100066595 | 3300006931 | Bacteria | 3637 |
| 117 | Ga0097620_101523913 | 3300006931 | Bacteria | 738 |
| 118 | Ga0105240_10000535 | 3300009093 | Bacteria | 70216 |
| 119 | Ga0105240_10002167 | 3300009093 | Bacteria | 32035 |
| 120 | Ga0105240_10050691 | 3300009093 | Bacteria | 5231 |
| 121 | Ga0105247_10063666 | 3300009101 | Bacteria | 2290 |
| 122 | Ga0105243_10773435 | 3300009148 | Bacteria | 944 |
| 123 | Ga0105241_10205375 | 3300009174 | Bacteria | 1648 |
| 124 | Ga0105248_10000963 | 3300009177 | Bacteria | 32061 |
| 125 | Ga0105248_10021645 | 3300009177 | Bacteria | 7121 |
| 126 | Ga0105248_10077474 | 3300009177 | Bacteria | 3737 |
| 127 | Ga0105238_10022615 | 3300009551 | Bacteria | 6408 |
| 128 | Ga0105238_10045390 | 3300009551 | Bacteria | 4439 |
| 129 | Ga0105238_10172164 | 3300009551 | Bacteria | 2141 |
| 130 | Ga0105249_10010885 | 3300009553 | Bacteria | 7994 |
| 131 | Ga0105239_10050787 | 3300010375 | Bacteria | 4547 |
| 132 | Ga0105239_10088694 | 3300010375 | Bacteria | 3410 |
| 133 | Ga0105239_10426207 | 3300010375 | Bacteria | 1503 |
| 134 | Ga0157373_10000266 | 3300013100 | Bacteria | 42156 |
| 135 | Ga0157373_10012438 | 3300013100 | Bacteria | 6256 |
| 136 | Ga0157373_10305715 | 3300013100 | Bacteria | 1129 |
| 137 | Ga0157370_10017504 | 3300013104 | Bacteria | 7230 |
| 138 | Ga0157370_10318028 | 3300013104 | Bacteria | 1436 |
| 139 | Ga0157369_10132230 | 3300013105 | Bacteria | 2644 |
| 140 | Ga0163162_10687387 | 3300013306 | Bacteria | 1145 |
| 141 | Ga0163163_10021896 | 3300014325 | Bacteria | 6041 |
| 142 | Ga0163163_10126113 | 3300014325 | Bacteria | 2598 |
| 143 | Ga0163163_10212084 | 3300014325 | Bacteria | 1986 |
| 144 | Ga0163163_10432077 | 3300014325 | Bacteria | 1376 |
| 145 | Ga0182008_10110733 | 3300014497 | Bacteria | 1361 |
| 146 | Ga0157379_10033986 | 3300014968 | Bacteria | 4545 |
| 147 | Ga0157379_10063806 | 3300014968 | Bacteria | 3293 |
| 148 | Ga0157379_10422682 | 3300014968 | Bacteria | 1227 |
| 149 | Ga0157379_10620627 | 3300014968 | Bacteria | 1010 |
| 150 | Ga0213874_10042953 | 3300021377 | Bacteria | 1360 |
| 151 | Ga0213876_10000129 | 3300021384 | Bacteria | 82128 |
| 152 | Ga0213876_10010289 | 3300021384 | Bacteria | 5025 |
| 153 | Ga0213875_10066582 | 3300021388 | Bacteria | 1683 |
| 154 | Ga0213875_10096715 | 3300021388 | Bacteria | 1377 |
| 155 | Ga0209026_1001124 | 3300025250 | Bacteria | 12639 |
| 156 | Ga0209026_1011705 | 3300025250 | Bacteria | 1562 |
| 157 | Ga0209233_1029535 | 3300025261 | Bacteria | 1302 |
| 158 | Ga0209565_1002061 | 3300025263 | Bacteria | 7698 |
| 159 | Ga0209455_1036323 | 3300025272 | Bacteria | 784 |
| 160 | Ga0209673_1000807 | 3300025273 | Bacteria | 41435 |
| 161 | Ga0209675_1009368 | 3300025291 | Bacteria | 3468 |
| 162 | Ga0209676_1000200 | 3300025292 | Bacteria | 133793 |
| 163 | Ga0209676_1000477 | 3300025292 | Bacteria | 66211 |
| 164 | Ga0209025_1120097 | 3300025294 | Bacteria | 786 |
| 165 | Ga0209564_1001886 | 3300025295 | Bacteria | 18859 |
| 166 | Ga0209564_1013771 | 3300025295 | Bacteria | 3408 |
| 167 | Ga0209564_1034144 | 3300025295 | Bacteria | 1497 |
| 168 | Ga0209564_1035626 | 3300025295 | Bacteria | 1437 |
| 169 | Ga0209758_1001528 | 3300025297 | Bacteria | 26711 |
| 170 | Ga0209758_1003270 | 3300025297 | Bacteria | 15024 |
| 171 | Ga0209758_1009767 | 3300025297 | Bacteria | 5884 |
| 172 | Ga0209050_1000057 | 3300025298 | Bacteria | 326289 |
| 173 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 174 | Ga0209050_1000696 | 3300025298 | Bacteria | 49982 |
| 175 | Ga0209050_1026171 | 3300025298 | Bacteria | 1960 |
| 176 | Ga0209256_1004238 | 3300025299 | Bacteria | 9190 |
| 177 | Ga0209256_1005142 | 3300025299 | Bacteria | 7733 |
| 178 | Ga0209256_1011164 | 3300025299 | Bacteria | 3632 |
| 179 | Ga0209257_1000220 | 3300025304 | Bacteria | 135116 |
| 180 | Ga0209257_1000223 | 3300025304 | Bacteria | 134337 |
| 181 | Ga0209257_1000702 | 3300025304 | Bacteria | 51789 |
| 182 | Ga0209257_1001456 | 3300025304 | Bacteria | 27971 |
| 183 | Ga0209257_1027610 | 3300025304 | Bacteria | 1887 |
| 184 | Ga0207710_10059959 | 3300025900 | Bacteria | 1723 |
| 185 | Ga0207643_10383791 | 3300025908 | Bacteria | 886 |
| 186 | Ga0207705_10154627 | 3300025909 | Bacteria | 1720 |
| 187 | Ga0207705_10593200 | 3300025909 | Bacteria | 861 |
| 188 | Ga0207684_10506669 | 3300025910 | Bacteria | 1034 |
| 189 | Ga0207654_10200661 | 3300025911 | Bacteria | 1313 |
| 190 | Ga0207707_10302312 | 3300025912 | Bacteria | 1383 |
| 191 | Ga0207707_10323004 | 3300025912 | Bacteria | 1332 |
| 192 | Ga0207707_10451428 | 3300025912 | Bacteria | 1100 |
| 193 | Ga0207695_10002212 | 3300025913 | Bacteria | 29262 |
| 194 | Ga0207695_10003013 | 3300025913 | Bacteria | 24211 |
| 195 | Ga0207695_10010454 | 3300025913 | Bacteria | 11349 |
| 196 | Ga0207695_10244486 | 3300025913 | Bacteria | 1695 |
| 197 | Ga0207695_10514152 | 3300025913 | Bacteria | 1079 |
| 198 | Ga0207671_10076810 | 3300025914 | Bacteria | 2499 |
| 199 | Ga0207660_10020290 | 3300025917 | Bacteria | 4456 |
| 200 | Ga0207660_10021174 | 3300025917 | Bacteria | 4371 |
| 201 | Ga0207657_10000621 | 3300025919 | Bacteria | 37675 |
| 202 | Ga0207657_10446961 | 3300025919 | Bacteria | 1014 |
| 203 | Ga0207649_10250205 | 3300025920 | Bacteria | 1276 |
| 204 | Ga0207652_10097512 | 3300025921 | Bacteria | 2591 |
| 205 | Ga0207652_10221969 | 3300025921 | Bacteria | 1703 |
| 206 | Ga0207681_10011486 | 3300025923 | Bacteria | 5442 |
| 207 | Ga0207681_10141169 | 3300025923 | Bacteria | 1794 |
| 208 | Ga0207694_10024478 | 3300025924 | Bacteria | 4585 |
| 209 | Ga0207694_10110731 | 3300025924 | Bacteria | 2184 |
| 210 | Ga0207650_10000084 | 3300025925 | Bacteria | 125773 |
| 211 | Ga0207650_10043649 | 3300025925 | Bacteria | 3292 |
| 212 | Ga0207650_10237696 | 3300025925 | Bacteria | 1471 |
| 213 | Ga0207650_10318639 | 3300025925 | Bacteria | 1273 |
| 214 | Ga0207664_10022011 | 3300025929 | Bacteria | 4752 |
| 215 | Ga0207644_10000767 | 3300025931 | Bacteria | 20321 |
| 216 | Ga0207644_10072980 | 3300025931 | Bacteria | 2515 |
| 217 | Ga0207644_10290774 | 3300025931 | Bacteria | 1314 |
| 218 | Ga0207690_10000760 | 3300025932 | Bacteria | 20828 |
| 219 | Ga0207690_10036903 | 3300025932 | Bacteria | 3169 |
| 220 | Ga0207690_10088127 | 3300025932 | Bacteria | 2185 |
| 221 | Ga0207686_10343883 | 3300025934 | Bacteria | 1121 |
| 222 | Ga0207704_10006609 | 3300025938 | Bacteria | 5425 |
| 223 | Ga0207691_10039738 | 3300025940 | Bacteria | 4351 |
| 224 | Ga0207711_10000903 | 3300025941 | Bacteria | 28567 |
| 225 | Ga0207711_10004902 | 3300025941 | Bacteria | 11362 |
| 226 | Ga0207711_10065255 | 3300025941 | Bacteria | 3147 |
| 227 | Ga0207689_10018685 | 3300025942 | Bacteria | 5847 |
| 228 | Ga0207667_10047475 | 3300025949 | Bacteria | 4545 |
| 229 | Ga0207667_10048351 | 3300025949 | Bacteria | 4498 |
| 230 | Ga0207667_10141969 | 3300025949 | Bacteria | 2473 |
| 231 | Ga0207667_10194007 | 3300025949 | Bacteria | 2084 |
| 232 | Ga0207667_10201573 | 3300025949 | Bacteria | 2041 |
| 233 | Ga0207667_10447478 | 3300025949 | Bacteria | 1313 |
| 234 | Ga0207712_10001180 | 3300025961 | Bacteria | 18078 |
| 235 | Ga0207668_10000007 | 3300025972 | Bacteria | 190613 |
| 236 | Ga0207668_10000036 | 3300025972 | Bacteria | 117190 |
| 237 | Ga0207668_10002156 | 3300025972 | Bacteria | 11478 |
| 238 | Ga0207668_10009936 | 3300025972 | Bacteria | 5723 |
| 239 | Ga0207668_10067141 | 3300025972 | Bacteria | 2545 |
| 240 | Ga0207668_10339547 | 3300025972 | Bacteria | 1252 |
| 241 | Ga0207640_10154041 | 3300025981 | Bacteria | 1692 |
| 242 | Ga0207658_10000427 | 3300025986 | Bacteria | 39977 |
| 243 | Ga0207658_10018889 | 3300025986 | Bacteria | 4767 |
| 244 | Ga0207658_10033269 | 3300025986 | Bacteria | 3676 |
| 245 | Ga0207658_10036818 | 3300025986 | Bacteria | 3510 |
| 246 | Ga0207677_10089437 | 3300026023 | Bacteria | 2235 |
| 247 | Ga0207703_10000658 | 3300026035 | Bacteria | 34612 |
| 248 | Ga0207703_10001840 | 3300026035 | Bacteria | 18897 |
| 249 | Ga0207703_10002382 | 3300026035 | Bacteria | 16346 |
| 250 | Ga0207703_10444047 | 3300026035 | Bacteria | 1211 |
| 251 | Ga0207639_10016913 | 3300026041 | Bacteria | 5168 |
| 252 | Ga0207639_10338312 | 3300026041 | Bacteria | 1341 |
| 253 | Ga0207702_10260853 | 3300026078 | Bacteria | 1631 |
| 254 | Ga0207702_10305214 | 3300026078 | Bacteria | 1512 |
| 255 | Ga0207641_10000376 | 3300026088 | Bacteria | 53079 |
| 256 | Ga0207641_10025693 | 3300026088 | Bacteria | 4855 |
| 257 | Ga0207641_10029022 | 3300026088 | Bacteria | 4573 |
| 258 | Ga0207641_10032627 | 3300026088 | Bacteria | 4324 |
| 259 | Ga0207676_10000102 | 3300026095 | Bacteria | 77065 |
| 260 | Ga0207676_10000332 | 3300026095 | Bacteria | 40676 |
| 261 | Ga0207676_10053643 | 3300026095 | Bacteria | 3156 |
| 262 | Ga0207676_10067837 | 3300026095 | Bacteria | 2850 |
| 263 | Ga0207676_10315414 | 3300026095 | Bacteria | 1433 |
| 264 | Ga0207674_10103734 | 3300026116 | Bacteria | 2822 |
| 265 | Ga0207675_100074798 | 3300026118 | Bacteria | 3170 |
| 266 | Ga0207698_10140852 | 3300026142 | Bacteria | 2078 |
| 267 | Ga0210000_1007493 | 3300027462 | Bacteria | 1597 |
| 268 | Ga0209983_1007314 | 3300027665 | Bacteria | 2264 |
| 269 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 270 | Ga0268266_10001586 | 3300028379 | Bacteria | 26564 |
| 271 | Ga0268266_10008574 | 3300028379 | Bacteria | 9082 |
| 272 | Ga0268266_10053286 | 3300028379 | Bacteria | 3475 |
| 273 | Ga0268266_10633972 | 3300028379 | Bacteria | 1028 |
| 274 | Ga0268266_10672195 | 3300028379 | Bacteria | 997 |
| 275 | Ga0268265_10000635 | 3300028380 | Bacteria | 35008 |
| 276 | Ga0268265_10000993 | 3300028380 | Bacteria | 25767 |
| 277 | Ga0268265_10006750 | 3300028380 | Bacteria | 7766 |
| 278 | Ga0268265_10016051 | 3300028380 | Bacteria | 5138 |
| 279 | Ga0268265_10047063 | 3300028380 | Bacteria | 3229 |
| 280 | Ga0268265_10114078 | 3300028380 | Bacteria | 2212 |
| 281 | Ga0268265_10177033 | 3300028380 | Bacteria | 1829 |
| 282 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 283 | Ga0268264_10000284 | 3300028381 | Bacteria | 85451 |
| 284 | Ga0268264_10014579 | 3300028381 | Bacteria | 6457 |
| 285 | Ga0268264_10034278 | 3300028381 | Bacteria | 4174 |
| 286 | Ga0268264_10368881 | 3300028381 | Bacteria | 1372 |
| 287 | Ga0265337_1035268 | 3300028556 | Bacteria | 1466 |
| 288 | Ga0265326_10022823 | 3300028558 | Bacteria | 1790 |
| 289 | Ga0265319_1073375 | 3300028563 | Bacteria | 1094 |
| 290 | Ga0265334_10023209 | 3300028573 | Bacteria | 2524 |
| 291 | Ga0265323_10000888 | 3300028653 | Bacteria | 15825 |
| 292 | Ga0265322_10019908 | 3300028654 | Bacteria | 1924 |
| 293 | Ga0265336_10000188 | 3300028666 | Bacteria | 43129 |
| 294 | Ga0307517_10002627 | 3300028786 | Bacteria | 28638 |
| 295 | Ga0307517_10026693 | 3300028786 | Bacteria | 6979 |
| 296 | Ga0307515_10016872 | 3300028794 | Bacteria | 13347 |
| 297 | Ga0307515_10038196 | 3300028794 | Bacteria | 7690 |
| 298 | Ga0265338_10000393 | 3300028800 | Bacteria | 78303 |
| 299 | Ga0265338_10038308 | 3300028800 | Bacteria | 4545 |
| 300 | Ga0265338_10076076 | 3300028800 | Bacteria | 2845 |
| 301 | Ga0265338_10121948 | 3300028800 | Bacteria | 2076 |
| 302 | Ga0265338_10159013 | 3300028800 | Bacteria | 1747 |
| 303 | Ga0265324_10031494 | 3300029957 | Bacteria | 1857 |
| 304 | Ga0307511_10019931 | 3300030521 | Bacteria | 6367 |
| 305 | Ga0265340_10037300 | 3300031247 | Bacteria | 2408 |
| 306 | Ga0265327_10000525 | 3300031251 | Bacteria | 66250 |
| 307 | Ga0265327_10000998 | 3300031251 | Bacteria | 40192 |
| 308 | Ga0265327_10002139 | 3300031251 | Bacteria | 21826 |
| 309 | Ga0307513_10000856 | 3300031456 | Bacteria | 44279 |
| 310 | Ga0307513_10006491 | 3300031456 | Bacteria | 15275 |
| 311 | Ga0307513_10008912 | 3300031456 | Bacteria | 12755 |
| 312 | Ga0307513_10009474 | 3300031456 | Bacteria | 12316 |
| 313 | Ga0307513_10431032 | 3300031456 | Bacteria | 1047 |
| 314 | Ga0307408_100012797 | 3300031548 | Bacteria | 5563 |
| 315 | Ga0307408_100016161 | 3300031548 | Bacteria | 4976 |
| 316 | Ga0307408_100030506 | 3300031548 | Bacteria | 3745 |
| 317 | Ga0307408_100150163 | 3300031548 | Bacteria | 1838 |
| 318 | Ga0307516_10000154 | 3300031730 | Bacteria | 85753 |
| 319 | Ga0307405_10060255 | 3300031731 | Bacteria | 2394 |
| 320 | Ga0307405_10061773 | 3300031731 | Bacteria | 2369 |
| 321 | Ga0307405_10069541 | 3300031731 | Bacteria | 2257 |
| 322 | Ga0307413_10029163 | 3300031824 | Bacteria | 3083 |
| 323 | Ga0307413_10200539 | 3300031824 | Bacteria | 1441 |
| 324 | Ga0307413_10233552 | 3300031824 | Bacteria | 1352 |
| 325 | Ga0307410_10004398 | 3300031852 | Bacteria | 7280 |
| 326 | Ga0307410_10362203 | 3300031852 | Bacteria | 1161 |
| 327 | Ga0307410_10372764 | 3300031852 | Unclassified | 1146 |
| 328 | Ga0307410_10595615 | 3300031852 | Bacteria | 921 |
| 329 | Ga0307406_10090299 | 3300031901 | Bacteria | 2061 |
| 330 | Ga0307406_10136120 | 3300031901 | Bacteria | 1731 |
| 331 | Ga0307406_10340398 | 3300031901 | Bacteria | 1168 |
| 332 | Ga0307407_10002410 | 3300031903 | Bacteria | 7310 |
| 333 | Ga0307407_10044779 | 3300031903 | Bacteria | 2496 |
| 334 | Ga0307412_10008188 | 3300031911 | Bacteria | 5959 |
| 335 | Ga0307412_10028012 | 3300031911 | Bacteria | 3520 |
| 336 | Ga0307409_100008921 | 3300031995 | Bacteria | 6124 |
| 337 | Ga0307409_100315718 | 3300031995 | Unclassified | 1460 |
| 338 | Ga0307409_100404387 | 3300031995 | Bacteria | 1305 |
| 339 | Ga0307416_100011899 | 3300032002 | Bacteria | 5836 |
| 340 | Ga0307416_100021809 | 3300032002 | Bacteria | 4607 |
| 341 | Ga0307416_100153594 | 3300032002 | Bacteria | 2115 |
| 342 | Ga0307414_10030100 | 3300032004 | Bacteria | 3542 |
| 343 | Ga0307414_10030170 | 3300032004 | Bacteria | 3539 |
| 344 | Ga0307414_10068341 | 3300032004 | Bacteria | 2549 |
| 345 | Ga0307414_10084627 | 3300032004 | Bacteria | 2333 |
| 346 | Ga0307414_10107210 | 3300032004 | Bacteria | 2116 |
| 347 | Ga0307414_10131123 | 3300032004 | Bacteria | 1946 |
| 348 | Ga0307414_10279377 | 3300032004 | Bacteria | 1402 |
| 349 | Ga0307414_10292151 | 3300032004 | Bacteria | 1374 |
| 350 | Ga0307414_10481680 | 3300032004 | Bacteria | 1094 |
| 351 | Ga0307414_10504936 | 3300032004 | Bacteria | 1070 |
| 352 | Ga0307414_10625208 | 3300032004 | Bacteria | 968 |
| 353 | Ga0307411_10048064 | 3300032005 | Bacteria | 2763 |
| 354 | Ga0307411_10127110 | 3300032005 | Bacteria | 1856 |
| 355 | Ga0307411_10638003 | 3300032005 | Bacteria | 920 |
| 356 | Ga0307415_100010695 | 3300032126 | Bacteria | 5210 |
| 357 | Ga0307415_100134890 | 3300032126 | Bacteria | 1875 |
| 358 | Ga0307510_10045878 | 3300033180 | Bacteria | 4708 |
| 359 | Ga0307510_10085000 | 3300033180 | Bacteria | 3044 |
| 360 | Ga0373944_0086867 | 3300035089 | Bacteria | 1040 |
| 361 | Ga0373923_0048700 | 3300035111 | Bacteria | 1770 |
| 362 | Ga0373936_0002829 | 3300035113 | Bacteria | 6472 |
| 363 | Ga0373936_0036367 | 3300035113 | Bacteria | 1963 |
| 364 | Ga0373953_0134639 | 3300035117 | Bacteria | 1055 |
| 365 | Ga0373943_0247930 | 3300035170 | Bacteria | 999 |
| 366 | Ga0373946_0028601 | 3300035171 | Bacteria | 2212 |
| 367 | Ga0373946_0051928 | 3300035171 | Bacteria | 1717 |
| 368 | Ga0373935_0001033 | 3300035692 | Bacteria | 15137 |
| 369 | Ga0373935_0057146 | 3300035692 | Bacteria | 2489 |
| 370 | Ga0373927_0002069 | 3300035695 | Bacteria | 14824 |
| 371 | Ga0373927_0013172 | 3300035695 | Bacteria | 5500 |
| 372 | Ga0373933_0039652 | 3300035724 | Bacteria | 2772 |
| 373 | Ga0373933_0376234 | 3300035724 | Bacteria | 925 |
| 374 | Ga0373947_0000940 | 3300035725 | Bacteria | 17726 |
| 375 | Ga0373947_0247322 | 3300035725 | Bacteria | 1178 |
| 376 | Ga0373937_0338970 | 3300036401 | Bacteria | 1424 |
| 377 | Ga0373925_0000380 | 3300037068 | Bacteria | 46083 |
| 378 | Ga0373925_0001317 | 3300037068 | Bacteria | 21738 |
| 379 | Ga0395899_0000100 | 3300037312 | Bacteria | 151710 |
| 380 | Ga0395899_0000251 | 3300037312 | Bacteria | 71228 |
| 381 | Ga0395899_0427810 | 3300037312 | Bacteria | 871 |
| 382 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 383 | Ga0395900_0000084 | 3300037418 | Bacteria | 172593 |
| 384 | Ga0395900_0053314 | 3300037418 | Bacteria | 4162 |
| 385 | Ga0395900_0062202 | 3300037418 | Bacteria | 3837 |
| 386 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 387 | Ga0395898_0007526 | 3300037466 | Bacteria | 11574 |
| 388 | Ga0395898_0114090 | 3300037466 | Bacteria | 2589 |
| 389 | Ga0395898_0477877 | 3300037466 | Bacteria | 1186 |
| 390 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 391 | Ga0395905_0019183 | 3300037471 | Bacteria | 6485 |
| 392 | Ga0395905_0200845 | 3300037471 | Bacteria | 1869 |
| 393 | Ga0436364_0357555 | 3300037853 | Bacteria | 2930 |
| 394 | Ga0436364_0537472 | 3300037853 | Bacteria | 1476 |
| 395 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 396 | Ga0395901_0009640 | 3300038443 | Bacteria | 9795 |
| 397 | Ga0395901_0491127 | 3300038443 | Bacteria | 1251 |
| 398 | Ga0436365_0042009 | 3300039437 | Bacteria | 49154 |
| 399 | Ga0436365_0478530 | 3300039437 | Bacteria | 3253 |
| 400 | Ga0436365_1871972 | 3300039437 | Bacteria | 3710 |
| 401 | Ga0436360_0388057 | 3300039438 | Bacteria | 946 |
| 402 | Ga0436360_1174836 | 3300039438 | Bacteria | 1278 |
| 403 | Ga0436361_0139917 | 3300039447 | Bacteria | 13997 |
| 404 | Ga0436363_1278549 | 3300039450 | Bacteria | 786 |
| 405 | Ga0439461_0015626 | 3300041410 | Bacteria | 1456 |
| 406 | Ga0439465_0028587 | 3300041413 | Bacteria | 1769 |
| 407 | Ga0451793_0789003 | 3300041452 | Bacteria | 1275 |
| 408 | Ga0451804_0466473 | 3300041463 | Bacteria | 831 |
| 409 | Ga0439433_0013436 | 3300041999 | Bacteria | 1798 |
| 410 | Ga0439441_004484 | 3300042001 | Bacteria | 2119 |
| 411 | Ga0439443_009465 | 3300042003 | Bacteria | 1397 |
| 412 | Ga0439456_021541 | 3300042013 | Bacteria | 1364 |
| 413 | Ga0450912_010423 | 3300042116 | Bacteria | 796 |
| 414 | Ga0450923_015668 | 3300042125 | Bacteria | 1420 |
| 415 | Ga0450895_000202 | 3300042132 | Bacteria | 2943 |
| 416 | Ga0450896_001567 | 3300042133 | Bacteria | 2844 |
| 417 | Ga0450896_013424 | 3300042133 | Bacteria | 1165 |
| 418 | Ga0450898_016893 | 3300042134 | Bacteria | 1250 |
| 419 | Ga0450910_008678 | 3300042147 | Bacteria | 1431 |
| 420 | Ga0439446_0001545 | 3300042156 | Bacteria | 5277 |
| 421 | Ga0450908_003099 | 3300042184 | Bacteria | 3232 |
| 422 | Ga0450908_003553 | 3300042184 | Bacteria | 3037 |
| 423 | Ga0439434_0004123 | 3300042435 | Bacteria | 4246 |
| 424 | Ga0439435_0001364 | 3300042436 | Bacteria | 4472 |
| 425 | Ga0450918_004852 | 3300042531 | Bacteria | 2433 |
| 426 | Ga0450918_009143 | 3300042531 | Bacteria | 1740 |
| 427 | Ga0466965_0070402 | 3300044683 | Bacteria | 1758 |
| 428 | Ga0466958_0466795 | 3300045836 | Bacteria | 818 |
| 429 | Ga0466967_0027665 | 3300045976 | Bacteria | 4719 |
| 430 | Ga0495617_146954 | 3300046452 | Bacteria | 751 |
| 431 | Ga0495627_000679 | 3300046453 | Bacteria | 26196 |
| 432 | Ga0495592_0017678 | 3300046454 | Bacteria | 5418 |
| 433 | Ga0495603_0019746 | 3300046455 | Bacteria | 4079 |
| 434 | Ga0495590_0001078 | 3300046457 | Bacteria | 12019 |
| 435 | Ga0495638_0000410 | 3300046460 | Bacteria | 52445 |
| 436 | Ga0495638_0000579 | 3300046460 | Bacteria | 41378 |
| 437 | Ga0495638_0002568 | 3300046460 | Bacteria | 14695 |
| 438 | Ga0495638_0006216 | 3300046460 | Bacteria | 8717 |
| 439 | Ga0495638_0077710 | 3300046460 | Bacteria | 2020 |
| 440 | Ga0495641_0003365 | 3300046461 | Bacteria | 12005 |
| 441 | Ga0495650_0000269 | 3300046471 | Bacteria | 99675 |
| 442 | Ga0495582_0000528 | 3300046473 | Bacteria | 21108 |
| 443 | Ga0495639_0000044 | 3300046475 | Bacteria | 55019 |
| 444 | Ga0495662_0049212 | 3300046476 | Bacteria | 2034 |
| 445 | Ga0495664_0104697 | 3300046477 | Bacteria | 1705 |
| 446 | Ga0495594_0000351 | 3300046499 | Bacteria | 23112 |
| 447 | Ga0495583_0000029 | 3300046506 | Bacteria | 255536 |
| 448 | Ga0495606_0048734 | 3300046507 | Bacteria | 2783 |
| 449 | Ga0495606_0118206 | 3300046507 | Bacteria | 1590 |
| 450 | Ga0495610_0000225 | 3300046512 | Bacteria | 60452 |
| 451 | Ga0495610_0001127 | 3300046512 | Bacteria | 24387 |
| 452 | Ga0495616_0000160 | 3300046513 | Bacteria | 58888 |
| 453 | Ga0495618_0107808 | 3300046514 | Bacteria | 1784 |
| 454 | Ga0495620_0041011 | 3300046515 | Bacteria | 2033 |
| 455 | Ga0495628_0087630 | 3300046516 | Bacteria | 2413 |
| 456 | Ga0495630_0002975 | 3300046517 | Bacteria | 11767 |
| 457 | Ga0495631_0010545 | 3300046518 | Bacteria | 4569 |
| 458 | Ga0495632_0001474 | 3300046519 | Bacteria | 19561 |
| 459 | Ga0495637_0017261 | 3300046520 | Bacteria | 3368 |
| 460 | Ga0495637_0039278 | 3300046520 | Bacteria | 2044 |
| 461 | Ga0495637_0057569 | 3300046520 | Bacteria | 1605 |
| 462 | Ga0495643_0117928 | 3300046522 | Bacteria | 1343 |
| 463 | Ga0495648_0001017 | 3300046524 | Bacteria | 28697 |
| 464 | Ga0495648_0009026 | 3300046524 | Bacteria | 7783 |
| 465 | Ga0495648_0250447 | 3300046524 | Bacteria | 855 |
| 466 | Ga0495663_0078905 | 3300046525 | Bacteria | 1058 |
| 467 | Ga0495642_0006227 | 3300046528 | Bacteria | 4580 |
| 468 | Ga0495642_0135809 | 3300046528 | Bacteria | 1060 |
| 469 | Ga0495652_0102548 | 3300046529 | Bacteria | 2318 |
| 470 | Ga0495654_0000123 | 3300046530 | Bacteria | 86159 |
| 471 | Ga0495654_0070310 | 3300046530 | Bacteria | 1660 |
| 472 | Ga0495665_0000397 | 3300046531 | Bacteria | 22124 |
| 473 | Ga0495640_0010991 | 3300046533 | Bacteria | 6973 |
| 474 | Ga0495609_0060471 | 3300046538 | Bacteria | 1675 |
| 475 | Ga0495597_0023219 | 3300046542 | Bacteria | 2870 |
| 476 | Ga0495622_0001316 | 3300046557 | Bacteria | 12733 |
| 477 | Ga0495622_0004304 | 3300046557 | Bacteria | 6630 |
| 478 | Ga0495633_0005300 | 3300046558 | Bacteria | 7929 |
| 479 | Ga0495667_0062069 | 3300046559 | Bacteria | 2449 |
| 480 | Ga0495668_0000014 | 3300046616 | Bacteria | 442055 |
| 481 | Ga0495668_0008784 | 3300046616 | Bacteria | 6263 |
| 482 | Ga0495668_0023540 | 3300046616 | Bacteria | 3510 |
| 483 | Ga0495668_0119174 | 3300046616 | Bacteria | 1443 |
| 484 | Ga0495668_0190222 | 3300046616 | Bacteria | 1124 |
| 485 | Ga0495668_0308982 | 3300046616 | Bacteria | 867 |
| 486 | Ga0495634_0000252 | 3300046642 | Bacteria | 50709 |
| 487 | Ga0495611_0015649 | 3300046648 | Bacteria | 3242 |
| 488 | Ga0495625_0000816 | 3300046660 | Bacteria | 42972 |
| 489 | Ga0495625_0016984 | 3300046660 | Bacteria | 5707 |
| 490 | Ga0495625_0039662 | 3300046660 | Bacteria | 3437 |
| 491 | Ga0495625_0073606 | 3300046660 | Bacteria | 2394 |
| 492 | Ga0495625_0076704 | 3300046660 | Bacteria | 2336 |
| 493 | Ga0495625_0250084 | 3300046660 | Bacteria | 1151 |
| 494 | Ga0495625_0328611 | 3300046660 | Bacteria | 972 |
| 495 | Ga0495625_0388926 | 3300046660 | Bacteria | 873 |
| 496 | Ga0495635_0001901 | 3300046663 | Bacteria | 14193 |
| 497 | Ga0495588_0016278 | 3300046674 | Bacteria | 3593 |
| 498 | Ga0495647_0004913 | 3300046681 | Bacteria | 4374 |
| 499 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 500 | Ga0495669_0000739 | 3300046684 | Bacteria | 14058 |
| 501 | Ga0495669_0148706 | 3300046684 | Bacteria | 1108 |
| 502 | Ga0495613_0000505 | 3300046689 | Bacteria | 32926 |
| 503 | Ga0495613_0002632 | 3300046689 | Bacteria | 13497 |
| 504 | Ga0495624_0002748 | 3300046690 | Bacteria | 13214 |
| 505 | Ga0495670_0202800 | 3300046691 | Bacteria | 1051 |
| 506 | Ga0495589_0165085 | 3300046794 | Bacteria | 1054 |
| 507 | Ga0495660_0005019 | 3300046810 | Bacteria | 7962 |
| 508 | Ga0495581_0001351 | 3300047315 | Bacteria | 13558 |
| 509 | Ga0495674_0003317 | 3300047319 | Bacteria | 15641 |
| 510 | Ga0495672_0001824 | 3300047320 | Bacteria | 20383 |
| 511 | Ga0495672_0049555 | 3300047320 | Bacteria | 2485 |
| 512 | Ga0495676_0034005 | 3300047321 | Bacteria | 4282 |
| 513 | Ga0495687_032417 | 3300047443 | Bacteria | 2385 |
| 514 | Ga0495677_0067308 | 3300047445 | Bacteria | 1333 |
| 515 | Ga0495677_0072055 | 3300047445 | Bacteria | 1288 |
| 516 | Ga0495673_0000094 | 3300047469 | Bacteria | 183868 |
| 517 | Ga0495673_0000461 | 3300047469 | Bacteria | 44189 |
| 518 | Ga0495673_0002213 | 3300047469 | Bacteria | 14001 |
| 519 | Ga0495686_0000825 | 3300047472 | Bacteria | 39868 |
| 520 | Ga0495686_0008370 | 3300047472 | Bacteria | 7593 |
| 521 | Ga0495686_0014578 | 3300047472 | Bacteria | 5407 |
| 522 | Ga0495686_0024859 | 3300047472 | Bacteria | 3930 |
| 523 | Ga0495686_0055016 | 3300047472 | Bacteria | 2490 |
| 524 | Ga0495686_0102508 | 3300047472 | Bacteria | 1724 |
| 525 | Ga0495686_0204304 | 3300047472 | Bacteria | 1132 |
| 526 | Ga0495593_0009579 | 3300047673 | Bacteria | 5623 |
| 527 | Ga0495602_0549830 | 3300048088 | Bacteria | 800 |
| 528 | Ga0495614_0032524 | 3300048089 | Bacteria | 2245 |
| 529 | Ga0495615_0010390 | 3300048090 | Bacteria | 1859 |
| 530 | Ga0496101_0114088 | 3300048904 | Bacteria | 2037 |
| 531 | Ga0496102_0017868 | 3300048905 | Bacteria | 6220 |
| 532 | Ga0496102_0166327 | 3300048905 | Bacteria | 2075 |
| 533 | Ga0496102_0305549 | 3300048905 | Bacteria | 1499 |
| 534 | Ga0496103_0429472 | 3300048906 | Bacteria | 848 |
| 535 | Ga0496106_0042247 | 3300048909 | Bacteria | 3419 |
| 536 | Ga0496106_0641039 | 3300048909 | Bacteria | 849 |
| 537 | Ga0496107_0000349 | 3300048910 | Bacteria | 25181 |
| 538 | Ga0496107_0073438 | 3300048910 | Bacteria | 2488 |
| 539 | Ga0496108_0126721 | 3300048911 | Bacteria | 2192 |
| 540 | Ga0496108_0629361 | 3300048911 | Bacteria | 934 |
| 541 | Ga0496108_0815728 | 3300048911 | Bacteria | 804 |
| 542 | Ga0496109_0015380 | 3300048912 | Bacteria | 6668 |
| 543 | Ga0496110_0220212 | 3300048913 | Bacteria | 1726 |
| 544 | Ga0496112_0267968 | 3300048915 | Bacteria | 1656 |
| 545 | Ga0496112_0617383 | 3300048915 | Bacteria | 1015 |
| 546 | Ga0496113_0305916 | 3300048916 | Bacteria | 1273 |
| 547 | Ga0496115_0000450 | 3300048918 | Bacteria | 33063 |
| 548 | Ga0496115_0003100 | 3300048918 | Bacteria | 11940 |
| 549 | Ga0496116_0011917 | 3300048919 | Bacteria | 7147 |
| 550 | Ga0496117_0013087 | 3300048920 | Bacteria | 7264 |
| 551 | Ga0496119_0030141 | 3300048922 | Bacteria | 3664 |
| 552 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 553 | Ga0496121_0034294 | 3300048924 | Bacteria | 4570 |
| 554 | Ga0496121_0053001 | 3300048924 | Bacteria | 3401 |
| 555 | Ga0496122_0037841 | 3300048925 | Bacteria | 3876 |
| 556 | Ga0496122_0215371 | 3300048925 | Bacteria | 1108 |
| 557 | Ga0496123_0001110 | 3300048926 | Bacteria | 40337 |
| 558 | Ga0496124_0014468 | 3300048927 | Bacteria | 7628 |
| 559 | Ga0496125_0000598 | 3300048928 | Bacteria | 61438 |
| 560 | Ga0496125_0023238 | 3300048928 | Bacteria | 5728 |
| 561 | Ga0496125_0050843 | 3300048928 | Bacteria | 3426 |
| 562 | Ga0496125_0183100 | 3300048928 | Bacteria | 1393 |
| 563 | Ga0496126_0006062 | 3300048929 | Bacteria | 13569 |
| 564 | Ga0496126_0494994 | 3300048929 | Bacteria | 978 |
| 565 | Ga0495678_000723 | 3300049459 | Bacteria | 29969 |
| 566 | Ga0501032_0051544 | 3300049569 | Bacteria | 2775 |
| 567 | Ga0501033_0002932 | 3300049570 | Bacteria | 14266 |
| 568 | Ga0501033_0058011 | 3300049570 | Bacteria | 2860 |
| 569 | Ga0501034_0049189 | 3300049571 | Bacteria | 4254 |
| 570 | Ga0501034_0198238 | 3300049571 | Bacteria | 1967 |
| 571 | Ga0501036_0214694 | 3300049572 | Bacteria | 1616 |
| 572 | Ga0501036_0353676 | 3300049572 | Bacteria | 1227 |
| 573 | Ga0501037_0138129 | 3300049573 | Bacteria | 1745 |
| 574 | Ga0501037_0161542 | 3300049573 | Bacteria | 1597 |
| 575 | Ga0501039_0257411 | 3300049575 | Bacteria | 1372 |
| 576 | Ga0501040_0330863 | 3300049576 | Bacteria | 1090 |
| 577 | Ga0501042_0275588 | 3300049578 | Bacteria | 1215 |
| 578 | Ga0501043_0510388 | 3300049579 | Bacteria | 897 |
| 579 | Ga0501046_0227479 | 3300049580 | Bacteria | 1379 |
| 580 | Ga0501047_0000790 | 3300049581 | Bacteria | 33132 |
| 581 | Ga0501047_0122348 | 3300049581 | Bacteria | 2484 |
| 582 | Ga0501047_0123297 | 3300049581 | Bacteria | 2472 |
| 583 | Ga0501047_0311271 | 3300049581 | Bacteria | 1415 |
| 584 | Ga0501047_0390664 | 3300049581 | Bacteria | 1225 |
| 585 | Ga0501047_0474535 | 3300049581 | Bacteria | 1079 |
| 586 | Ga0501067_0047740 | 3300049583 | Bacteria | 2375 |
| 587 | Ga0501069_0040201 | 3300049585 | Bacteria | 2585 |
| 588 | Ga0501072_0033810 | 3300049588 | Bacteria | 4006 |
| 589 | Ga0501073_0093747 | 3300049589 | Bacteria | 2086 |
| 590 | Ga0501074_0046448 | 3300049590 | Bacteria | 3140 |
| 591 | Ga0501080_0008405 | 3300049742 | Bacteria | 9349 |
| 592 | Ga0501083_0116867 | 3300049744 | Bacteria | 1751 |
| 593 | Ga0501035_0156068 | 3300049822 | Bacteria | 1978 |
| 594 | Ga0501044_0001087 | 3300049823 | Bacteria | 32422 |
| 595 | Ga0501044_0019170 | 3300049823 | Bacteria | 7323 |
| 596 | Ga0501044_0114986 | 3300049823 | Bacteria | 2696 |
| 597 | nmdc:mga03683_16002_c1 | 3300050489 | Bacteria | 2117 |
| 598 | nmdc:mga03n38_65448_c1 | 3300050490 | Bacteria | 1667 |
| 599 | nmdc:mga00v17_2096_c1 | 3300050491 | Bacteria | 10260 |
| 600 | nmdc:mga0k408_18392_c1 | 3300050493 | Bacteria | 3901 |
| 601 | nmdc:mga04h51_30748_c1 | 3300050495 | Bacteria | 1692 |
| 602 | nmdc:mga07m45_17228_c1 | 3300050496 | Bacteria | 3877 |
| 603 | nmdc:mga07m45_212359_c1 | 3300050496 | Bacteria | 1126 |
| 604 | nmdc:mga07m45_31708_c1 | 3300050496 | Bacteria | 2929 |
| 605 | Ga0500635_0000288 | 3300053080 | Bacteria | 18543 |
| 606 | Ga0500578_0001050 | 3300053086 | Bacteria | 30142 |
| 607 | Ga0500578_0288190 | 3300053086 | Bacteria | 977 |
| 608 | Ga0500643_001504 | 3300053087 | Bacteria | 13345 |
| 609 | Ga0500643_001586 | 3300053087 | Bacteria | 12865 |
| 610 | Ga0500643_001950 | 3300053087 | Bacteria | 11190 |
| 611 | Ga0500643_008450 | 3300053087 | Bacteria | 4042 |
| 612 | Ga0500643_010475 | 3300053087 | Bacteria | 3448 |
| 613 | Ga0500644_0000261 | 3300053088 | Bacteria | 29859 |
| 614 | Ga0500646_0115185 | 3300053090 | Bacteria | 859 |
| 615 | Ga0500583_0043556 | 3300053092 | Bacteria | 2051 |
| 616 | Ga0500583_0255370 | 3300053092 | Bacteria | 865 |
| 617 | Ga0500566_0151246 | 3300053094 | Bacteria | 1220 |
| 618 | Ga0500566_0197638 | 3300053094 | Bacteria | 1018 |
| 619 | Ga0500641_0000646 | 3300053096 | Bacteria | 12569 |
| 620 | Ga0500641_0006915 | 3300053096 | Bacteria | 4034 |
| 621 | Ga0500554_002053 | 3300053102 | Bacteria | 3900 |
| 622 | Ga0500555_000871 | 3300053103 | Bacteria | 10753 |
| 623 | Ga0500556_0000583 | 3300053104 | Bacteria | 24043 |
| 624 | Ga0500556_0002738 | 3300053104 | Bacteria | 5438 |
| 625 | Ga0500556_0003686 | 3300053104 | Bacteria | 4456 |
| 626 | Ga0500556_0027079 | 3300053104 | Bacteria | 1911 |
| 627 | Ga0500556_0115541 | 3300053104 | Bacteria | 1044 |
| 628 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 629 | Ga0500562_000833 | 3300053108 | Bacteria | 7485 |
| 630 | Ga0500562_001521 | 3300053108 | Bacteria | 5735 |
| 631 | Ga0500562_002292 | 3300053108 | Bacteria | 4795 |
| 632 | Ga0500562_005155 | 3300053108 | Bacteria | 3283 |
| 633 | Ga0500562_016591 | 3300053108 | Bacteria | 1894 |
| 634 | Ga0500572_000035 | 3300053111 | Bacteria | 42615 |
| 635 | Ga0500594_0000084 | 3300053118 | Bacteria | 28710 |
| 636 | Ga0500595_003680 | 3300053119 | Bacteria | 7081 |
| 637 | Ga0500595_008288 | 3300053119 | Bacteria | 4253 |
| 638 | Ga0500595_022228 | 3300053119 | Bacteria | 2249 |
| 639 | Ga0500597_056673 | 3300053120 | Bacteria | 1678 |
| 640 | Ga0500597_203053 | 3300053120 | Bacteria | 831 |
| 641 | Ga0500607_094802 | 3300053121 | Bacteria | 1494 |
| 642 | Ga0500608_000101 | 3300053122 | Bacteria | 34992 |
| 643 | Ga0500608_001518 | 3300053122 | Bacteria | 8300 |
| 644 | Ga0500614_001563 | 3300053123 | Bacteria | 5417 |
| 645 | Ga0500614_016705 | 3300053123 | Bacteria | 1650 |
| 646 | Ga0500618_000255 | 3300053125 | Bacteria | 41984 |
| 647 | Ga0500642_0000170 | 3300053130 | Bacteria | 26891 |
| 648 | Ga0500652_111389 | 3300053131 | Bacteria | 1144 |
| 649 | Ga0500655_023857 | 3300053133 | Bacteria | 1157 |
| 650 | Ga0500658_0040526 | 3300053134 | Bacteria | 1865 |
| 651 | Ga0500559_0000035 | 3300053136 | Bacteria | 110851 |
| 652 | Ga0500559_0000243 | 3300053136 | Bacteria | 43046 |
| 653 | Ga0500559_0003669 | 3300053136 | Bacteria | 7498 |
| 654 | Ga0500559_0008182 | 3300053136 | Bacteria | 4598 |
| 655 | Ga0500559_0026157 | 3300053136 | Bacteria | 2484 |
| 656 | Ga0500559_0334722 | 3300053136 | Bacteria | 709 |
| 657 | Ga0500564_000062 | 3300053138 | Bacteria | 29161 |
| 658 | Ga0500577_0001545 | 3300053142 | Bacteria | 5872 |
| 659 | Ga0500577_0125666 | 3300053142 | Bacteria | 1071 |
| 660 | Ga0500590_019664 | 3300053148 | Bacteria | 3501 |
| 661 | Ga0500604_0117237 | 3300053151 | Bacteria | 888 |
| 662 | Ga0500616_0001309 | 3300053153 | Bacteria | 24602 |
| 663 | Ga0500616_0022947 | 3300053153 | Bacteria | 3481 |
| 664 | Ga0500622_0001061 | 3300053156 | Bacteria | 22910 |
| 665 | Ga0500622_0002619 | 3300053156 | Bacteria | 12798 |
| 666 | Ga0500622_0003125 | 3300053156 | Bacteria | 11383 |
| 667 | Ga0500622_0006366 | 3300053156 | Bacteria | 6875 |
| 668 | Ga0500622_0016359 | 3300053156 | Bacteria | 3964 |
| 669 | Ga0500622_0042460 | 3300053156 | Bacteria | 2362 |
| 670 | Ga0500622_0127640 | 3300053156 | Bacteria | 1226 |
| 671 | Ga0500627_0217706 | 3300053158 | Bacteria | 853 |
| 672 | Ga0500637_0137549 | 3300053178 | Bacteria | 1414 |
| 673 | Ga0500637_0201334 | 3300053178 | Bacteria | 1133 |
| 674 | Ga0500576_041884 | 3300053725 | Bacteria | 2058 |
| 675 | Ga0500625_009359 | 3300053729 | Bacteria | 4369 |
| 676 | Ga0500625_016435 | 3300053729 | Bacteria | 3446 |
| 677 | Ga0500645_000433 | 3300053730 | Bacteria | 28666 |
| 678 | Ga0500645_001713 | 3300053730 | Bacteria | 10672 |
| 679 | Ga0500645_002033 | 3300053730 | Bacteria | 9436 |
| 680 | Ga0500645_003312 | 3300053730 | Bacteria | 6620 |
| 681 | Ga0500645_015734 | 3300053730 | Bacteria | 2392 |
| 682 | Ga0500609_000644 | 3300053731 | Bacteria | 5311 |
| 683 | Ga0501084_0137919 | 3300054114 | Bacteria | 2053 |
| 684 | Ga0501082_0041303 | 3300060353 | Bacteria | 3976 |
| 685 | Ga0501082_0087090 | 3300060353 | Bacteria | 2694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10372764 | Ga0307410_103727642 | 189 |
| 2 | 3300031901 | Ga0307406_10090299 | Ga0307406_100902992 | 189 |
| 3 | 3300049575 | Ga0501039_0257411 | Ga0501039_0257411_354_926 | 189 |
| 4 | 3300049578 | Ga0501042_0275588 | Ga0501042_0275588_213_785 | 189 |
| 5 | 3300032005 | Ga0307411_10127110 | Ga0307411_101271103 | 202 |
| 6 | 3300049576 | Ga0501040_0330863 | Ga0501040_0330863_325_996 | 204 |
| 7 | 3300039438 | Ga0436360_0388057 | Ga0436360_0388057_195_824 | 209 |
| 8 | 3300005341 | Ga0070691_10081842 | Ga0070691_100818422 | 210 |
| 9 | 3300013306 | Ga0163162_10687387 | Ga0163162_106873872 | 210 |
| 10 | 3300025921 | Ga0207652_10097512 | Ga0207652_100975122 | 210 |
| 11 | 3300025924 | Ga0207694_10110731 | Ga0207694_101107312 | 210 |
| 12 | 3300027462 | Ga0210000_1007493 | Ga0210000_10074932 | 210 |
| 13 | 3300027665 | Ga0209983_1007314 | Ga0209983_10073143 | 210 |
| 14 | 3300048090 | Ga0495615_0010390 | Ga0495615_0010390_23_655 | 210 |
| 15 | 3300048911 | Ga0496108_0815728 | Ga0496108_0815728_71_730 | 210 |
| 16 | 3300048915 | Ga0496112_0267968 | Ga0496112_0267968_56_688 | 210 |
| 17 | 3300048928 | Ga0496125_0050843 | Ga0496125_0050843_1903_2562 | 210 |
| 18 | 3300049572 | Ga0501036_0214694 | Ga0501036_0214694_488_1120 | 210 |
| 19 | 3300049580 | Ga0501046_0227479 | Ga0501046_0227479_646_1278 | 210 |
| 20 | 3300049581 | Ga0501047_0000790 | Ga0501047_0000790_14041_14673 | 210 |
| 21 | iso_pu_bacteria | 2643221663 | 2644352107 | 210 |
| 22 | iso_pu_bacteria | 2941485952 | 2941487336 | 210 |
| 23 | 3300005334 | Ga0068869_100521118 | Ga0068869_1005211182 | 211 |
| 24 | 3300009093 | Ga0105240_10002167 | Ga0105240_100021676 | 211 |
| 25 | 3300013104 | Ga0157370_10318028 | Ga0157370_103180282 | 211 |
| 26 | 3300021384 | Ga0213876_10000129 | Ga0213876_1000012912 | 211 |
| 27 | 3300021388 | Ga0213875_10066582 | Ga0213875_100665823 | 211 |
| 28 | 3300025942 | Ga0207689_10018685 | Ga0207689_100186851 | 211 |
| 29 | 3300026078 | Ga0207702_10305214 | Ga0207702_103052142 | 211 |
| 30 | 3300037853 | Ga0436364_0357555 | Ga0436364_0357555_1305_1943 | 211 |
| 31 | 3300039437 | Ga0436365_0042009 | Ga0436365_0042009_23006_23644 | 211 |
| 32 | 3300046558 | Ga0495633_0005300 | Ga0495633_0005300_462_1097 | 211 |
| 33 | 3300049570 | Ga0501033_0058011 | Ga0501033_0058011_218_856 | 211 |
| 34 | 3300049573 | Ga0501037_0161542 | Ga0501037_0161542_369_1007 | 211 |
| 35 | 3300049579 | Ga0501043_0510388 | Ga0501043_0510388_155_793 | 211 |
| 36 | 3300049581 | Ga0501047_0311271 | Ga0501047_0311271_108_746 | 211 |
| 37 | 3300049581 | Ga0501047_0474535 | Ga0501047_0474535_428_1069 | 211 |
| 38 | 3300049822 | Ga0501035_0156068 | Ga0501035_0156068_536_1174 | 211 |
| 39 | 3300049823 | Ga0501044_0001087 | Ga0501044_0001087_23660_24298 | 211 |
| 40 | iso_pu_bacteria | 2643221598 | 2644000394 | 211 |
| 41 | iso_pu_bacteria | 2643221614 | 2644084843 | 211 |
| 42 | iso_pu_bacteria | 2643221661 | 2644342395 | 211 |
| 43 | iso_pu_bacteria | 2643221666 | 2644365695 | 211 |
| 44 | 3300006846 | Ga0075430_100029675 | Ga0075430_1000296755 | 212 |
| 45 | 3300013104 | Ga0157370_10017504 | Ga0157370_100175045 | 212 |
| 46 | 3300013105 | Ga0157369_10132230 | Ga0157369_101322303 | 212 |
| 47 | 3300028556 | Ga0265337_1035268 | Ga0265337_10352681 | 212 |
| 48 | 3300028800 | Ga0265338_10038308 | Ga0265338_100383086 | 212 |
| 49 | 3300028800 | Ga0265338_10121948 | Ga0265338_101219483 | 212 |
| 50 | 3300032004 | Ga0307414_10504936 | Ga0307414_105049362 | 212 |
| 51 | 3300035692 | Ga0373935_0057146 | Ga0373935_0057146_1743_2381 | 212 |
| 52 | 3300035725 | Ga0373947_0247322 | Ga0373947_0247322_74_712 | 212 |
| 53 | 3300048925 | Ga0496122_0037841 | Ga0496122_0037841_1932_2570 | 212 |
| 54 | 3300048926 | Ga0496123_0001110 | Ga0496123_0001110_32782_33420 | 212 |
| 55 | 3300005467 | Ga0070706_100005625 | Ga0070706_1000056252 | 213 |
| 56 | 3300005518 | Ga0070699_100006239 | Ga0070699_1000062392 | 213 |
| 57 | 3300005536 | Ga0070697_100010902 | Ga0070697_1000109027 | 213 |
| 58 | 3300005616 | Ga0068852_100185943 | Ga0068852_1001859432 | 213 |
| 59 | 3300026142 | Ga0207698_10140852 | Ga0207698_101408522 | 213 |
| 60 | 3300031548 | Ga0307408_100150163 | Ga0307408_1001501632 | 213 |
| 61 | 3300031731 | Ga0307405_10061773 | Ga0307405_100617733 | 213 |
| 62 | 3300031824 | Ga0307413_10233552 | Ga0307413_102335522 | 213 |
| 63 | 3300031852 | Ga0307410_10595615 | Ga0307410_105956152 | 213 |
| 64 | 3300031911 | Ga0307412_10028012 | Ga0307412_100280124 | 213 |
| 65 | 3300031995 | Ga0307409_100315718 | Ga0307409_1003157182 | 213 |
| 66 | 3300032002 | Ga0307416_100021809 | Ga0307416_1000218094 | 213 |
| 67 | 3300032004 | Ga0307414_10030100 | Ga0307414_100301006 | 213 |
| 68 | 3300032004 | Ga0307414_10030170 | Ga0307414_100301702 | 213 |
| 69 | 3300032004 | Ga0307414_10084627 | Ga0307414_100846272 | 213 |
| 70 | 3300032004 | Ga0307414_10279377 | Ga0307414_102793771 | 213 |
| 71 | 3300032004 | Ga0307414_10481680 | Ga0307414_104816802 | 213 |
| 72 | 3300032004 | Ga0307414_10625208 | Ga0307414_106252081 | 213 |
| 73 | 3300032005 | Ga0307411_10638003 | Ga0307411_106380031 | 213 |
| 74 | 3300032126 | Ga0307415_100010695 | Ga0307415_1000106952 | 213 |
| 75 | 3300037466 | Ga0395898_0477877 | Ga0395898_0477877_322_972 | 213 |
| 76 | 3300039438 | Ga0436360_1174836 | Ga0436360_1174836_184_825 | 213 |
| 77 | 3300039447 | Ga0436361_0139917 | Ga0436361_0139917_2981_3625 | 213 |
| 78 | 3300039450 | Ga0436363_1278549 | Ga0436363_1278549_22_663 | 213 |
| 79 | 3300041410 | Ga0439461_0015626 | Ga0439461_0015626_36_689 | 213 |
| 80 | 3300041999 | Ga0439433_0013436 | Ga0439433_0013436_963_1616 | 213 |
| 81 | 3300042001 | Ga0439441_004484 | Ga0439441_004484_1183_1836 | 213 |
| 82 | 3300042003 | Ga0439443_009465 | Ga0439443_009465_523_1176 | 213 |
| 83 | 3300042013 | Ga0439456_021541 | Ga0439456_021541_618_1271 | 213 |
| 84 | 3300042116 | Ga0450912_010423 | Ga0450912_010423_21_674 | 213 |
| 85 | 3300042125 | Ga0450923_015668 | Ga0450923_015668_126_779 | 213 |
| 86 | 3300042133 | Ga0450896_013424 | Ga0450896_013424_492_1145 | 213 |
| 87 | 3300042134 | Ga0450898_016893 | Ga0450898_016893_420_1073 | 213 |
| 88 | 3300042156 | Ga0439446_0001545 | Ga0439446_0001545_3121_3774 | 213 |
| 89 | 3300042184 | Ga0450908_003099 | Ga0450908_003099_2302_2955 | 213 |
| 90 | 3300042435 | Ga0439434_0004123 | Ga0439434_0004123_1046_1699 | 213 |
| 91 | 3300042436 | Ga0439435_0001364 | Ga0439435_0001364_328_981 | 213 |
| 92 | 3300045836 | Ga0466958_0466795 | Ga0466958_0466795_159_806 | 213 |
| 93 | 3300046684 | Ga0495669_0000739 | Ga0495669_0000739_11096_11737 | 213 |
| 94 | 3300049581 | Ga0501047_0122348 | Ga0501047_0122348_215_865 | 213 |
| 95 | 3300049589 | Ga0501073_0093747 | Ga0501073_0093747_232_879 | 213 |
| 96 | 3300053104 | Ga0500556_0115541 | Ga0500556_0115541_20_679 | 213 |
| 97 | 3300053108 | Ga0500562_016591 | Ga0500562_016591_1222_1863 | 213 |
| 98 | 3300053136 | Ga0500559_0334722 | Ga0500559_0334722_37_690 | 213 |
| 99 | 3300053153 | Ga0500616_0001309 | Ga0500616_0001309_15491_16150 | 213 |
| 100 | 3300053156 | Ga0500622_0127640 | Ga0500622_0127640_403_1062 | 213 |
| 101 | 3300005262 | Ga0065165_1000210 | Ga0065165_1000210101 | 214 |
| 102 | 3300005262 | Ga0065165_1024553 | Ga0065165_10245532 | 214 |
| 103 | 3300005366 | Ga0070659_100000250 | Ga0070659_10000025037 | 214 |
| 104 | 3300005548 | Ga0070665_100066641 | Ga0070665_1000666413 | 214 |
| 105 | 3300005983 | Ga0081540_1007651 | Ga0081540_10076517 | 214 |
| 106 | 3300005983 | Ga0081540_1010892 | Ga0081540_10108926 | 214 |
| 107 | 3300005983 | Ga0081540_1014384 | Ga0081540_10143843 | 214 |
| 108 | 3300014325 | Ga0163163_10126113 | Ga0163163_101261132 | 214 |
| 109 | 3300025931 | Ga0207644_10072980 | Ga0207644_100729802 | 214 |
| 110 | 3300025932 | Ga0207690_10000760 | Ga0207690_1000076013 | 214 |
| 111 | 3300028379 | Ga0268266_10053286 | Ga0268266_100532864 | 214 |
| 112 | 3300028786 | Ga0307517_10026693 | Ga0307517_100266937 | 214 |
| 113 | 3300031456 | Ga0307513_10000856 | Ga0307513_1000085633 | 214 |
| 114 | 3300031456 | Ga0307513_10006491 | Ga0307513_100064915 | 214 |
| 115 | 3300031901 | Ga0307406_10340398 | Ga0307406_103403981 | 214 |
| 116 | 3300032004 | Ga0307414_10068341 | Ga0307414_100683414 | 214 |
| 117 | 3300032004 | Ga0307414_10131123 | Ga0307414_101311233 | 214 |
| 118 | 3300033180 | Ga0307510_10085000 | Ga0307510_100850002 | 214 |
| 119 | 3300037418 | Ga0395900_0062202 | Ga0395900_0062202_2140_2793 | 214 |
| 120 | 3300046616 | Ga0495668_0308982 | Ga0495668_0308982_112_762 | 214 |
| 121 | 3300046648 | Ga0495611_0015649 | Ga0495611_0015649_2278_2928 | 214 |
| 122 | 3300046660 | Ga0495625_0076704 | Ga0495625_0076704_1285_1935 | 214 |
| 123 | 3300046689 | Ga0495613_0000505 | Ga0495613_0000505_15481_16134 | 214 |
| 124 | 3300047320 | Ga0495672_0049555 | Ga0495672_0049555_669_1313 | 214 |
| 125 | 3300047472 | Ga0495686_0204304 | Ga0495686_0204304_350_1000 | 214 |
| 126 | 3300048911 | Ga0496108_0629361 | Ga0496108_0629361_234_884 | 214 |
| 127 | 3300048919 | Ga0496116_0011917 | Ga0496116_0011917_2258_2902 | 214 |
| 128 | 3300048928 | Ga0496125_0000598 | Ga0496125_0000598_21177_21821 | 214 |
| 129 | 3300049572 | Ga0501036_0353676 | Ga0501036_0353676_188_856 | 214 |
| 130 | 3300053087 | Ga0500643_001586 | Ga0500643_001586_2443_3093 | 214 |
| 131 | 3300053096 | Ga0500641_0006915 | Ga0500641_0006915_535_1185 | 214 |
| 132 | 3300053104 | Ga0500556_0002738 | Ga0500556_0002738_605_1255 | 214 |
| 133 | 3300053108 | Ga0500562_001521 | Ga0500562_001521_4976_5626 | 214 |
| 134 | 3300053108 | Ga0500562_002292 | Ga0500562_002292_4076_4726 | 214 |
| 135 | 3300053133 | Ga0500655_023857 | Ga0500655_023857_260_910 | 214 |
| 136 | 3300053151 | Ga0500604_0117237 | Ga0500604_0117237_35_685 | 214 |
| 137 | 3300053153 | Ga0500616_0022947 | Ga0500616_0022947_61_711 | 214 |
| 138 | 3300053156 | Ga0500622_0003125 | Ga0500622_0003125_1195_1845 | 214 |
| 139 | 3300053158 | Ga0500627_0217706 | Ga0500627_0217706_159_809 | 214 |
| 140 | 3300053730 | Ga0500645_000433 | Ga0500645_000433_506_1156 | 214 |
| 141 | 3300053730 | Ga0500645_002033 | Ga0500645_002033_3429_4079 | 214 |
| 142 | 3300003794 | Ga0055531_10033561 | Ga0055531_100335612 | 215 |
| 143 | 3300005331 | Ga0070670_100057708 | Ga0070670_1000577082 | 215 |
| 144 | 3300005339 | Ga0070660_100530192 | Ga0070660_1005301922 | 215 |
| 145 | 3300005347 | Ga0070668_100002210 | Ga0070668_10000221013 | 215 |
| 146 | 3300005347 | Ga0070668_100016286 | Ga0070668_1000162866 | 215 |
| 147 | 3300005366 | Ga0070659_100032958 | Ga0070659_1000329585 | 215 |
| 148 | 3300005367 | Ga0070667_100020319 | Ga0070667_1000203195 | 215 |
| 149 | 3300005539 | Ga0068853_100126552 | Ga0068853_1001265522 | 215 |
| 150 | 3300005539 | Ga0068853_100144638 | Ga0068853_1001446382 | 215 |
| 151 | 3300005618 | Ga0068864_100033979 | Ga0068864_1000339793 | 215 |
| 152 | 3300005841 | Ga0068863_100013356 | Ga0068863_1000133565 | 215 |
| 153 | 3300005843 | Ga0068860_100000145 | Ga0068860_10000014514 | 215 |
| 154 | 3300005843 | Ga0068860_100096149 | Ga0068860_1000961495 | 215 |
| 155 | 3300005844 | Ga0068862_100007746 | Ga0068862_1000077468 | 215 |
| 156 | 3300005844 | Ga0068862_100030692 | Ga0068862_1000306924 | 215 |
| 157 | 3300005844 | Ga0068862_100098213 | Ga0068862_1000982133 | 215 |
| 158 | 3300014497 | Ga0182008_10110733 | Ga0182008_101107332 | 215 |
| 159 | 3300021384 | Ga0213876_10010289 | Ga0213876_100102895 | 215 |
| 160 | 3300025250 | Ga0209026_1001124 | Ga0209026_10011246 | 215 |
| 161 | 3300025304 | Ga0209257_1001456 | Ga0209257_10014566 | 215 |
| 162 | 3300025919 | Ga0207657_10446961 | Ga0207657_104469611 | 215 |
| 163 | 3300025923 | Ga0207681_10011486 | Ga0207681_100114864 | 215 |
| 164 | 3300025925 | Ga0207650_10043649 | Ga0207650_100436492 | 215 |
| 165 | 3300025932 | Ga0207690_10036903 | Ga0207690_100369034 | 215 |
| 166 | 3300025972 | Ga0207668_10009936 | Ga0207668_100099366 | 215 |
| 167 | 3300025972 | Ga0207668_10067141 | Ga0207668_100671414 | 215 |
| 168 | 3300025986 | Ga0207658_10036818 | Ga0207658_100368183 | 215 |
| 169 | 3300026041 | Ga0207639_10016913 | Ga0207639_100169133 | 215 |
| 170 | 3300026088 | Ga0207641_10032627 | Ga0207641_100326275 | 215 |
| 171 | 3300026095 | Ga0207676_10053643 | Ga0207676_100536434 | 215 |
| 172 | 3300028380 | Ga0268265_10000993 | Ga0268265_1000099325 | 215 |
| 173 | 3300028380 | Ga0268265_10006750 | Ga0268265_100067505 | 215 |
| 174 | 3300028380 | Ga0268265_10114078 | Ga0268265_101140784 | 215 |
| 175 | 3300028381 | Ga0268264_10000046 | Ga0268264_1000004662 | 215 |
| 176 | 3300028381 | Ga0268264_10034278 | Ga0268264_100342785 | 215 |
| 177 | 3300028563 | Ga0265319_1073375 | Ga0265319_10733752 | 215 |
| 178 | 3300028786 | Ga0307517_10002627 | Ga0307517_1000262720 | 215 |
| 179 | 3300028800 | Ga0265338_10159013 | Ga0265338_101590132 | 215 |
| 180 | 3300031247 | Ga0265340_10037300 | Ga0265340_100373002 | 215 |
| 181 | 3300031251 | Ga0265327_10002139 | Ga0265327_1000213921 | 215 |
| 182 | 3300031456 | Ga0307513_10009474 | Ga0307513_100094748 | 215 |
| 183 | 3300031995 | Ga0307409_100404387 | Ga0307409_1004043872 | 215 |
| 184 | 3300032004 | Ga0307414_10292151 | Ga0307414_102921512 | 215 |
| 185 | 3300033180 | Ga0307510_10045878 | Ga0307510_100458782 | 215 |
| 186 | 3300037312 | Ga0395899_0427810 | Ga0395899_0427810_202_849 | 215 |
| 187 | 3300039437 | Ga0436365_0478530 | Ga0436365_0478530_1685_2332 | 215 |
| 188 | 3300046452 | Ga0495617_146954 | Ga0495617_146954_23_670 | 215 |
| 189 | 3300047472 | Ga0495686_0024859 | Ga0495686_0024859_2741_3388 | 215 |
| 190 | 3300048918 | Ga0496115_0000450 | Ga0496115_0000450_16840_17487 | 215 |
| 191 | 3300049585 | Ga0501069_0040201 | Ga0501069_0040201_1910_2569 | 215 |
| 192 | 3300053730 | Ga0500645_001713 | Ga0500645_001713_5666_6313 | 215 |
| 193 | 3300060353 | Ga0501082_0041303 | Ga0501082_0041303_216_875 | 215 |
| 194 | iso_pu_bacteria | 2507262055 | 2507509487 | 215 |
| 195 | iso_pu_bacteria | 2935769743 | 2935775863 | 215 |
| 196 | iso_pu_bacteria | 2935777560 | 2935780711 | 215 |
| 197 | iso_pu_bacteria | 2935785616 | 2935791400 | 215 |
| 198 | iso_pu_bacteria | 2935793552 | 2935799724 | 215 |
| 199 | iso_pu_bacteria | 2935908558 | 2935915492 | 215 |
| 200 | iso_pu_bacteria | 2935916978 | 2935921406 | 215 |
| 201 | iso_pu_bacteria | 2935926038 | 2935932909 | 215 |
| 202 | iso_pu_bacteria | 2935934488 | 2935941480 | 215 |
| 203 | iso_pu_bacteria | 2935942939 | 2935949683 | 215 |
| 204 | iso_pu_bacteria | 2935951376 | 2935958378 | 215 |
| 205 | iso_pu_bacteria | 2935967501 | 2935974452 | 215 |
| 206 | iso_pu_bacteria | 8016522445 | 8016530529 | 215 |
| 207 | iso_pu_bacteria | 8016530956 | 8016535806 | 215 |
| 208 | iso_pu_bacteria | 8016539877 | 8016540088 | 215 |
| 209 | iso_pu_bacteria | 8016548790 | 8016553143 | 215 |
| 210 | iso_pu_bacteria | 8016557553 | 8016561525 | 215 |
| 211 | iso_pu_bacteria | 8016566248 | 8016574146 | 215 |
| 212 | iso_pu_bacteria | 8016595262 | 8016599369 | 215 |
| 213 | iso_pu_bacteria | 8016603502 | 8016611668 | 215 |
| 214 | iso_pu_bacteria | 8016613128 | 8016622131 | 215 |
| 215 | iso_pu_bacteria | 8016622563 | 8016627717 | 215 |
| 216 | iso_pu_bacteria | 8019530166 | 8019535535 | 215 |
| 217 | iso_pu_bacteria | 8019538911 | 8019543946 | 215 |
| 218 | iso_pu_bacteria | 8019547302 | 8019554823 | 215 |
| 219 | iso_pu_bacteria | 8019687851 | 8019689037 | 215 |
| 220 | 3300003791 | Ga0055530_10003799 | Ga0055530_100037992 | 216 |
| 221 | 3300003794 | Ga0055531_10001352 | Ga0055531_100013526 | 216 |
| 222 | 3300005290 | Ga0065712_10020657 | Ga0065712_100206571 | 216 |
| 223 | 3300005331 | Ga0070670_100000062 | Ga0070670_10000006224 | 216 |
| 224 | 3300005347 | Ga0070668_100002583 | Ga0070668_1000025834 | 216 |
| 225 | 3300005353 | Ga0070669_100164119 | Ga0070669_1001641192 | 216 |
| 226 | 3300005367 | Ga0070667_100000178 | Ga0070667_10000017848 | 216 |
| 227 | 3300005548 | Ga0070665_100002121 | Ga0070665_10000212120 | 216 |
| 228 | 3300005614 | Ga0068856_100620614 | Ga0068856_1006206142 | 216 |
| 229 | 3300005617 | Ga0068859_100066598 | Ga0068859_1000665984 | 216 |
| 230 | 3300005618 | Ga0068864_100000126 | Ga0068864_10000012671 | 216 |
| 231 | 3300005841 | Ga0068863_100001240 | Ga0068863_10000124010 | 216 |
| 232 | 3300005841 | Ga0068863_100278321 | Ga0068863_1002783212 | 216 |
| 233 | 3300005842 | Ga0068858_100027605 | Ga0068858_1000276053 | 216 |
| 234 | 3300005843 | Ga0068860_100002315 | Ga0068860_10000231510 | 216 |
| 235 | 3300005844 | Ga0068862_100001903 | Ga0068862_10000190310 | 216 |
| 236 | 3300006931 | Ga0097620_100066595 | Ga0097620_1000665954 | 216 |
| 237 | 3300009101 | Ga0105247_10063666 | Ga0105247_100636663 | 216 |
| 238 | 3300009174 | Ga0105241_10205375 | Ga0105241_102053752 | 216 |
| 239 | 3300009177 | Ga0105248_10077474 | Ga0105248_100774744 | 216 |
| 240 | 3300009551 | Ga0105238_10045390 | Ga0105238_100453903 | 216 |
| 241 | 3300009553 | Ga0105249_10010885 | Ga0105249_100108853 | 216 |
| 242 | 3300014325 | Ga0163163_10432077 | Ga0163163_104320772 | 216 |
| 243 | 3300014968 | Ga0157379_10063806 | Ga0157379_100638062 | 216 |
| 244 | 3300014968 | Ga0157379_10620627 | Ga0157379_106206272 | 216 |
| 245 | 3300025297 | Ga0209758_1009767 | Ga0209758_10097676 | 216 |
| 246 | 3300025298 | Ga0209050_1000101 | Ga0209050_100010198 | 216 |
| 247 | 3300025304 | Ga0209257_1000220 | Ga0209257_100022098 | 216 |
| 248 | 3300025911 | Ga0207654_10200661 | Ga0207654_102006612 | 216 |
| 249 | 3300025923 | Ga0207681_10141169 | Ga0207681_101411693 | 216 |
| 250 | 3300025925 | Ga0207650_10000084 | Ga0207650_1000008424 | 216 |
| 251 | 3300025961 | Ga0207712_10001180 | Ga0207712_1000118014 | 216 |
| 252 | 3300025972 | Ga0207668_10000036 | Ga0207668_1000003666 | 216 |
| 253 | 3300025986 | Ga0207658_10000427 | Ga0207658_1000042717 | 216 |
| 254 | 3300026035 | Ga0207703_10001840 | Ga0207703_1000184016 | 216 |
| 255 | 3300026078 | Ga0207702_10260853 | Ga0207702_102608532 | 216 |
| 256 | 3300026088 | Ga0207641_10029022 | Ga0207641_100290224 | 216 |
| 257 | 3300026095 | Ga0207676_10000102 | Ga0207676_1000010252 | 216 |
| 258 | 3300026095 | Ga0207676_10315414 | Ga0207676_103154142 | 216 |
| 259 | 3300028379 | Ga0268266_10008574 | Ga0268266_100085745 | 216 |
| 260 | 3300028380 | Ga0268265_10000635 | Ga0268265_100006359 | 216 |
| 261 | 3300028381 | Ga0268264_10000284 | Ga0268264_1000028456 | 216 |
| 262 | 3300028800 | Ga0265338_10076076 | Ga0265338_100760763 | 216 |
| 263 | 3300031456 | Ga0307513_10431032 | Ga0307513_104310322 | 216 |
| 264 | 3300031548 | Ga0307408_100030506 | Ga0307408_1000305061 | 216 |
| 265 | 3300031730 | Ga0307516_10000154 | Ga0307516_1000015478 | 216 |
| 266 | 3300035089 | Ga0373944_0086867 | Ga0373944_0086867_49_708 | 216 |
| 267 | 3300035171 | Ga0373946_0028601 | Ga0373946_0028601_1076_1735 | 216 |
| 268 | 3300035695 | Ga0373927_0013172 | Ga0373927_0013172_1664_2323 | 216 |
| 269 | 3300035724 | Ga0373933_0376234 | Ga0373933_0376234_150_803 | 216 |
| 270 | 3300037068 | Ga0373925_0000380 | Ga0373925_0000380_23179_23838 | 216 |
| 271 | 3300042132 | Ga0450895_000202 | Ga0450895_000202_1391_2056 | 216 |
| 272 | 3300042133 | Ga0450896_001567 | Ga0450896_001567_1977_2642 | 216 |
| 273 | 3300042147 | Ga0450910_008678 | Ga0450910_008678_520_1203 | 216 |
| 274 | 3300042184 | Ga0450908_003553 | Ga0450908_003553_732_1397 | 216 |
| 275 | 3300042531 | Ga0450918_004852 | Ga0450918_004852_1738_2421 | 216 |
| 276 | 3300042531 | Ga0450918_009143 | Ga0450918_009143_130_795 | 216 |
| 277 | 3300046522 | Ga0495643_0117928 | Ga0495643_0117928_516_1190 | 216 |
| 278 | 3300046530 | Ga0495654_0070310 | Ga0495654_0070310_66_740 | 216 |
| 279 | 3300046538 | Ga0495609_0060471 | Ga0495609_0060471_515_1189 | 216 |
| 280 | 3300046542 | Ga0495597_0023219 | Ga0495597_0023219_1600_2274 | 216 |
| 281 | 3300046557 | Ga0495622_0004304 | Ga0495622_0004304_4998_5672 | 216 |
| 282 | 3300046616 | Ga0495668_0190222 | Ga0495668_0190222_199_873 | 216 |
| 283 | 3300047443 | Ga0495687_032417 | Ga0495687_032417_545_1219 | 216 |
| 284 | 3300048088 | Ga0495602_0549830 | Ga0495602_0549830_44_718 | 216 |
| 285 | 3300048905 | Ga0496102_0166327 | Ga0496102_0166327_642_1352 | 216 |
| 286 | 3300048905 | Ga0496102_0305549 | Ga0496102_0305549_697_1371 | 216 |
| 287 | 3300048920 | Ga0496117_0013087 | Ga0496117_0013087_3008_3682 | 216 |
| 288 | 3300048922 | Ga0496119_0030141 | Ga0496119_0030141_708_1382 | 216 |
| 289 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_633709_634383 | 216 |
| 290 | 3300049581 | Ga0501047_0123297 | Ga0501047_0123297_406_1056 | 216 |
| 291 | 3300049583 | Ga0501067_0047740 | Ga0501067_0047740_1586_2296 | 216 |
| 292 | 3300049588 | Ga0501072_0033810 | Ga0501072_0033810_2164_2841 | 216 |
| 293 | 3300049590 | Ga0501074_0046448 | Ga0501074_0046448_1636_2313 | 216 |
| 294 | 3300049742 | Ga0501080_0008405 | Ga0501080_0008405_807_1484 | 216 |
| 295 | 3300049823 | Ga0501044_0114986 | Ga0501044_0114986_1731_2381 | 216 |
| 296 | 3300050489 | nmdc:mga03683_16002_c1 | nmdc:mga03683_16002_c1_1402_2055 | 216 |
| 297 | 3300053080 | Ga0500635_0000288 | Ga0500635_0000288_9338_10012 | 216 |
| 298 | 3300053086 | Ga0500578_0288190 | Ga0500578_0288190_111_785 | 216 |
| 299 | 3300053092 | Ga0500583_0043556 | Ga0500583_0043556_1212_1886 | 216 |
| 300 | 3300053094 | Ga0500566_0151246 | Ga0500566_0151246_126_800 | 216 |
| 301 | 3300053119 | Ga0500595_003680 | Ga0500595_003680_2790_3464 | 216 |
| 302 | 3300053121 | Ga0500607_094802 | Ga0500607_094802_693_1367 | 216 |
| 303 | 3300053122 | Ga0500608_001518 | Ga0500608_001518_5023_5697 | 216 |
| 304 | 3300053123 | Ga0500614_001563 | Ga0500614_001563_1236_1910 | 216 |
| 305 | 3300053134 | Ga0500658_0040526 | Ga0500658_0040526_155_829 | 216 |
| 306 | 3300053136 | Ga0500559_0003669 | Ga0500559_0003669_1122_1796 | 216 |
| 307 | 3300053148 | Ga0500590_019664 | Ga0500590_019664_1113_1787 | 216 |
| 308 | 3300053178 | Ga0500637_0137549 | Ga0500637_0137549_556_1230 | 216 |
| 309 | 3300053178 | Ga0500637_0201334 | Ga0500637_0201334_163_837 | 216 |
| 310 | 3300053725 | Ga0500576_041884 | Ga0500576_041884_277_951 | 216 |
| 311 | 3300053729 | Ga0500625_016435 | Ga0500625_016435_21_695 | 216 |
| 312 | 3300054114 | Ga0501084_0137919 | Ga0501084_0137919_232_909 | 216 |
| 313 | 3300005327 | Ga0070658_10562888 | Ga0070658_105628881 | 217 |
| 314 | 3300005364 | Ga0070673_100808575 | Ga0070673_1008085751 | 217 |
| 315 | 3300005435 | Ga0070714_100004266 | Ga0070714_1000042666 | 217 |
| 316 | 3300005458 | Ga0070681_10038255 | Ga0070681_100382552 | 217 |
| 317 | 3300005530 | Ga0070679_100030766 | Ga0070679_1000307661 | 217 |
| 318 | 3300005548 | Ga0070665_100000121 | Ga0070665_10000012111 | 217 |
| 319 | 3300005563 | Ga0068855_100020193 | Ga0068855_1000201933 | 217 |
| 320 | 3300005614 | Ga0068856_100377011 | Ga0068856_1003770112 | 217 |
| 321 | 3300005617 | Ga0068859_101524412 | Ga0068859_1015244121 | 217 |
| 322 | 3300006048 | Ga0075363_100084385 | Ga0075363_1000843852 | 217 |
| 323 | 3300006051 | Ga0075364_10001440 | Ga0075364_100014407 | 217 |
| 324 | 3300006178 | Ga0075367_10074765 | Ga0075367_100747653 | 217 |
| 325 | 3300006186 | Ga0075369_10088847 | Ga0075369_100888473 | 217 |
| 326 | 3300006195 | Ga0075366_10019261 | Ga0075366_100192613 | 217 |
| 327 | 3300006353 | Ga0075370_10048162 | Ga0075370_100481624 | 217 |
| 328 | 3300006931 | Ga0097620_101523913 | Ga0097620_1015239131 | 217 |
| 329 | 3300009148 | Ga0105243_10773435 | Ga0105243_107734352 | 217 |
| 330 | 3300010375 | Ga0105239_10050787 | Ga0105239_100507874 | 217 |
| 331 | 3300010375 | Ga0105239_10426207 | Ga0105239_104262072 | 217 |
| 332 | 3300014325 | Ga0163163_10021896 | Ga0163163_100218965 | 217 |
| 333 | 3300025250 | Ga0209026_1011705 | Ga0209026_10117052 | 217 |
| 334 | 3300025272 | Ga0209455_1036323 | Ga0209455_10363231 | 217 |
| 335 | 3300025294 | Ga0209025_1120097 | Ga0209025_11200971 | 217 |
| 336 | 3300025912 | Ga0207707_10451428 | Ga0207707_104514282 | 217 |
| 337 | 3300025913 | Ga0207695_10002212 | Ga0207695_1000221227 | 217 |
| 338 | 3300025913 | Ga0207695_10244486 | Ga0207695_102444862 | 217 |
| 339 | 3300025913 | Ga0207695_10514152 | Ga0207695_105141522 | 217 |
| 340 | 3300025924 | Ga0207694_10024478 | Ga0207694_100244785 | 217 |
| 341 | 3300025925 | Ga0207650_10318639 | Ga0207650_103186392 | 217 |
| 342 | 3300025929 | Ga0207664_10022011 | Ga0207664_100220114 | 217 |
| 343 | 3300025934 | Ga0207686_10343883 | Ga0207686_103438832 | 217 |
| 344 | 3300025949 | Ga0207667_10048351 | Ga0207667_100483513 | 217 |
| 345 | 3300028379 | Ga0268266_10000106 | Ga0268266_10000106153 | 217 |
| 346 | 3300030521 | Ga0307511_10019931 | Ga0307511_100199314 | 217 |
| 347 | 3300031251 | Ga0265327_10000998 | Ga0265327_1000099839 | 217 |
| 348 | 3300031456 | Ga0307513_10008912 | Ga0307513_1000891214 | 217 |
| 349 | 3300031824 | Ga0307413_10200539 | Ga0307413_102005391 | 217 |
| 350 | 3300032005 | Ga0307411_10048064 | Ga0307411_100480642 | 217 |
| 351 | 3300036401 | Ga0373937_0338970 | Ga0373937_0338970_224_886 | 217 |
| 352 | 3300046528 | Ga0495642_0135809 | Ga0495642_0135809_274_927 | 217 |
| 353 | 3300046660 | Ga0495625_0328611 | Ga0495625_0328611_93_746 | 217 |
| 354 | 3300046684 | Ga0495669_0000003 | Ga0495669_0000003_60068_60721 | 217 |
| 355 | 3300046684 | Ga0495669_0148706 | Ga0495669_0148706_248_916 | 217 |
| 356 | 3300046691 | Ga0495670_0202800 | Ga0495670_0202800_302_979 | 217 |
| 357 | 3300047445 | Ga0495677_0067308 | Ga0495677_0067308_193_846 | 217 |
| 358 | 3300048928 | Ga0496125_0183100 | Ga0496125_0183100_470_1138 | 217 |
| 359 | 3300049570 | Ga0501033_0002932 | Ga0501033_0002932_5364_6017 | 217 |
| 360 | 3300049571 | Ga0501034_0049189 | Ga0501034_0049189_352_1005 | 217 |
| 361 | 3300049571 | Ga0501034_0198238 | Ga0501034_0198238_519_1175 | 217 |
| 362 | 3300049573 | Ga0501037_0138129 | Ga0501037_0138129_827_1480 | 217 |
| 363 | 3300049581 | Ga0501047_0390664 | Ga0501047_0390664_37_714 | 217 |
| 364 | 3300049823 | Ga0501044_0019170 | Ga0501044_0019170_1374_2027 | 217 |
| 365 | 3300050490 | nmdc:mga03n38_65448_c1 | nmdc:mga03n38_65448_c1_643_1308 | 217 |
| 366 | 3300050491 | nmdc:mga00v17_2096_c1 | nmdc:mga00v17_2096_c1_7393_8058 | 217 |
| 367 | 3300050493 | nmdc:mga0k408_18392_c1 | nmdc:mga0k408_18392_c1_572_1237 | 217 |
| 368 | 3300050495 | nmdc:mga04h51_30748_c1 | nmdc:mga04h51_30748_c1_337_1002 | 217 |
| 369 | 3300050496 | nmdc:mga07m45_17228_c1 | nmdc:mga07m45_17228_c1_1716_2381 | 217 |
| 370 | 3300050496 | nmdc:mga07m45_212359_c1 | nmdc:mga07m45_212359_c1_45_710 | 217 |
| 371 | 3300053087 | Ga0500643_001504 | Ga0500643_001504_4438_5106 | 217 |
| 372 | 3300053087 | Ga0500643_001950 | Ga0500643_001950_1857_2513 | 217 |
| 373 | 3300053087 | Ga0500643_008450 | Ga0500643_008450_989_1654 | 217 |
| 374 | 3300053092 | Ga0500583_0255370 | Ga0500583_0255370_107_769 | 217 |
| 375 | 3300053103 | Ga0500555_000871 | Ga0500555_000871_9764_10441 | 217 |
| 376 | 3300053104 | Ga0500556_0003686 | Ga0500556_0003686_1565_2242 | 217 |
| 377 | 3300053111 | Ga0500572_000035 | Ga0500572_000035_26100_26762 | 217 |
| 378 | 3300053119 | Ga0500595_022228 | Ga0500595_022228_1002_1655 | 217 |
| 379 | 3300053120 | Ga0500597_056673 | Ga0500597_056673_379_1041 | 217 |
| 380 | 3300053131 | Ga0500652_111389 | Ga0500652_111389_189_851 | 217 |
| 381 | 3300053136 | Ga0500559_0000035 | Ga0500559_0000035_79403_80065 | 217 |
| 382 | 3300005336 | Ga0070680_100715920 | Ga0070680_1007159201 | 218 |
| 383 | 3300005347 | Ga0070668_100009206 | Ga0070668_1000092067 | 218 |
| 384 | 3300005367 | Ga0070667_100004563 | Ga0070667_1000045634 | 218 |
| 385 | 3300005458 | Ga0070681_10177574 | Ga0070681_101775741 | 218 |
| 386 | 3300005548 | Ga0070665_100002649 | Ga0070665_10000264918 | 218 |
| 387 | 3300005563 | Ga0068855_100117313 | Ga0068855_1001173133 | 218 |
| 388 | 3300005563 | Ga0068855_100298262 | Ga0068855_1002982621 | 218 |
| 389 | 3300005618 | Ga0068864_100002265 | Ga0068864_10000226512 | 218 |
| 390 | 3300005841 | Ga0068863_100000282 | Ga0068863_1000002825 | 218 |
| 391 | 3300005842 | Ga0068858_100000493 | Ga0068858_10000049333 | 218 |
| 392 | 3300005844 | Ga0068862_100017518 | Ga0068862_1000175185 | 218 |
| 393 | 3300005844 | Ga0068862_100033184 | Ga0068862_1000331844 | 218 |
| 394 | 3300009093 | Ga0105240_10000535 | Ga0105240_1000053526 | 218 |
| 395 | 3300009093 | Ga0105240_10050691 | Ga0105240_100506916 | 218 |
| 396 | 3300009177 | Ga0105248_10021645 | Ga0105248_100216458 | 218 |
| 397 | 3300014325 | Ga0163163_10212084 | Ga0163163_102120842 | 218 |
| 398 | 3300014968 | Ga0157379_10033986 | Ga0157379_100339862 | 218 |
| 399 | 3300021388 | Ga0213875_10096715 | Ga0213875_100967152 | 218 |
| 400 | 3300025909 | Ga0207705_10593200 | Ga0207705_105932002 | 218 |
| 401 | 3300025912 | Ga0207707_10323004 | Ga0207707_103230042 | 218 |
| 402 | 3300025913 | Ga0207695_10003013 | Ga0207695_1000301322 | 218 |
| 403 | 3300025913 | Ga0207695_10010454 | Ga0207695_1001045411 | 218 |
| 404 | 3300025917 | Ga0207660_10020290 | Ga0207660_100202904 | 218 |
| 405 | 3300025925 | Ga0207650_10237696 | Ga0207650_102376962 | 218 |
| 406 | 3300025941 | Ga0207711_10065255 | Ga0207711_100652554 | 218 |
| 407 | 3300025949 | Ga0207667_10047475 | Ga0207667_100474752 | 218 |
| 408 | 3300025972 | Ga0207668_10000007 | Ga0207668_10000007127 | 218 |
| 409 | 3300025972 | Ga0207668_10339547 | Ga0207668_103395473 | 218 |
| 410 | 3300025986 | Ga0207658_10018889 | Ga0207658_100188894 | 218 |
| 411 | 3300026035 | Ga0207703_10000658 | Ga0207703_1000065828 | 218 |
| 412 | 3300026088 | Ga0207641_10000376 | Ga0207641_1000037643 | 218 |
| 413 | 3300026095 | Ga0207676_10000332 | Ga0207676_1000033223 | 218 |
| 414 | 3300028379 | Ga0268266_10001586 | Ga0268266_100015863 | 218 |
| 415 | 3300028379 | Ga0268266_10633972 | Ga0268266_106339722 | 218 |
| 416 | 3300028380 | Ga0268265_10016051 | Ga0268265_100160514 | 218 |
| 417 | 3300028380 | Ga0268265_10047063 | Ga0268265_100470634 | 218 |
| 418 | 3300037312 | Ga0395899_0000251 | Ga0395899_0000251_61759_62430 | 218 |
| 419 | 3300037418 | Ga0395900_0000084 | Ga0395900_0000084_144842_145513 | 218 |
| 420 | 3300037418 | Ga0395900_0053314 | Ga0395900_0053314_1799_2461 | 218 |
| 421 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_187792_188463 | 218 |
| 422 | 3300037466 | Ga0395898_0114090 | Ga0395898_0114090_1114_1776 | 218 |
| 423 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_404044_404715 | 218 |
| 424 | 3300037471 | Ga0395905_0200845 | Ga0395905_0200845_987_1649 | 218 |
| 425 | 3300037853 | Ga0436364_0537472 | Ga0436364_0537472_425_1090 | 218 |
| 426 | 3300038443 | Ga0395901_0009640 | Ga0395901_0009640_7469_8140 | 218 |
| 427 | 3300048909 | Ga0496106_0641039 | Ga0496106_0641039_56_736 | 218 |
| 428 | 3300053090 | Ga0500646_0115185 | Ga0500646_0115185_162_821 | 218 |
| 429 | 3300053104 | Ga0500556_0027079 | Ga0500556_0027079_425_1105 | 218 |
| 430 | 3300053108 | Ga0500562_000833 | Ga0500562_000833_4138_4794 | 218 |
| 431 | 3300053119 | Ga0500595_008288 | Ga0500595_008288_2365_3021 | 218 |
| 432 | 3300053156 | Ga0500622_0002619 | Ga0500622_0002619_550_1230 | 218 |
| 433 | 3300005337 | Ga0070682_100218252 | Ga0070682_1002182522 | 219 |
| 434 | 3300005344 | Ga0070661_100068188 | Ga0070661_1000681882 | 219 |
| 435 | 3300005347 | Ga0070668_100001523 | Ga0070668_1000015233 | 219 |
| 436 | 3300005353 | Ga0070669_100002957 | Ga0070669_1000029574 | 219 |
| 437 | 3300005367 | Ga0070667_100171046 | Ga0070667_1001710463 | 219 |
| 438 | 3300005548 | Ga0070665_100376492 | Ga0070665_1003764921 | 219 |
| 439 | 3300005548 | Ga0070665_100790429 | Ga0070665_1007904292 | 219 |
| 440 | 3300005563 | Ga0068855_100586354 | Ga0068855_1005863542 | 219 |
| 441 | 3300005617 | Ga0068859_100000320 | Ga0068859_10000032021 | 219 |
| 442 | 3300005718 | Ga0068866_10029999 | Ga0068866_100299994 | 219 |
| 443 | 3300005841 | Ga0068863_100001015 | Ga0068863_10000101527 | 219 |
| 444 | 3300005842 | Ga0068858_100002660 | Ga0068858_1000026606 | 219 |
| 445 | 3300005843 | Ga0068860_100022099 | Ga0068860_1000220994 | 219 |
| 446 | 3300005844 | Ga0068862_100075652 | Ga0068862_1000756524 | 219 |
| 447 | 3300006028 | Ga0070717_10888716 | Ga0070717_108887162 | 219 |
| 448 | 3300006931 | Ga0097620_100000320 | Ga0097620_10000032021 | 219 |
| 449 | 3300010375 | Ga0105239_10088694 | Ga0105239_100886945 | 219 |
| 450 | 3300013100 | Ga0157373_10305715 | Ga0157373_103057151 | 219 |
| 451 | 3300025920 | Ga0207649_10250205 | Ga0207649_102502052 | 219 |
| 452 | 3300025931 | Ga0207644_10000767 | Ga0207644_100007679 | 219 |
| 453 | 3300025940 | Ga0207691_10039738 | Ga0207691_100397383 | 219 |
| 454 | 3300025941 | Ga0207711_10004902 | Ga0207711_100049028 | 219 |
| 455 | 3300025949 | Ga0207667_10194007 | Ga0207667_101940073 | 219 |
| 456 | 3300025972 | Ga0207668_10002156 | Ga0207668_1000215610 | 219 |
| 457 | 3300025986 | Ga0207658_10033269 | Ga0207658_100332693 | 219 |
| 458 | 3300026035 | Ga0207703_10002382 | Ga0207703_1000238218 | 219 |
| 459 | 3300026088 | Ga0207641_10025693 | Ga0207641_100256932 | 219 |
| 460 | 3300026118 | Ga0207675_100074798 | Ga0207675_1000747983 | 219 |
| 461 | 3300028379 | Ga0268266_10672195 | Ga0268266_106721952 | 219 |
| 462 | 3300028380 | Ga0268265_10177033 | Ga0268265_101770333 | 219 |
| 463 | 3300028381 | Ga0268264_10014579 | Ga0268264_100145793 | 219 |
| 464 | 3300028558 | Ga0265326_10022823 | Ga0265326_100228232 | 219 |
| 465 | 3300028653 | Ga0265323_10000888 | Ga0265323_1000088814 | 219 |
| 466 | 3300028654 | Ga0265322_10019908 | Ga0265322_100199082 | 219 |
| 467 | 3300028666 | Ga0265336_10000188 | Ga0265336_100001886 | 219 |
| 468 | 3300028800 | Ga0265338_10000393 | Ga0265338_1000039351 | 219 |
| 469 | 3300029957 | Ga0265324_10031494 | Ga0265324_100314942 | 219 |
| 470 | 3300031251 | Ga0265327_10000525 | Ga0265327_1000052532 | 219 |
| 471 | 3300031548 | Ga0307408_100012797 | Ga0307408_1000127975 | 219 |
| 472 | 3300031731 | Ga0307405_10060255 | Ga0307405_100602552 | 219 |
| 473 | 3300031824 | Ga0307413_10029163 | Ga0307413_100291633 | 219 |
| 474 | 3300031852 | Ga0307410_10004398 | Ga0307410_100043984 | 219 |
| 475 | 3300031852 | Ga0307410_10362203 | Ga0307410_103622032 | 219 |
| 476 | 3300031901 | Ga0307406_10136120 | Ga0307406_101361202 | 219 |
| 477 | 3300031903 | Ga0307407_10002410 | Ga0307407_100024102 | 219 |
| 478 | 3300031911 | Ga0307412_10008188 | Ga0307412_100081883 | 219 |
| 479 | 3300031995 | Ga0307409_100008921 | Ga0307409_1000089215 | 219 |
| 480 | 3300032002 | Ga0307416_100011899 | Ga0307416_1000118992 | 219 |
| 481 | 3300032004 | Ga0307414_10107210 | Ga0307414_101072102 | 219 |
| 482 | 3300032126 | Ga0307415_100134890 | Ga0307415_1001348903 | 219 |
| 483 | 3300035111 | Ga0373923_0048700 | Ga0373923_0048700_567_1265 | 219 |
| 484 | 3300035113 | Ga0373936_0036367 | Ga0373936_0036367_796_1494 | 219 |
| 485 | 3300035117 | Ga0373953_0134639 | Ga0373953_0134639_317_1015 | 219 |
| 486 | 3300035170 | Ga0373943_0247930 | Ga0373943_0247930_188_886 | 219 |
| 487 | 3300035171 | Ga0373946_0051928 | Ga0373946_0051928_449_1147 | 219 |
| 488 | 3300035692 | Ga0373935_0001033 | Ga0373935_0001033_2534_3232 | 219 |
| 489 | 3300035695 | Ga0373927_0002069 | Ga0373927_0002069_10866_11564 | 219 |
| 490 | 3300035724 | Ga0373933_0039652 | Ga0373933_0039652_1581_2279 | 219 |
| 491 | 3300035725 | Ga0373947_0000940 | Ga0373947_0000940_9740_10438 | 219 |
| 492 | 3300037068 | Ga0373925_0001317 | Ga0373925_0001317_9808_10506 | 219 |
| 493 | 3300041413 | Ga0439465_0028587 | Ga0439465_0028587_610_1284 | 219 |
| 494 | 3300041452 | Ga0451793_0789003 | Ga0451793_0789003_140_814 | 219 |
| 495 | 3300041463 | Ga0451804_0466473 | Ga0451804_0466473_88_762 | 219 |
| 496 | 3300045976 | Ga0466967_0027665 | Ga0466967_0027665_3578_4267 | 219 |
| 497 | 3300046454 | Ga0495592_0017678 | Ga0495592_0017678_308_1006 | 219 |
| 498 | 3300046455 | Ga0495603_0019746 | Ga0495603_0019746_1456_2154 | 219 |
| 499 | 3300046461 | Ga0495641_0003365 | Ga0495641_0003365_444_1142 | 219 |
| 500 | 3300046473 | Ga0495582_0000528 | Ga0495582_0000528_11212_11910 | 219 |
| 501 | 3300046475 | Ga0495639_0000044 | Ga0495639_0000044_40251_40949 | 219 |
| 502 | 3300046476 | Ga0495662_0049212 | Ga0495662_0049212_746_1444 | 219 |
| 503 | 3300046477 | Ga0495664_0104697 | Ga0495664_0104697_297_995 | 219 |
| 504 | 3300046499 | Ga0495594_0000351 | Ga0495594_0000351_12083_12781 | 219 |
| 505 | 3300046514 | Ga0495618_0107808 | Ga0495618_0107808_281_979 | 219 |
| 506 | 3300046516 | Ga0495628_0087630 | Ga0495628_0087630_1321_2019 | 219 |
| 507 | 3300046517 | Ga0495630_0002975 | Ga0495630_0002975_7002_7700 | 219 |
| 508 | 3300046529 | Ga0495652_0102548 | Ga0495652_0102548_548_1246 | 219 |
| 509 | 3300046531 | Ga0495665_0000397 | Ga0495665_0000397_10201_10899 | 219 |
| 510 | 3300046533 | Ga0495640_0010991 | Ga0495640_0010991_244_942 | 219 |
| 511 | 3300046557 | Ga0495622_0001316 | Ga0495622_0001316_10824_11522 | 219 |
| 512 | 3300046559 | Ga0495667_0062069 | Ga0495667_0062069_564_1262 | 219 |
| 513 | 3300046642 | Ga0495634_0000252 | Ga0495634_0000252_35806_36504 | 219 |
| 514 | 3300046663 | Ga0495635_0001901 | Ga0495635_0001901_6206_6904 | 219 |
| 515 | 3300046674 | Ga0495588_0016278 | Ga0495588_0016278_1585_2283 | 219 |
| 516 | 3300046681 | Ga0495647_0004913 | Ga0495647_0004913_956_1654 | 219 |
| 517 | 3300046689 | Ga0495613_0002632 | Ga0495613_0002632_6494_7192 | 219 |
| 518 | 3300046690 | Ga0495624_0002748 | Ga0495624_0002748_7197_7895 | 219 |
| 519 | 3300047315 | Ga0495581_0001351 | Ga0495581_0001351_11191_11889 | 219 |
| 520 | 3300047319 | Ga0495674_0003317 | Ga0495674_0003317_7279_7977 | 219 |
| 521 | 3300047321 | Ga0495676_0034005 | Ga0495676_0034005_2131_2829 | 219 |
| 522 | 3300047673 | Ga0495593_0009579 | Ga0495593_0009579_136_834 | 219 |
| 523 | 3300048089 | Ga0495614_0032524 | Ga0495614_0032524_758_1456 | 219 |
| 524 | 3300049569 | Ga0501032_0051544 | Ga0501032_0051544_2060_2728 | 219 |
| 525 | 3300053094 | Ga0500566_0197638 | Ga0500566_0197638_239_913 | 219 |
| 526 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_92109_92783 | 219 |
| 527 | 3300053120 | Ga0500597_203053 | Ga0500597_203053_59_733 | 219 |
| 528 | 3300053130 | Ga0500642_0000170 | Ga0500642_0000170_10905_11579 | 219 |
| 529 | 3300053729 | Ga0500625_009359 | Ga0500625_009359_2845_3519 | 219 |
| 530 | 3300060353 | Ga0501082_0087090 | Ga0501082_0087090_211_906 | 219 |
| 531 | iso_pu_bacteria | 2508501128 | 2509153574 | 219 |
| 532 | 3300005327 | Ga0070658_10174440 | Ga0070658_101744402 | 220 |
| 533 | 3300005336 | Ga0070680_100113772 | Ga0070680_1001137723 | 220 |
| 534 | 3300005339 | Ga0070660_100098447 | Ga0070660_1000984472 | 220 |
| 535 | 3300005339 | Ga0070660_100230085 | Ga0070660_1002300852 | 220 |
| 536 | 3300005355 | Ga0070671_100159057 | Ga0070671_1001590572 | 220 |
| 537 | 3300005366 | Ga0070659_100005883 | Ga0070659_1000058831 | 220 |
| 538 | 3300005458 | Ga0070681_10002207 | Ga0070681_1000220715 | 220 |
| 539 | 3300005530 | Ga0070679_100614193 | Ga0070679_1006141932 | 220 |
| 540 | 3300005563 | Ga0068855_100150193 | Ga0068855_1001501934 | 220 |
| 541 | 3300005563 | Ga0068855_100362370 | Ga0068855_1003623702 | 220 |
| 542 | 3300005618 | Ga0068864_100210318 | Ga0068864_1002103182 | 220 |
| 543 | 3300005842 | Ga0068858_100601581 | Ga0068858_1006015812 | 220 |
| 544 | 3300005844 | Ga0068862_100352022 | Ga0068862_1003520222 | 220 |
| 545 | 3300006881 | Ga0068865_100000993 | Ga0068865_1000009937 | 220 |
| 546 | 3300009177 | Ga0105248_10000963 | Ga0105248_1000096315 | 220 |
| 547 | 3300009551 | Ga0105238_10022615 | Ga0105238_100226156 | 220 |
| 548 | 3300009551 | Ga0105238_10172164 | Ga0105238_101721642 | 220 |
| 549 | 3300013100 | Ga0157373_10012438 | Ga0157373_100124382 | 220 |
| 550 | 3300014968 | Ga0157379_10422682 | Ga0157379_104226822 | 220 |
| 551 | 3300025900 | Ga0207710_10059959 | Ga0207710_100599592 | 220 |
| 552 | 3300025908 | Ga0207643_10383791 | Ga0207643_103837912 | 220 |
| 553 | 3300025909 | Ga0207705_10154627 | Ga0207705_101546272 | 220 |
| 554 | 3300025912 | Ga0207707_10302312 | Ga0207707_103023122 | 220 |
| 555 | 3300025914 | Ga0207671_10076810 | Ga0207671_100768104 | 220 |
| 556 | 3300025917 | Ga0207660_10021174 | Ga0207660_100211745 | 220 |
| 557 | 3300025919 | Ga0207657_10000621 | Ga0207657_100006215 | 220 |
| 558 | 3300025921 | Ga0207652_10221969 | Ga0207652_102219692 | 220 |
| 559 | 3300025931 | Ga0207644_10290774 | Ga0207644_102907742 | 220 |
| 560 | 3300025932 | Ga0207690_10088127 | Ga0207690_100881273 | 220 |
| 561 | 3300025938 | Ga0207704_10006609 | Ga0207704_100066095 | 220 |
| 562 | 3300025941 | Ga0207711_10000903 | Ga0207711_1000090322 | 220 |
| 563 | 3300025949 | Ga0207667_10141969 | Ga0207667_101419694 | 220 |
| 564 | 3300025949 | Ga0207667_10201573 | Ga0207667_102015733 | 220 |
| 565 | 3300025949 | Ga0207667_10447478 | Ga0207667_104474782 | 220 |
| 566 | 3300025981 | Ga0207640_10154041 | Ga0207640_101540412 | 220 |
| 567 | 3300026023 | Ga0207677_10089437 | Ga0207677_100894372 | 220 |
| 568 | 3300026035 | Ga0207703_10444047 | Ga0207703_104440472 | 220 |
| 569 | 3300026041 | Ga0207639_10338312 | Ga0207639_103383122 | 220 |
| 570 | 3300026095 | Ga0207676_10067837 | Ga0207676_100678374 | 220 |
| 571 | 3300026116 | Ga0207674_10103734 | Ga0207674_101037343 | 220 |
| 572 | 3300028381 | Ga0268264_10368881 | Ga0268264_103688812 | 220 |
| 573 | 3300031548 | Ga0307408_100016161 | Ga0307408_1000161613 | 220 |
| 574 | 3300031731 | Ga0307405_10069541 | Ga0307405_100695413 | 220 |
| 575 | 3300031903 | Ga0307407_10044779 | Ga0307407_100447796 | 220 |
| 576 | 3300032002 | Ga0307416_100153594 | Ga0307416_1001535942 | 220 |
| 577 | 3300035113 | Ga0373936_0002829 | Ga0373936_0002829_4056_4718 | 220 |
| 578 | 3300037312 | Ga0395899_0000100 | Ga0395899_0000100_3599_4264 | 220 |
| 579 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_66121_66786 | 220 |
| 580 | 3300037466 | Ga0395898_0007526 | Ga0395898_0007526_8263_8928 | 220 |
| 581 | 3300037471 | Ga0395905_0019183 | Ga0395905_0019183_709_1374 | 220 |
| 582 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_17343_18008 | 220 |
| 583 | 3300038443 | Ga0395901_0491127 | Ga0395901_0491127_477_1157 | 220 |
| 584 | 3300039437 | Ga0436365_1871972 | Ga0436365_1871972_41_712 | 220 |
| 585 | 3300044683 | Ga0466965_0070402 | Ga0466965_0070402_329_997 | 220 |
| 586 | 3300046528 | Ga0495642_0006227 | Ga0495642_0006227_1722_2384 | 220 |
| 587 | 3300047445 | Ga0495677_0072055 | Ga0495677_0072055_591_1253 | 220 |
| 588 | 3300048904 | Ga0496101_0114088 | Ga0496101_0114088_602_1270 | 220 |
| 589 | 3300048905 | Ga0496102_0017868 | Ga0496102_0017868_2975_3643 | 220 |
| 590 | 3300048906 | Ga0496103_0429472 | Ga0496103_0429472_24_695 | 220 |
| 591 | 3300048910 | Ga0496107_0073438 | Ga0496107_0073438_479_1147 | 220 |
| 592 | 3300048911 | Ga0496108_0126721 | Ga0496108_0126721_653_1321 | 220 |
| 593 | 3300048912 | Ga0496109_0015380 | Ga0496109_0015380_1693_2361 | 220 |
| 594 | 3300048913 | Ga0496110_0220212 | Ga0496110_0220212_179_847 | 220 |
| 595 | 3300048915 | Ga0496112_0617383 | Ga0496112_0617383_285_953 | 220 |
| 596 | 3300048916 | Ga0496113_0305916 | Ga0496113_0305916_341_1009 | 220 |
| 597 | iso_pu_bacteria | 2791355048 | 2792459605 | 220 |
| 598 | iso_pu_bacteria | 2843744320 | 2843747260 | 220 |
| 599 | iso_pu_bacteria | 2849560528 | 2849560799 | 220 |
| 600 | iso_pu_bacteria | 2849573788 | 2849574317 | 220 |
| 601 | iso_pu_bacteria | 2851153111 | 2851158057 | 220 |
| 602 | iso_pu_bacteria | 2898329390 | 2898333429 | 220 |
| 603 | 3300025261 | Ga0209233_1029535 | Ga0209233_10295352 | 221 |
| 604 | iso_pu_bacteria | 2510917020 | 2511124616 | 221 |
| 605 | iso_pu_bacteria | 2582581280 | 2585155459 | 221 |
| 606 | iso_pu_bacteria | 2582581293 | 2585199245 | 221 |
| 607 | iso_pu_bacteria | 2585428106 | 2587919680 | 221 |
| 608 | iso_pu_bacteria | 2643221545 | 2643747922 | 221 |
| 609 | iso_pu_bacteria | 2643221552 | 2643781906 | 221 |
| 610 | iso_pu_bacteria | 2643221583 | 2643926163 | 221 |
| 611 | iso_pu_bacteria | 2643221584 | 2643931571 | 221 |
| 612 | iso_pu_bacteria | 2643221640 | 2644226386 | 221 |
| 613 | iso_pu_bacteria | 2643221642 | 2644235874 | 221 |
| 614 | iso_pu_bacteria | 2643221691 | 2644507974 | 221 |
| 615 | iso_pu_bacteria | 2818991435 | 2819536790 | 221 |
| 616 | iso_pu_bacteria | 2818991454 | 2819645951 | 221 |
| 617 | iso_pu_bacteria | 2857504554 | 2857506702 | 221 |
| 618 | iso_pu_bacteria | 2884960567 | 2884963916 | 221 |
| 619 | iso_pu_bacteria | 2928531327 | 2928534471 | 221 |
| 620 | 3300013100 | Ga0157373_10000266 | Ga0157373_100002662 | 222 |
| 621 | 3300028573 | Ga0265334_10023209 | Ga0265334_100232094 | 222 |
| 622 | 3300049744 | Ga0501083_0116867 | Ga0501083_0116867_344_1027 | 222 |
| 623 | 3300053096 | Ga0500641_0000646 | Ga0500641_0000646_7993_8661 | 222 |
| 624 | 3300053142 | Ga0500577_0125666 | Ga0500577_0125666_222_890 | 222 |
| 625 | 3300025299 | Ga0209256_1005142 | Ga0209256_10051426 | 223 |
| 626 | iso_pu_bacteria | 2582581279 | 2585150119 | 223 |
| 627 | 3300003781 | Ga0055536_1001488 | Ga0055536_10014889 | 224 |
| 628 | 3300003791 | Ga0055530_10004881 | Ga0055530_100048816 | 224 |
| 629 | 3300003794 | Ga0055531_10059501 | Ga0055531_100595012 | 224 |
| 630 | 3300025292 | Ga0209676_1000200 | Ga0209676_100020067 | 224 |
| 631 | 3300025298 | Ga0209050_1000057 | Ga0209050_1000057184 | 224 |
| 632 | 3300025304 | Ga0209257_1027610 | Ga0209257_10276102 | 224 |
| 633 | 3300025910 | Ga0207684_10506669 | Ga0207684_105066692 | 224 |
| 634 | 3300048909 | Ga0496106_0042247 | Ga0496106_0042247_2097_2771 | 224 |
| 635 | 3300048910 | Ga0496107_0000349 | Ga0496107_0000349_8260_8934 | 224 |
| 636 | 3300048924 | Ga0496121_0034294 | Ga0496121_0034294_36_710 | 224 |
| 637 | 3300053122 | Ga0500608_000101 | Ga0500608_000101_10527_11201 | 224 |
| 638 | 3300053136 | Ga0500559_0026157 | Ga0500559_0026157_91_765 | 224 |
| 639 | 3300003775 | Ga0055524_1024640 | Ga0055524_10246402 | 225 |
| 640 | 3300003781 | Ga0055536_1001673 | Ga0055536_10016735 | 225 |
| 641 | 3300003791 | Ga0055530_10028365 | Ga0055530_100283652 | 225 |
| 642 | 3300003794 | Ga0055531_10000799 | Ga0055531_1000079919 | 225 |
| 643 | 3300003794 | Ga0055531_10000833 | Ga0055531_1000083323 | 225 |
| 644 | 3300005262 | Ga0065165_1001007 | Ga0065165_100100715 | 225 |
| 645 | 3300006186 | Ga0075369_10007966 | Ga0075369_100079664 | 225 |
| 646 | 3300006195 | Ga0075366_10010660 | Ga0075366_100106606 | 225 |
| 647 | 3300006353 | Ga0075370_10207398 | Ga0075370_102073982 | 225 |
| 648 | 3300021377 | Ga0213874_10042953 | Ga0213874_100429532 | 225 |
| 649 | 3300025263 | Ga0209565_1002061 | Ga0209565_10020617 | 225 |
| 650 | 3300025273 | Ga0209673_1000807 | Ga0209673_100080718 | 225 |
| 651 | 3300025291 | Ga0209675_1009368 | Ga0209675_10093683 | 225 |
| 652 | 3300025292 | Ga0209676_1000477 | Ga0209676_100047760 | 225 |
| 653 | 3300025295 | Ga0209564_1001886 | Ga0209564_10018865 | 225 |
| 654 | 3300025295 | Ga0209564_1013771 | Ga0209564_10137712 | 225 |
| 655 | 3300025295 | Ga0209564_1034144 | Ga0209564_10341441 | 225 |
| 656 | 3300025295 | Ga0209564_1035626 | Ga0209564_10356262 | 225 |
| 657 | 3300025297 | Ga0209758_1001528 | Ga0209758_100152810 | 225 |
| 658 | 3300025297 | Ga0209758_1003270 | Ga0209758_10032708 | 225 |
| 659 | 3300025298 | Ga0209050_1000696 | Ga0209050_10006969 | 225 |
| 660 | 3300025298 | Ga0209050_1026171 | Ga0209050_10261713 | 225 |
| 661 | 3300025299 | Ga0209256_1004238 | Ga0209256_10042385 | 225 |
| 662 | 3300025299 | Ga0209256_1011164 | Ga0209256_10111644 | 225 |
| 663 | 3300025304 | Ga0209257_1000223 | Ga0209257_1000223119 | 225 |
| 664 | 3300025304 | Ga0209257_1000702 | Ga0209257_100070231 | 225 |
| 665 | 3300028794 | Ga0307515_10016872 | Ga0307515_1001687210 | 225 |
| 666 | 3300028794 | Ga0307515_10038196 | Ga0307515_100381965 | 225 |
| 667 | 3300046453 | Ga0495627_000679 | Ga0495627_000679_15585_16262 | 225 |
| 668 | 3300046457 | Ga0495590_0001078 | Ga0495590_0001078_3320_4003 | 225 |
| 669 | 3300046460 | Ga0495638_0000410 | Ga0495638_0000410_10736_11419 | 225 |
| 670 | 3300046460 | Ga0495638_0000579 | Ga0495638_0000579_13883_14560 | 225 |
| 671 | 3300046460 | Ga0495638_0002568 | Ga0495638_0002568_2974_3651 | 225 |
| 672 | 3300046460 | Ga0495638_0006216 | Ga0495638_0006216_2284_2961 | 225 |
| 673 | 3300046460 | Ga0495638_0077710 | Ga0495638_0077710_86_763 | 225 |
| 674 | 3300046471 | Ga0495650_0000269 | Ga0495650_0000269_55892_56569 | 225 |
| 675 | 3300046506 | Ga0495583_0000029 | Ga0495583_0000029_16782_17459 | 225 |
| 676 | 3300046507 | Ga0495606_0048734 | Ga0495606_0048734_727_1404 | 225 |
| 677 | 3300046507 | Ga0495606_0118206 | Ga0495606_0118206_663_1340 | 225 |
| 678 | 3300046512 | Ga0495610_0000225 | Ga0495610_0000225_4903_5580 | 225 |
| 679 | 3300046512 | Ga0495610_0001127 | Ga0495610_0001127_11199_11882 | 225 |
| 680 | 3300046513 | Ga0495616_0000160 | Ga0495616_0000160_42604_43281 | 225 |
| 681 | 3300046515 | Ga0495620_0041011 | Ga0495620_0041011_800_1477 | 225 |
| 682 | 3300046518 | Ga0495631_0010545 | Ga0495631_0010545_3539_4222 | 225 |
| 683 | 3300046519 | Ga0495632_0001474 | Ga0495632_0001474_9563_10240 | 225 |
| 684 | 3300046520 | Ga0495637_0017261 | Ga0495637_0017261_1464_2141 | 225 |
| 685 | 3300046520 | Ga0495637_0039278 | Ga0495637_0039278_819_1502 | 225 |
| 686 | 3300046520 | Ga0495637_0057569 | Ga0495637_0057569_422_1105 | 225 |
| 687 | 3300046524 | Ga0495648_0001017 | Ga0495648_0001017_18110_18793 | 225 |
| 688 | 3300046524 | Ga0495648_0009026 | Ga0495648_0009026_2936_3613 | 225 |
| 689 | 3300046524 | Ga0495648_0250447 | Ga0495648_0250447_96_773 | 225 |
| 690 | 3300046525 | Ga0495663_0078905 | Ga0495663_0078905_62_739 | 225 |
| 691 | 3300046530 | Ga0495654_0000123 | Ga0495654_0000123_56878_57555 | 225 |
| 692 | 3300046616 | Ga0495668_0000014 | Ga0495668_0000014_337912_338589 | 225 |
| 693 | 3300046616 | Ga0495668_0008784 | Ga0495668_0008784_4450_5127 | 225 |
| 694 | 3300046616 | Ga0495668_0023540 | Ga0495668_0023540_2342_3025 | 225 |
| 695 | 3300046616 | Ga0495668_0119174 | Ga0495668_0119174_107_784 | 225 |
| 696 | 3300046660 | Ga0495625_0000816 | Ga0495625_0000816_24256_24933 | 225 |
| 697 | 3300046660 | Ga0495625_0016984 | Ga0495625_0016984_2421_3098 | 225 |
| 698 | 3300046660 | Ga0495625_0039662 | Ga0495625_0039662_341_1018 | 225 |
| 699 | 3300046660 | Ga0495625_0073606 | Ga0495625_0073606_670_1350 | 225 |
| 700 | 3300046660 | Ga0495625_0250084 | Ga0495625_0250084_104_787 | 225 |
| 701 | 3300046660 | Ga0495625_0388926 | Ga0495625_0388926_43_720 | 225 |
| 702 | 3300046794 | Ga0495589_0165085 | Ga0495589_0165085_166_846 | 225 |
| 703 | 3300046810 | Ga0495660_0005019 | Ga0495660_0005019_1687_2364 | 225 |
| 704 | 3300047320 | Ga0495672_0001824 | Ga0495672_0001824_18639_19316 | 225 |
| 705 | 3300047469 | Ga0495673_0000094 | Ga0495673_0000094_26385_27062 | 225 |
| 706 | 3300047469 | Ga0495673_0000461 | Ga0495673_0000461_24055_24738 | 225 |
| 707 | 3300047469 | Ga0495673_0002213 | Ga0495673_0002213_9205_9882 | 225 |
| 708 | 3300047472 | Ga0495686_0000825 | Ga0495686_0000825_20520_21203 | 225 |
| 709 | 3300047472 | Ga0495686_0008370 | Ga0495686_0008370_638_1315 | 225 |
| 710 | 3300047472 | Ga0495686_0014578 | Ga0495686_0014578_4284_4967 | 225 |
| 711 | 3300047472 | Ga0495686_0055016 | Ga0495686_0055016_1688_2371 | 225 |
| 712 | 3300047472 | Ga0495686_0102508 | Ga0495686_0102508_458_1135 | 225 |
| 713 | 3300048918 | Ga0496115_0003100 | Ga0496115_0003100_11154_11831 | 225 |
| 714 | 3300048924 | Ga0496121_0053001 | Ga0496121_0053001_1435_2112 | 225 |
| 715 | 3300048925 | Ga0496122_0215371 | Ga0496122_0215371_211_888 | 225 |
| 716 | 3300048927 | Ga0496124_0014468 | Ga0496124_0014468_6277_6954 | 225 |
| 717 | 3300048928 | Ga0496125_0023238 | Ga0496125_0023238_4171_4848 | 225 |
| 718 | 3300048929 | Ga0496126_0006062 | Ga0496126_0006062_11301_11978 | 225 |
| 719 | 3300048929 | Ga0496126_0494994 | Ga0496126_0494994_58_735 | 225 |
| 720 | 3300049459 | Ga0495678_000723 | Ga0495678_000723_10508_11191 | 225 |
| 721 | 3300050496 | nmdc:mga07m45_31708_c1 | nmdc:mga07m45_31708_c1_429_1106 | 225 |
| 722 | 3300053086 | Ga0500578_0001050 | Ga0500578_0001050_10344_11027 | 225 |
| 723 | 3300053087 | Ga0500643_010475 | Ga0500643_010475_690_1373 | 225 |
| 724 | 3300053088 | Ga0500644_0000261 | Ga0500644_0000261_11531_12214 | 225 |
| 725 | 3300053102 | Ga0500554_002053 | Ga0500554_002053_1285_1962 | 225 |
| 726 | 3300053104 | Ga0500556_0000583 | Ga0500556_0000583_7248_7925 | 225 |
| 727 | 3300053108 | Ga0500562_005155 | Ga0500562_005155_2360_3043 | 225 |
| 728 | 3300053118 | Ga0500594_0000084 | Ga0500594_0000084_11146_11829 | 225 |
| 729 | 3300053123 | Ga0500614_016705 | Ga0500614_016705_584_1261 | 225 |
| 730 | 3300053125 | Ga0500618_000255 | Ga0500618_000255_18851_19528 | 225 |
| 731 | 3300053136 | Ga0500559_0000243 | Ga0500559_0000243_23367_24044 | 225 |
| 732 | 3300053136 | Ga0500559_0008182 | Ga0500559_0008182_3236_3913 | 225 |
| 733 | 3300053138 | Ga0500564_000062 | Ga0500564_000062_10145_10828 | 225 |
| 734 | 3300053142 | Ga0500577_0001545 | Ga0500577_0001545_2754_3431 | 225 |
| 735 | 3300053156 | Ga0500622_0001061 | Ga0500622_0001061_18777_19460 | 225 |
| 736 | 3300053156 | Ga0500622_0006366 | Ga0500622_0006366_3303_3980 | 225 |
| 737 | 3300053156 | Ga0500622_0016359 | Ga0500622_0016359_1148_1825 | 225 |
| 738 | 3300053156 | Ga0500622_0042460 | Ga0500622_0042460_75_755 | 225 |
| 739 | 3300053730 | Ga0500645_003312 | Ga0500645_003312_3133_3810 | 225 |
| 740 | 3300053730 | Ga0500645_015734 | Ga0500645_015734_1468_2145 | 225 |
| 741 | 3300053731 | Ga0500609_000644 | Ga0500609_000644_2812_3489 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.9112 | 22 | 216 |
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.8121 | 22 | 216 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.812 | 20 | 222 |
| 1vk2-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution | 0.7805 | 20 | 216 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.7716 | 20 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9116 | 22 | 212 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8891 | 20 | 216 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8067 | 20 | 222 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7961 | 22 | 212 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7942 | 20 | 216 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T8NWG6-F1-model_v4 | deleted | 0.9937 | 16 | 216 |
|
| AF-A0A3D2L3Z4-F1-model_v4 | Uracil-DNA glycosylase | 0.9936 | 27 | 155 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A519WZQ7-F1-model_v4 | deleted | 0.993 | 16 | 219 |
|
| AF-A0A257PF37-F1-model_v4 | Uracil-DNA glycosylase | 0.9908 | 17 | 126 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A258DPB5-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9906 | 17 | 219 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar