F478217

General Info

Members Datasets Scaffolds Average Seq Length
735 313 1470 139

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0194605|Ga0453684_0194605_1440_1919
Length 159
Sequence MVQLSSQPYCQTGANKEKSTAMKSYRKELFMEVPTRRAFVNITPQVEQCLAESGIREGLLLCNAMHITASVFINDDESGLHHDYEVWLEKLAPHAPVKQYRHNTYEDNADAHMKRQLMGREVVVAITAGKLDFGTWEQIFYGEFDGRRQKRVLVKIIGE

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
246 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
247 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
248 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
249 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
250 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
263 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
264 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
265 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
266 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
267 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
268 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
269 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
270 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
271 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
272 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
273 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
274 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
275 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
278 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
279 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
280 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
281 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
282 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
283 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
284 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
287 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
288 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
291 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
292 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
293 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
294 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
295 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
298 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
299 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
300 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
301 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.9
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0194605 3300044712 Bacteria 2369
2 SwRhRL2b_contig_830599 2162886007 Bacteria 1632
3 ARSoilOldRDRAFT_c003936 3300000044 Bacteria 1267
4 JGI24739J22299_10110220 3300001989 Bacteria 826
5 JGI24739J22299_10126970 3300001989 Bacteria 760
6 JGI24743J22301_10065101 3300001991 Bacteria 755
7 JGI24751J29686_10000233 3300002459 Bacteria 22750
8 rootL2_10108684 3300003322 Bacteria 2164
9 Ga0065704_10149682 3300005289 Bacteria 1440
10 Ga0065704_10210722 3300005289 Bacteria 1110
11 Ga0065704_10253600 3300005289 Bacteria 983
12 Ga0065704_10273750 3300005289 Bacteria 913
13 Ga0065712_10002754 3300005290 Bacteria 4364
14 Ga0065712_10336319 3300005290 Unclassified 771
15 Ga0065712_10775921 3300005290 Bacteria 520
16 Ga0065715_10002637 3300005293 Bacteria 5030
17 Ga0065715_10025122 3300005293 Bacteria 2043
18 Ga0065715_10154339 3300005293 Bacteria 1678
19 Ga0065715_10376058 3300005293 Bacteria 914
20 Ga0065715_10692371 3300005293 Bacteria 657
21 Ga0065707_10025193 3300005295 Bacteria 1708
22 Ga0065707_10091010 3300005295 Bacteria 4023
23 Ga0065707_10149506 3300005295 Bacteria 1674
24 Ga0065707_10301646 3300005295 Bacteria 995
25 Ga0065707_10442675 3300005295 Bacteria 808
26 Ga0065707_10642731 3300005295 Bacteria 667
27 Ga0070658_10930102 3300005327 Bacteria 756
28 Ga0070676_10008369 3300005328 Archaea 5574
29 Ga0070676_11079497 3300005328 Bacteria 606
30 Ga0070683_100259631 3300005329 Archaea 1652
31 Ga0070683_100426185 3300005329 Bacteria 1266
32 Ga0070690_100056742 3300005330 Bacteria 2512
33 Ga0070670_100000227 3300005331 Bacteria 51904
34 Ga0070670_100088322 3300005331 Unclassified 2665
35 Ga0070670_100333197 3300005331 Bacteria 1331
36 Ga0068869_100027502 3300005334 Bacteria 3965
37 Ga0068869_100655949 3300005334 Bacteria 891
38 Ga0068869_100881843 3300005334 Bacteria 773
39 Ga0068869_101522603 3300005334 Bacteria 594
40 Ga0070682_100234666 3300005337 Bacteria 1313
41 Ga0070682_100264668 3300005337 Bacteria 1246
42 Ga0068868_100275533 3300005338 Archaea 1422
43 Ga0070691_10421822 3300005341 Bacteria 756
44 Ga0070687_100030159 3300005343 Bacteria 2649
45 Ga0070687_100580597 3300005343 Bacteria 767
46 Ga0070661_100225615 3300005344 Archaea 1438
47 Ga0070692_10094800 3300005345 Bacteria 1628
48 Ga0070692_10441661 3300005345 Bacteria 831
49 Ga0070692_10524126 3300005345 Unclassified 772
50 Ga0070669_101940542 3300005353 Bacteria 514
51 Ga0070673_100342674 3300005364 Bacteria 1325
52 Ga0070673_102005663 3300005364 Bacteria 549
53 Ga0070703_10000112 3300005406 Bacteria 42152
54 Ga0070703_10091368 3300005406 Bacteria 1056
55 Ga0070709_10000497 3300005434 Archaea 23182
56 Ga0070709_10250387 3300005434 Unclassified 1276
57 Ga0070710_10025681 3300005437 Archaea 3122
58 Ga0070701_10213891 3300005438 Archaea 1146
59 Ga0070701_10216798 3300005438 Bacteria 1139
60 Ga0070701_10250809 3300005438 Bacteria 1069
61 Ga0070701_11125494 3300005438 Bacteria 554
62 Ga0070711_100035865 3300005439 Unclassified 3319
63 Ga0070705_100052558 3300005440 Bacteria 2381
64 Ga0070705_100068438 3300005440 Bacteria 2137
65 Ga0070705_100073331 3300005440 Archaea 2077
66 Ga0070705_100093988 3300005440 Bacteria 1876
67 Ga0070705_100639355 3300005440 Bacteria 828
68 Ga0070705_100992375 3300005440 Bacteria 681
69 Ga0070700_100000110 3300005441 Bacteria 52465
70 Ga0070700_100034977 3300005441 Bacteria 3037
71 Ga0070700_100751918 3300005441 Bacteria 780
72 Ga0070694_100001664 3300005444 Bacteria 13064
73 Ga0070694_100038712 3300005444 Archaea 3170
74 Ga0070694_100084938 3300005444 Bacteria 2209
75 Ga0070694_100149582 3300005444 Unclassified 1704
76 Ga0070694_100946048 3300005444 Bacteria 713
77 Ga0070708_100002974 3300005445 Bacteria 13171
78 Ga0070708_100063942 3300005445 Bacteria 3295
79 Ga0070708_100382565 3300005445 Bacteria 1327
80 Ga0070708_100490579 3300005445 Bacteria 1159
81 Ga0070678_100236591 3300005456 Archaea 1525
82 Ga0070681_10017224 3300005458 Bacteria 7224
83 Ga0068867_100140629 3300005459 Bacteria 1886
84 Ga0068867_101060172 3300005459 Bacteria 738
85 Ga0068867_101806470 3300005459 Bacteria 575
86 Ga0070706_100000125 3300005467 Bacteria 94689
87 Ga0070706_100344169 3300005467 Archaea 1390
88 Ga0070707_100071115 3300005468 Bacteria 3352
89 Ga0070707_100144249 3300005468 Bacteria 2317
90 Ga0070707_100703839 3300005468 Bacteria 973
91 Ga0070698_100007824 3300005471 Bacteria 11571
92 Ga0070698_100035872 3300005471 Bacteria 5125
93 Ga0070698_100105535 3300005471 Bacteria 2787
94 Ga0070699_100002333 3300005518 Bacteria 17039
95 Ga0070699_100009184 3300005518 Bacteria 8573
96 Ga0070699_100150374 3300005518 Bacteria 2059
97 Ga0070699_100320086 3300005518 Bacteria 1394
98 Ga0070699_101576601 3300005518 Bacteria 602
99 Ga0070679_100038926 3300005530 Bacteria 4728
100 Ga0070679_100706184 3300005530 Bacteria 951
101 Ga0070679_102154527 3300005530 Bacteria 507
102 Ga0070684_100242853 3300005535 Bacteria 1646
103 Ga0070697_100223706 3300005536 Bacteria 1604
104 Ga0070697_100275067 3300005536 Bacteria 1444
105 Ga0070697_100790696 3300005536 Archaea 839
106 Ga0068853_100667568 3300005539 Bacteria 990
107 Ga0068853_100991031 3300005539 Bacteria 809
108 Ga0068853_101992922 3300005539 Bacteria 563
109 Ga0070672_101019536 3300005543 Bacteria 734
110 Ga0070686_100032089 3300005544 Bacteria 3218
111 Ga0070686_100113715 3300005544 Bacteria 1848
112 Ga0070695_100078018 3300005545 Bacteria 2183
113 Ga0070695_100317623 3300005545 Bacteria 1157
114 Ga0070695_100377566 3300005545 Bacteria 1069
115 Ga0070696_100222591 3300005546 Bacteria 1416
116 Ga0070693_100107401 3300005547 Bacteria 1711
117 Ga0070693_100184249 3300005547 Bacteria 1346
118 Ga0070693_100206185 3300005547 Bacteria 1280
119 Ga0070693_100336467 3300005547 Bacteria 1029
120 Ga0070693_100491255 3300005547 Bacteria 869
121 Ga0070665_100015294 3300005548 Bacteria 7705
122 Ga0070704_100012650 3300005549 Bacteria 5220
123 Ga0070704_100436524 3300005549 Bacteria 1124
124 Ga0070704_100467489 3300005549 Bacteria 1089
125 Ga0070704_101004599 3300005549 Bacteria 755
126 Ga0070704_101416077 3300005549 Bacteria 638
127 Ga0070664_100390411 3300005564 Bacteria 1272
128 Ga0070664_101192177 3300005564 Bacteria 718
129 Ga0068857_100019268 3300005577 Bacteria 5991
130 Ga0068857_100488095 3300005577 Bacteria 1155
131 Ga0068857_100811124 3300005577 Bacteria 894
132 Ga0068857_101890413 3300005577 Bacteria 585
133 Ga0068854_100078093 3300005578 Bacteria 2438
134 Ga0068854_100214136 3300005578 Bacteria 1521
135 Ga0068854_100231108 3300005578 Bacteria 1468
136 Ga0068854_100675688 3300005578 Bacteria 889
137 Ga0068856_100294308 3300005614 Bacteria 1640
138 Ga0068856_100606911 3300005614 Bacteria 1115
139 Ga0070702_100008463 3300005615 Bacteria 4984
140 Ga0070702_100083592 3300005615 Bacteria 1918
141 Ga0070702_100098100 3300005615 Archaea 1792
142 Ga0068852_100564081 3300005616 Bacteria 1140
143 Ga0068859_100005956 3300005617 Bacteria 12379
144 Ga0068859_100016039 3300005617 Bacteria 7528
145 Ga0068859_100061637 3300005617 Bacteria 3780
146 Ga0068859_100117825 3300005617 Bacteria 2721
147 Ga0068859_100266400 3300005617 Bacteria 1805
148 Ga0068859_100291942 3300005617 Bacteria 1724
149 Ga0068859_100316808 3300005617 Bacteria 1653
150 Ga0068859_100399041 3300005617 Bacteria 1471
151 Ga0068859_100500506 3300005617 Bacteria 1310
152 Ga0068859_100596732 3300005617 Bacteria 1197
153 Ga0068859_101274975 3300005617 Bacteria 810
154 Ga0068859_101325256 3300005617 Bacteria 793
155 Ga0068864_100064570 3300005618 Bacteria 3175
156 Ga0068864_100215296 3300005618 Bacteria 1771
157 Ga0068864_100266487 3300005618 Bacteria 1595
158 Ga0068864_100409597 3300005618 Bacteria 1290
159 Ga0068864_100486273 3300005618 Unclassified 1185
160 Ga0068864_101025348 3300005618 Bacteria 819
161 Ga0068864_101073627 3300005618 Bacteria 800
162 Ga0068866_10125579 3300005718 Bacteria 1452
163 Ga0068861_100103880 3300005719 Bacteria 2266
164 Ga0068861_100292087 3300005719 Bacteria 1408
165 Ga0068870_10128473 3300005840 Bacteria 1469
166 Ga0068870_10184695 3300005840 Bacteria 1254
167 Ga0068863_100220369 3300005841 Bacteria 1828
168 Ga0068863_100220430 3300005841 Bacteria 1827
169 Ga0068863_100584937 3300005841 Bacteria 1104
170 Ga0068863_101234045 3300005841 Bacteria 754
171 Ga0068863_101583138 3300005841 Bacteria 664
172 Ga0068863_102029759 3300005841 Bacteria 585
173 Ga0068858_100096208 3300005842 Bacteria 2759
174 Ga0068858_100189019 3300005842 Bacteria 1946
175 Ga0068858_100209450 3300005842 Bacteria 1845
176 Ga0068858_100504025 3300005842 Bacteria 1170
177 Ga0068858_100516458 3300005842 Bacteria 1155
178 Ga0068858_101022931 3300005842 Bacteria 810
179 Ga0068858_101251309 3300005842 Bacteria 730
180 Ga0068858_102560518 3300005842 Unclassified 504
181 Ga0068860_100039244 3300005843 Bacteria 4529
182 Ga0068860_100274456 3300005843 Bacteria 1646
183 Ga0068860_100295619 3300005843 Bacteria 1585
184 Ga0068860_100429332 3300005843 Bacteria 1311
185 Ga0068860_101277188 3300005843 Bacteria 755
186 Ga0068862_100578068 3300005844 Bacteria 1076
187 Ga0068862_100623423 3300005844 Bacteria 1038
188 Ga0068862_101702498 3300005844 Bacteria 639
189 Ga0081538_10277857 3300005981 Unclassified 624
190 Ga0081539_10240214 3300005985 Bacteria 811
191 Ga0070715_10006993 3300006163 Unclassified 3862
192 Ga0070716_100002793 3300006173 Archaea 8119
193 Ga0070716_100574634 3300006173 Bacteria 844
194 Ga0070712_100082624 3300006175 Archaea 2330
195 Ga0097621_100034180 3300006237 Bacteria 4054
196 Ga0097621_100240057 3300006237 Bacteria 1584
197 Ga0068871_100006206 3300006358 Bacteria 8428
198 Ga0068871_100096083 3300006358 Bacteria 2475
199 Ga0068871_100466677 3300006358 Bacteria 1134
200 Ga0075428_100067874 3300006844 Bacteria 3902
201 Ga0075428_100470222 3300006844 Bacteria 1346
202 Ga0075428_101941859 3300006844 Bacteria 611
203 Ga0075428_102631405 3300006844 Archaea 514
204 Ga0075430_100028772 3300006846 Bacteria 4719
205 Ga0075430_100151065 3300006846 Bacteria 1934
206 Ga0075430_100217688 3300006846 Bacteria 1585
207 Ga0075431_100073867 3300006847 Bacteria 3519
208 Ga0075431_100134908 3300006847 Bacteria 2545
209 Ga0075431_100334483 3300006847 Unclassified 1525
210 Ga0075433_10011055 3300006852 Bacteria 7260
211 Ga0075433_10028365 3300006852 Bacteria 4758
212 Ga0075433_10060519 3300006852 Bacteria 3316
213 Ga0075433_10072241 3300006852 Bacteria 3034
214 Ga0075433_10150870 3300006852 Bacteria 2068
215 Ga0075433_10219254 3300006852 Archaea 1690
216 Ga0075433_10597636 3300006852 Bacteria 969
217 Ga0075433_10726050 3300006852 Bacteria 869
218 Ga0075433_11121084 3300006852 Bacteria 684
219 Ga0075434_100610695 3300006871 Bacteria 1109
220 Ga0075429_100002912 3300006880 Bacteria 14509
221 Ga0075429_100206166 3300006880 Bacteria 1722
222 Ga0075429_100362277 3300006880 Bacteria 1269
223 Ga0068865_100378563 3300006881 Bacteria 1154
224 Ga0075436_100102764 3300006914 Bacteria 1991
225 Ga0075436_100676550 3300006914 Bacteria 763
226 Ga0097620_100005956 3300006931 Bacteria 12379
227 Ga0097620_100016039 3300006931 Bacteria 7528
228 Ga0097620_100061636 3300006931 Bacteria 3780
229 Ga0097620_100117823 3300006931 Bacteria 2721
230 Ga0097620_100266404 3300006931 Bacteria 1805
231 Ga0097620_100291945 3300006931 Bacteria 1724
232 Ga0097620_100316801 3300006931 Bacteria 1653
233 Ga0097620_100399080 3300006931 Bacteria 1471
234 Ga0097620_100500500 3300006931 Bacteria 1310
235 Ga0097620_100596710 3300006931 Bacteria 1197
236 Ga0097620_101274981 3300006931 Bacteria 810
237 Ga0097620_101325168 3300006931 Bacteria 793
238 Ga0075435_100223383 3300007076 Bacteria 1599
239 Ga0105251_10242928 3300009011 Bacteria 811
240 Ga0105251_10370171 3300009011 Unclassified 656
241 Ga0105240_10310141 3300009093 Bacteria 1802
242 Ga0105240_10465098 3300009093 Bacteria 1412
243 Ga0105240_10471245 3300009093 Bacteria 1401
244 Ga0105240_11762911 3300009093 Bacteria 646
245 Ga0111539_10031691 3300009094 Bacteria 6421
246 Ga0111539_10057182 3300009094 Bacteria 4632
247 Ga0111539_10564471 3300009094 Bacteria 1325
248 Ga0111539_10908648 3300009094 Bacteria 1024
249 Ga0111539_11181959 3300009094 Archaea 888
250 Ga0111539_13515789 3300009094 Bacteria 503
251 Ga0105245_10276384 3300009098 Bacteria 1640
252 Ga0105245_10322131 3300009098 Bacteria 1523
253 Ga0105245_11188529 3300009098 Bacteria 810
254 Ga0105245_11763825 3300009098 Bacteria 672
255 Ga0105247_10001051 3300009101 Bacteria 20694
256 Ga0105247_10196874 3300009101 Bacteria 1352
257 Ga0105247_10236741 3300009101 Bacteria 1242
258 Ga0105247_11158484 3300009101 Bacteria 613
259 Ga0105247_11622183 3300009101 Bacteria 532
260 Ga0114129_10052303 3300009147 Bacteria 5732
261 Ga0114129_10060671 3300009147 Bacteria 5287
262 Ga0114129_10089963 3300009147 Bacteria 4255
263 Ga0114129_10102281 3300009147 Bacteria 3963
264 Ga0114129_10324393 3300009147 Unclassified 2046
265 Ga0114129_11011814 3300009147 Bacteria 1046
266 Ga0114129_11030980 3300009147 Unclassified 1034
267 Ga0114129_11316089 3300009147 Unclassified 895
268 Ga0114129_11795688 3300009147 Bacteria 746
269 Ga0114129_11890346 3300009147 Bacteria 724
270 Ga0114129_12287770 3300009147 Bacteria 649
271 Ga0105243_10103715 3300009148 Bacteria 2365
272 Ga0105243_10195333 3300009148 Bacteria 1771
273 Ga0105243_10202398 3300009148 Bacteria 1742
274 Ga0105243_10519752 3300009148 Bacteria 1132
275 Ga0105243_10555174 3300009148 Bacteria 1098
276 Ga0105243_10574959 3300009148 Bacteria 1081
277 Ga0105243_10803853 3300009148 Bacteria 927
278 Ga0105243_11002619 3300009148 Unclassified 838
279 Ga0105243_11299457 3300009148 Bacteria 744
280 Ga0105243_12211111 3300009148 Bacteria 587
281 Ga0105241_10037519 3300009174 Bacteria 3651
282 Ga0105241_10061500 3300009174 Bacteria 2892
283 Ga0105241_10080344 3300009174 Unclassified 2552
284 Ga0105241_10141442 3300009174 Bacteria 1960
285 Ga0105241_10172902 3300009174 Bacteria 1785
286 Ga0105241_10468220 3300009174 Bacteria 1118
287 Ga0105241_10795383 3300009174 Bacteria 871
288 Ga0105242_10029970 3300009176 Bacteria 4342
289 Ga0105242_10463176 3300009176 Bacteria 1198
290 Ga0105242_10654150 3300009176 Bacteria 1022
291 Ga0105242_11357440 3300009176 Bacteria 737
292 Ga0105248_10001795 3300009177 Bacteria 23869
293 Ga0105248_10006777 3300009177 Bacteria 12562
294 Ga0105248_10266171 3300009177 Bacteria 1929
295 Ga0105248_10502699 3300009177 Bacteria 1367
296 Ga0105248_10530663 3300009177 Bacteria 1327
297 Ga0105248_11072486 3300009177 Bacteria 910
298 Ga0105248_13299968 3300009177 Bacteria 513
299 Ga0105237_10304812 3300009545 Bacteria 1596
300 Ga0105237_10345175 3300009545 Bacteria 1493
301 Ga0105237_10508931 3300009545 Bacteria 1211
302 Ga0105238_10241019 3300009551 Bacteria 1786
303 Ga0105238_10258589 3300009551 Bacteria 1720
304 Ga0105249_10063743 3300009553 Bacteria 3386
305 Ga0105249_10115789 3300009553 Bacteria 2540
306 Ga0105249_10939339 3300009553 Bacteria 932
307 Ga0105239_10137693 3300010375 Bacteria 2718
308 Ga0105239_10357418 3300010375 Bacteria 1649
309 Ga0105239_10417570 3300010375 Bacteria 1519
310 Ga0105239_11193055 3300010375 Bacteria 877
311 Ga0105246_10067191 3300011119 Archaea 2512
312 Ga0105246_10198433 3300011119 Bacteria 1558
313 Ga0105246_10560554 3300011119 Bacteria 981
314 Ga0157339_1027500 3300012505 Bacteria 645
315 Ga0157338_1083837 3300012515 Bacteria 520
316 Ga0157373_10256616 3300013100 Unclassified 1237
317 Ga0157373_11023305 3300013100 Bacteria 617
318 Ga0157371_11192004 3300013102 Bacteria 587
319 Ga0157371_11538123 3300013102 Bacteria 520
320 Ga0157369_10588288 3300013105 Bacteria 1149
321 Ga0157369_12009304 3300013105 Bacteria 586
322 Ga0157374_10033334 3300013296 Bacteria 4699
323 Ga0157374_10173080 3300013296 Bacteria 2107
324 Ga0157374_10541998 3300013296 Bacteria 1171
325 Ga0157374_11024154 3300013296 Bacteria 845
326 Ga0157378_10014873 3300013297 Bacteria 6809
327 Ga0157378_10041776 3300013297 Archaea 4068
328 Ga0157378_10208158 3300013297 Bacteria 1853
329 Ga0157378_10261556 3300013297 Bacteria 1660
330 Ga0157378_10303944 3300013297 Bacteria 1545
331 Ga0157378_10722547 3300013297 Bacteria 1017
332 Ga0157378_11724246 3300013297 Bacteria 674
333 Ga0157378_12349426 3300013297 Bacteria 585
334 Ga0163162_10054248 3300013306 Bacteria 4032
335 Ga0163162_10085281 3300013306 Bacteria 3235
336 Ga0163162_10141456 3300013306 Bacteria 2520
337 Ga0163162_10530367 3300013306 Bacteria 1306
338 Ga0163162_10554069 3300013306 Bacteria 1278
339 Ga0163162_10584982 3300013306 Bacteria 1243
340 Ga0163162_11020011 3300013306 Bacteria 936
341 Ga0163162_12169313 3300013306 Bacteria 638
342 Ga0157372_10194105 3300013307 Bacteria 2352
343 Ga0157375_11012371 3300013308 Bacteria 970
344 Ga0157375_11553431 3300013308 Bacteria 782
345 Ga0157375_12974070 3300013308 Bacteria 566
346 Ga0163163_10000277 3300014325 Bacteria 51205
347 Ga0163163_10011916 3300014325 Bacteria 7910
348 Ga0163163_10144926 3300014325 Bacteria 2418
349 Ga0163163_10451479 3300014325 Bacteria 1346
350 Ga0163163_10629696 3300014325 Unclassified 1136
351 Ga0157380_10046154 3300014326 Bacteria 3421
352 Ga0157380_10258219 3300014326 Bacteria 1581
353 Ga0157380_10635783 3300014326 Bacteria 1062
354 Ga0157380_12967530 3300014326 Bacteria 540
355 Ga0157377_10081697 3300014745 Bacteria 1891
356 Ga0157377_10132505 3300014745 Bacteria 1524
357 Ga0157377_10159816 3300014745 Bacteria 1400
358 Ga0157379_10052260 3300014968 Bacteria 3650
359 Ga0157379_11067337 3300014968 Bacteria 772
360 Ga0157379_11203147 3300014968 Bacteria 729
361 Ga0157376_10015328 3300014969 Archaea 5788
362 Ga0157376_10059076 3300014969 Bacteria 3215
363 Ga0157376_11472994 3300014969 Bacteria 713
364 Ga0157376_12219680 3300014969 Bacteria 588
365 Ga0163161_11183266 3300017792 Bacteria 660
366 Ga0207656_10443574 3300025321 Bacteria 655
367 Ga0207653_10000027 3300025885 Bacteria 113830
368 Ga0207692_10214945 3300025898 Bacteria 1137
369 Ga0207642_10288586 3300025899 Bacteria 947
370 Ga0207642_10336784 3300025899 Bacteria 886
371 Ga0207688_10080108 3300025901 Archaea 1864
372 Ga0207688_10551373 3300025901 Bacteria 724
373 Ga0207647_10004971 3300025904 Bacteria 9802
374 Ga0207647_10217928 3300025904 Bacteria 1100
375 Ga0207685_10006894 3300025905 Bacteria 3128
376 Ga0207699_10103029 3300025906 Archaea 1815
377 Ga0207699_10828331 3300025906 Archaea 681
378 Ga0207645_10987127 3300025907 Bacteria 570
379 Ga0207643_10032725 3300025908 Bacteria 2905
380 Ga0207643_10203918 3300025908 Unclassified 1205
381 Ga0207684_10000130 3300025910 Bacteria 137931
382 Ga0207654_10183828 3300025911 Bacteria 1365
383 Ga0207654_10241357 3300025911 Bacteria 1207
384 Ga0207654_10243594 3300025911 Bacteria 1203
385 Ga0207654_10866633 3300025911 Bacteria 654
386 Ga0207707_10102077 3300025912 Bacteria 2507
387 Ga0207707_10294142 3300025912 Bacteria 1405
388 Ga0207695_10062816 3300025913 Bacteria 3831
389 Ga0207671_10586058 3300025914 Bacteria 889
390 Ga0207693_10084881 3300025915 Archaea 2481
391 Ga0207663_10003003 3300025916 Archaea 8166
392 Ga0207660_10525164 3300025917 Bacteria 961
393 Ga0207662_10026825 3300025918 Bacteria 3324
394 Ga0207662_10445577 3300025918 Bacteria 884
395 Ga0207662_11124443 3300025918 Bacteria 558
396 Ga0207662_11232489 3300025918 Unclassified 532
397 Ga0207657_11056727 3300025919 Bacteria 622
398 Ga0207652_10283732 3300025921 Bacteria 1494
399 Ga0207652_11771199 3300025921 Bacteria 523
400 Ga0207646_10020280 3300025922 Bacteria 6162
401 Ga0207646_10096525 3300025922 Bacteria 2648
402 Ga0207681_10014337 3300025923 Bacteria 4924
403 Ga0207694_10003503 3300025924 Bacteria 12469
404 Ga0207694_10071194 3300025924 Bacteria 2717
405 Ga0207650_10000027 3300025925 Bacteria 257466
406 Ga0207650_10052605 3300025925 Bacteria 3017
407 Ga0207650_10677914 3300025925 Bacteria 870
408 Ga0207687_10256495 3300025927 Bacteria 1392
409 Ga0207706_10735204 3300025933 Bacteria 841
410 Ga0207686_10269887 3300025934 Bacteria 1251
411 Ga0207686_10696869 3300025934 Bacteria 807
412 Ga0207709_10043082 3300025935 Bacteria 2719
413 Ga0207709_10117104 3300025935 Bacteria 1792
414 Ga0207709_10408410 3300025935 Bacteria 1040
415 Ga0207709_10483023 3300025935 Bacteria 964
416 Ga0207670_10200592 3300025936 Bacteria 1516
417 Ga0207670_11330589 3300025936 Bacteria 609
418 Ga0207665_10024003 3300025939 Archaea 4019
419 Ga0207691_10553404 3300025940 Bacteria 975
420 Ga0207691_10578154 3300025940 Bacteria 952
421 Ga0207711_10005876 3300025941 Bacteria 10361
422 Ga0207711_10038047 3300025941 Bacteria 4090
423 Ga0207711_10071805 3300025941 Bacteria 3005
424 Ga0207711_10453538 3300025941 Bacteria 1194
425 Ga0207711_11062235 3300025941 Bacteria 750
426 Ga0207689_10015307 3300025942 Bacteria 6494
427 Ga0207689_10237875 3300025942 Bacteria 1505
428 Ga0207689_10357145 3300025942 Bacteria 1215
429 Ga0207689_10586249 3300025942 Bacteria 937
430 Ga0207689_11090794 3300025942 Bacteria 673
431 Ga0207661_10141807 3300025944 Bacteria 2069
432 Ga0207661_11519399 3300025944 Bacteria 613
433 Ga0207679_10853928 3300025945 Bacteria 831
434 Ga0207679_11696272 3300025945 Bacteria 578
435 Ga0207679_11835157 3300025945 Unclassified 554
436 Ga0207651_10211369 3300025960 Bacteria 1562
437 Ga0207651_10394548 3300025960 Bacteria 1176
438 Ga0207651_10494178 3300025960 Bacteria 1057
439 Ga0207651_11196179 3300025960 Bacteria 682
440 Ga0207712_10057719 3300025961 Bacteria 2740
441 Ga0207712_10105897 3300025961 Bacteria 2100
442 Ga0207640_10104523 3300025981 Bacteria 1994
443 Ga0207640_10224734 3300025981 Bacteria 1440
444 Ga0207658_10476418 3300025986 Unclassified 1109
445 Ga0207677_10546098 3300026023 Bacteria 1009
446 Ga0207703_10081204 3300026035 Bacteria 2702
447 Ga0207703_10223068 3300026035 Bacteria 1686
448 Ga0207703_10286651 3300026035 Bacteria 1497
449 Ga0207703_11370944 3300026035 Bacteria 680
450 Ga0207639_11838065 3300026041 Bacteria 566
451 Ga0207708_10000028 3300026075 Bacteria 164263
452 Ga0207708_10017384 3300026075 Bacteria 5414
453 Ga0207708_10053117 3300026075 Bacteria 3086
454 Ga0207708_10144443 3300026075 Bacteria 1869
455 Ga0207708_10505524 3300026075 Bacteria 1013
456 Ga0207702_10218768 3300026078 Archaea 1774
457 Ga0207641_10394726 3300026088 Bacteria 1327
458 Ga0207641_10792300 3300026088 Bacteria 937
459 Ga0207641_10851322 3300026088 Bacteria 904
460 Ga0207641_11210833 3300026088 Bacteria 755
461 Ga0207641_11549417 3300026088 Bacteria 664
462 Ga0207648_10032182 3300026089 Bacteria 4632
463 Ga0207648_10059837 3300026089 Bacteria 3322
464 Ga0207648_10148635 3300026089 Bacteria 2067
465 Ga0207648_10150716 3300026089 Bacteria 2052
466 Ga0207648_10535380 3300026089 Unclassified 1074
467 Ga0207676_10128886 3300026095 Bacteria 2148
468 Ga0207676_10373507 3300026095 Bacteria 1325
469 Ga0207674_10026983 3300026116 Bacteria 6088
470 Ga0207674_10079621 3300026116 Bacteria 3280
471 Ga0207674_10449400 3300026116 Bacteria 1246
472 Ga0207674_10529151 3300026116 Bacteria 1139
473 Ga0207674_10585392 3300026116 Bacteria 1078
474 Ga0207674_11167275 3300026116 Bacteria 739
475 Ga0207675_100062682 3300026118 Bacteria 3473
476 Ga0207675_100313772 3300026118 Bacteria 1529
477 Ga0207675_100978310 3300026118 Bacteria 864
478 Ga0207675_102423223 3300026118 Bacteria 537
479 Ga0207683_10074588 3300026121 Archaea 3001
480 Ga0207698_10309892 3300026142 Bacteria 1474
481 Ga0207698_10350129 3300026142 Bacteria 1395
482 Ga0207698_11385985 3300026142 Bacteria 718
483 Ga0207428_10017260 3300027907 Bacteria 6197
484 Ga0268265_10096775 3300028380 Bacteria 2373
485 Ga0268264_10159252 3300028381 Bacteria 2032
486 Ga0268264_10205016 3300028381 Bacteria 1806
487 Ga0268264_10523570 3300028381 Bacteria 1159
488 Ga0268264_10536780 3300028381 Bacteria 1145
489 Ga0268264_10890958 3300028381 Bacteria 893
490 Ga0265319_1039615 3300028563 Bacteria 1596
491 Ga0265318_10026566 3300028577 Bacteria 2279
492 Ga0265336_10078788 3300028666 Bacteria 983
493 Ga0265338_10000025 3300028800 Bacteria 296972
494 Ga0265338_10052712 3300028800 Bacteria 3647
495 Ga0265338_10064414 3300028800 Bacteria 3188
496 Ga0265324_10031562 3300029957 Bacteria 1855
497 Ga0316182_1105733 3300030745 Bacteria 642
498 Ga0265325_10002394 3300031241 Bacteria 12676
499 Ga0265325_10121315 3300031241 Bacteria 1260
500 Ga0265340_10295857 3300031247 Bacteria 718
501 Ga0265339_10182296 3300031249 Bacteria 1045
502 Ga0265316_10082646 3300031344 Bacteria 2461
503 Ga0307408_100633616 3300031548 Bacteria 954
504 Ga0316579_10130494 3300031691 Bacteria 1210
505 Ga0316579_10144764 3300031691 Bacteria 1146
506 Ga0316579_10193656 3300031691 Bacteria 983
507 Ga0265314_10278573 3300031711 Bacteria 947
508 Ga0316576_10002781 3300031727 Bacteria 10050
509 Ga0316576_10016609 3300031727 Bacteria 4977
510 Ga0316576_10061512 3300031727 Bacteria 2752
511 Ga0316578_10031833 3300031728 Bacteria 3008
512 Ga0316578_10082727 3300031728 Bacteria 1911
513 Ga0316578_10255932 3300031728 Bacteria 1050
514 Ga0307405_10045886 3300031731 Bacteria 2681
515 Ga0307405_10251660 3300031731 Bacteria 1315
516 Ga0316577_10016492 3300031733 Bacteria 4072
517 Ga0316577_10033722 3300031733 Bacteria 2861
518 Ga0316577_10266961 3300031733 Bacteria 968
519 Ga0316577_10281787 3300031733 Bacteria 941
520 Ga0316577_10299913 3300031733 Bacteria 910
521 Ga0307413_10552501 3300031824 Bacteria 934
522 Ga0307413_10712723 3300031824 Bacteria 835
523 Ga0307410_10071635 3300031852 Bacteria 2404
524 Ga0307410_11330155 3300031852 Unclassified 629
525 Ga0307406_10019144 3300031901 Bacteria 4015
526 Ga0307412_10125244 3300031911 Unclassified 1857
527 Ga0307416_100196502 3300032002 Unclassified 1909
528 Ga0307416_101374927 3300032002 Bacteria 812
529 Ga0307416_101533139 3300032002 Bacteria 772
530 Ga0307414_10001533 3300032004 Bacteria 12027
531 Ga0307414_10708611 3300032004 Bacteria 912
532 Ga0307414_10791978 3300032004 Bacteria 864
533 Ga0307411_10194120 3300032005 Unclassified 1553
534 Ga0307411_10294641 3300032005 Bacteria 1298
535 Ga0307411_11063229 3300032005 Bacteria 728
536 Ga0307415_100025330 3300032126 Bacteria 3720
537 Ga0373930_0064614 3300034816 Bacteria 822
538 Ga0373941_0052781 3300035115 Bacteria 1298
539 Ga0373943_0662523 3300035170 Archaea 617
540 Ga0373943_0776857 3300035170 Unclassified 569
541 Ga0316574_0130667 3300035398 Bacteria 1616
542 Ga0316574_0174893 3300035398 Bacteria 1382
543 Ga0373924_0434147 3300035410 Bacteria 588
544 Ga0373931_0361402 3300035691 Bacteria 911
545 Ga0373937_0104524 3300036401 Bacteria 2631
546 Ga0373937_0507598 3300036401 Bacteria 1146
547 Ga0316582_0019289 3300036647 Bacteria 3988
548 Ga0316582_0048650 3300036647 Bacteria 2681
549 Ga0316582_0190411 3300036647 Bacteria 1397
550 Ga0316582_0601446 3300036647 Bacteria 757
551 Ga0316584_0012464 3300036712 Bacteria 5995
552 Ga0316584_0044456 3300036712 Bacteria 3311
553 Ga0316584_0076991 3300036712 Bacteria 2500
554 Ga0316584_0229920 3300036712 Bacteria 1360
555 Ga0316584_0355625 3300036712 Bacteria 1051
556 Ga0373925_0741941 3300037068 Unclassified 809
557 Ga0395900_0085691 3300037418 Unclassified 3238
558 Ga0395900_1157067 3300037418 Bacteria 690
559 Ga0395898_0363545 3300037466 Bacteria 1380
560 Ga0395905_0705454 3300037471 Bacteria 911
561 Ga0316581_0058858 3300037588 Bacteria 1178
562 Ga0436364_0222681 3300037853 Bacteria 3149
563 Ga0436364_0523199 3300037853 Bacteria 1888
564 Ga0395901_0318045 3300038443 Bacteria 1611
565 Ga0395901_0898177 3300038443 Bacteria 868
566 Ga0400489_42784 3300039093 Bacteria 1439
567 Ga0400489_50738 3300039093 Bacteria 3957
568 Ga0436360_0584398 3300039438 Bacteria 595
569 Ga0436362_0629763 3300039453 Bacteria 599
570 Ga0451839_1040140 3300041496 Bacteria 642
571 Ga0439443_094807 3300042003 Bacteria 567
572 Ga0451577_0820660 3300042876 Bacteria 839
573 Ga0453683_0002587 3300044673 Bacteria 13888
574 Ga0453683_0334417 3300044673 Bacteria 972
575 Ga0453684_0017704 3300044712 Bacteria 11008
576 Ga0453684_0035067 3300044712 Bacteria 6945
577 Ga0453684_0158868 3300044712 Bacteria 2676
578 Ga0453684_0331407 3300044712 Bacteria 1721
579 Ga0453684_0485496 3300044712 Bacteria 1370
580 Ga0453684_1279722 3300044712 Bacteria 766
581 Ga0453684_2093802 3300044712 Bacteria 568
582 Ga0451576_0885065 3300045051 Unclassified 937
583 Ga0451576_0939981 3300045051 Bacteria 907
584 Ga0451576_1107269 3300045051 Bacteria 829
585 Ga0495618_0012029 3300046514 Bacteria 5252
586 Ga0495618_0305037 3300046514 Bacteria 989
587 Ga0495640_0296927 3300046533 Bacteria 1004
588 Ga0495586_0217339 3300046535 Bacteria 1086
589 Ga0495622_0008910 3300046557 Bacteria 4649
590 Ga0495657_0093949 3300046675 Bacteria 1919
591 Ga0495658_0484553 3300046683 Bacteria 791
592 Ga0495613_0002983 3300046689 Bacteria 12677
593 Ga0495604_0560251 3300047317 Bacteria 736
594 Ga0495674_0067329 3300047319 Bacteria 3103
595 Ga0495676_0657302 3300047321 Unclassified 680
596 Ga0495675_0091363 3300047444 Bacteria 1911
597 Ga0495684_0073663 3300047471 Bacteria 2594
598 Ga0495684_0417741 3300047471 Bacteria 938
599 Ga0496100_0647664 3300048903 Bacteria 822
600 Ga0496101_0105679 3300048904 Bacteria 2113
601 Ga0496102_0241419 3300048905 Archaea 1703
602 Ga0496104_0521492 3300048907 Bacteria 1099
603 Ga0496106_0079194 3300048909 Archaea 2522
604 Ga0496106_1119129 3300048909 Bacteria 616
605 Ga0496107_0037942 3300048910 Archaea 3458
606 Ga0496108_0197856 3300048911 Bacteria 1743
607 Ga0496109_0365237 3300048912 Bacteria 1363
608 Ga0496110_0190532 3300048913 Bacteria 1862
609 Ga0496111_0205568 3300048914 Bacteria 1463
610 Ga0496112_0961705 3300048915 Bacteria 775
611 Ga0496113_0108155 3300048916 Bacteria 2161
612 Ga0496114_0368502 3300048917 Bacteria 1271
613 Ga0501292_024355 3300049515 Bacteria 992
614 Ga0501294_014529 3300049517 Bacteria 807
615 Ga0501297_048505 3300049520 Bacteria 618
616 Ga0501298_118264 3300049521 Bacteria 621
617 Ga0501298_135647 3300049521 Bacteria 591
618 Ga0501303_007894 3300049526 Bacteria 957
619 Ga0501312_021466 3300049528 Bacteria 962
620 Ga0501032_0026177 3300049569 Bacteria 4016
621 Ga0501037_0004823 3300049573 Bacteria 9810
622 Ga0501038_0004530 3300049574 Bacteria 12938
623 Ga0501038_0915360 3300049574 Bacteria 647
624 Ga0501039_0240188 3300049575 Bacteria 1424
625 Ga0501039_1082003 3300049575 Bacteria 622
626 Ga0501043_0915573 3300049579 Bacteria 628
627 Ga0501046_0031731 3300049580 Bacteria 4281
628 Ga0501047_0132499 3300049581 Bacteria 2373
629 Ga0501070_0089531 3300049586 Bacteria 2547
630 Ga0501071_0515766 3300049587 Bacteria 917
631 Ga0501075_0731943 3300049591 Bacteria 753
632 Ga0501076_0201357 3300049592 Bacteria 1626
633 Ga0501076_0596760 3300049592 Bacteria 911
634 Ga0501198_000807 3300049649 Bacteria 3889
635 Ga0501202_059651 3300049652 Bacteria 860
636 Ga0501202_175370 3300049652 Bacteria 575
637 Ga0501207_009058 3300049654 Unclassified 1448
638 Ga0501207_054048 3300049654 Bacteria 723
639 Ga0501209_003691 3300049656 Bacteria 2565
640 Ga0501209_161490 3300049656 Bacteria 678
641 Ga0501217_103102 3300049661 Unclassified 812
642 Ga0501217_125741 3300049661 Bacteria 748
643 Ga0501223_000424 3300049663 Bacteria 10249
644 Ga0501223_016100 3300049663 Bacteria 1479
645 Ga0501223_020721 3300049663 Bacteria 1287
646 Ga0501224_001820 3300049664 Bacteria 2874
647 Ga0501227_050931 3300049665 Unclassified 1044
648 Ga0501227_125348 3300049665 Bacteria 696
649 Ga0501230_002628 3300049667 Bacteria 2309
650 Ga0501230_070216 3300049667 Bacteria 720
651 Ga0501233_000801 3300049668 Bacteria 5270
652 Ga0501233_044975 3300049668 Unclassified 1051
653 Ga0501235_012415 3300049669 Bacteria 1873
654 Ga0501236_012954 3300049670 Unclassified 1133
655 Ga0501239_014248 3300049672 Bacteria 918
656 Ga0501239_047430 3300049672 Bacteria 612
657 Ga0501239_052852 3300049672 Bacteria 592
658 Ga0501242_016567 3300049674 Unclassified 924
659 Ga0501243_021120 3300049675 Bacteria 1074
660 Ga0501243_028532 3300049675 Unclassified 945
661 Ga0501249_022097 3300049679 Bacteria 1391
662 Ga0501249_055377 3300049679 Bacteria 914
663 Ga0501249_084989 3300049679 Bacteria 746
664 Ga0501250_023805 3300049680 Unclassified 811
665 Ga0501253_032489 3300049683 Bacteria 1005
666 Ga0501253_117999 3300049683 Unclassified 640
667 Ga0501256_007242 3300049685 Bacteria 1016
668 Ga0501257_027913 3300049686 Bacteria 1352
669 Ga0501259_021253 3300049688 Bacteria 1158
670 Ga0501261_027099 3300049690 Bacteria 851
671 Ga0501221_044626 3300049704 Unclassified 979
672 Ga0501225_0005135 3300049705 Bacteria 3855
673 Ga0501225_0140733 3300049705 Bacteria 729
674 Ga0501229_002712 3300049706 Bacteria 2092
675 Ga0501229_051019 3300049706 Bacteria 611
676 Ga0501234_001233 3300049707 Bacteria 4019
677 Ga0501245_006509 3300049708 Bacteria 1634
678 Ga0501079_0692538 3300049741 Bacteria 802
679 Ga0501241_060625 3300049758 Bacteria 759
680 Ga0501263_022016 3300049760 Bacteria 863
681 Ga0501268_111588 3300049765 Bacteria 597
682 Ga0501272_008028 3300049769 Unclassified 1153
683 Ga0501273_007563 3300049770 Bacteria 1281
684 Ga0501283_006170 3300049779 Bacteria 1670
685 Ga0501283_025347 3300049779 Bacteria 971
686 Ga0501044_1146916 3300049823 Bacteria 646
687 Ga0501200_03802 3300049849 Bacteria 669
688 Ga0501204_008498 3300049850 Bacteria 1174
689 Ga0501212_010825 3300049851 Bacteria 1306
690 Ga0501212_018645 3300049851 Bacteria 1058
691 Ga0501220_06552 3300049852 Bacteria 581
692 Ga0501226_006474 3300049853 Unclassified 1327
693 Ga0501226_027512 3300049853 Bacteria 640
694 nmdc:mga05p37_189463_c1 3300050507 Bacteria 2498
695 nmdc:mga05p37_234_c1 3300050507 Bacteria 56385
696 nmdc:mga05p37_415748_c1 3300050507 Bacteria 1566
697 nmdc:mga05p37_50778_c1 3300050507 Bacteria 5101
698 nmdc:mga05p37_818410_c1 3300050507 Bacteria 1016
699 nmdc:mga05p37_868722_c1 3300050507 Unclassified 977
700 nmdc:mga05p37_89863_c1 3300050507 Bacteria 3785
701 nmdc:mga09592_1977_c1 3300050508 Bacteria 16531
702 nmdc:mga09592_341663_c1 3300050508 Bacteria 1296
703 nmdc:mga09592_522257_c1 3300050508 Bacteria 1021
704 nmdc:mga0qj67_203740_c1 3300050509 Bacteria 1607
705 nmdc:mga0qj67_311498_c1 3300050509 Bacteria 1275
706 nmdc:mga0qj67_74674_c1 3300050509 Bacteria 2709
707 nmdc:mga06r32_1301588_c1 3300050510 Bacteria 671
708 nmdc:mga06r32_203980_c1 3300050510 Bacteria 1965
709 nmdc:mga06r32_578888_c1 3300050510 Unclassified 1095
710 nmdc:mga08y16_12478_c1 3300050511 Bacteria 8940
711 nmdc:mga08y16_316480_c1 3300050511 Bacteria 1607
712 nmdc:mga08y16_7183_c1 3300050511 Bacteria 11689
713 nmdc:mga08y16_998123_c1 3300050511 Archaea 817
714 nmdc:mga0n895_1832878_c1 3300050512 Bacteria 567
715 nmdc:mga0n895_351624_c1 3300050512 Archaea 1493
716 nmdc:mga0n895_37399_c1 3300050512 Bacteria 4695
717 nmdc:mga0n895_694768_c1 3300050512 Bacteria 1014
718 nmdc:mga0n895_780093_c1 3300050512 Bacteria 947
719 nmdc:mga0n895_834330_c1 3300050512 Unclassified 910
720 nmdc:mga0rr50_118755_c1 3300050513 Bacteria 2101
721 nmdc:mga0rr50_215476_c1 3300050513 Archaea 1584
722 nmdc:mga08x19_1210425_c1 3300050514 Bacteria 535
723 nmdc:mga08x19_144943_c1 3300050514 Bacteria 1606
724 nmdc:mga08x19_265718_c1 3300050514 Bacteria 1187
725 nmdc:mga0a205_120977_c1 3300050515 Bacteria 2517
726 nmdc:mga0a205_1455679_c1 3300050515 Bacteria 533
727 nmdc:mga0a205_20922_c1 3300050515 Bacteria 5523
728 nmdc:mga0a205_39282_c1 3300050515 Bacteria 4556
729 nmdc:mga0a205_511877_c1 3300050515 Bacteria 1057
730 nmdc:mga0a205_60517_c1 3300050515 Archaea 3657
731 nmdc:mga0a205_83349_c1 3300050515 Bacteria 3088
732 nmdc:mga0a205_92519_c1 3300050515 Bacteria 2922
733 Ga0501084_1371294 3300054114 Bacteria 592
734 Ga0590074_023713 3300059423 Bacteria 1065
735 Ga0530510_0331848 3300061734 Bacteria 1141
736 Ga0453684_0194605
737 SwRhRL2b_contig_830599
738 ARSoilOldRDRAFT_c003936
739 JGI24739J22299_10110220
740 JGI24739J22299_10126970
741 JGI24743J22301_10065101
742 JGI24751J29686_10000233
743 rootL2_10108684
744 Ga0065704_10149682
745 Ga0065704_10210722
746 Ga0065704_10253600
747 Ga0065704_10273750
748 Ga0065712_10002754
749 Ga0065712_10336319
750 Ga0065712_10775921
751 Ga0065715_10002637
752 Ga0065715_10025122
753 Ga0065715_10154339
754 Ga0065715_10376058
755 Ga0065715_10692371
756 Ga0065707_10025193
757 Ga0065707_10091010
758 Ga0065707_10149506
759 Ga0065707_10301646
760 Ga0065707_10442675
761 Ga0065707_10642731
762 Ga0070658_10930102
763 Ga0070676_10008369
764 Ga0070676_11079497
765 Ga0070683_100259631
766 Ga0070683_100426185
767 Ga0070690_100056742
768 Ga0070670_100000227
769 Ga0070670_100088322
770 Ga0070670_100333197
771 Ga0068869_100027502
772 Ga0068869_100655949
773 Ga0068869_100881843
774 Ga0068869_101522603
775 Ga0070682_100234666
776 Ga0070682_100264668
777 Ga0068868_100275533
778 Ga0070691_10421822
779 Ga0070687_100030159
780 Ga0070687_100580597
781 Ga0070661_100225615
782 Ga0070692_10094800
783 Ga0070692_10441661
784 Ga0070692_10524126
785 Ga0070669_101940542
786 Ga0070673_100342674
787 Ga0070673_102005663
788 Ga0070703_10000112
789 Ga0070703_10091368
790 Ga0070709_10000497
791 Ga0070709_10250387
792 Ga0070710_10025681
793 Ga0070701_10213891
794 Ga0070701_10216798
795 Ga0070701_10250809
796 Ga0070701_11125494
797 Ga0070711_100035865
798 Ga0070705_100052558
799 Ga0070705_100068438
800 Ga0070705_100073331
801 Ga0070705_100093988
802 Ga0070705_100639355
803 Ga0070705_100992375
804 Ga0070700_100000110
805 Ga0070700_100034977
806 Ga0070700_100751918
807 Ga0070694_100001664
808 Ga0070694_100038712
809 Ga0070694_100084938
810 Ga0070694_100149582
811 Ga0070694_100946048
812 Ga0070708_100002974
813 Ga0070708_100063942
814 Ga0070708_100382565
815 Ga0070708_100490579
816 Ga0070678_100236591
817 Ga0070681_10017224
818 Ga0068867_100140629
819 Ga0068867_101060172
820 Ga0068867_101806470
821 Ga0070706_100000125
822 Ga0070706_100344169
823 Ga0070707_100071115
824 Ga0070707_100144249
825 Ga0070707_100703839
826 Ga0070698_100007824
827 Ga0070698_100035872
828 Ga0070698_100105535
829 Ga0070699_100002333
830 Ga0070699_100009184
831 Ga0070699_100150374
832 Ga0070699_100320086
833 Ga0070699_101576601
834 Ga0070679_100038926
835 Ga0070679_100706184
836 Ga0070679_102154527
837 Ga0070684_100242853
838 Ga0070697_100223706
839 Ga0070697_100275067
840 Ga0070697_100790696
841 Ga0068853_100667568
842 Ga0068853_100991031
843 Ga0068853_101992922
844 Ga0070672_101019536
845 Ga0070686_100032089
846 Ga0070686_100113715
847 Ga0070695_100078018
848 Ga0070695_100317623
849 Ga0070695_100377566
850 Ga0070696_100222591
851 Ga0070693_100107401
852 Ga0070693_100184249
853 Ga0070693_100206185
854 Ga0070693_100336467
855 Ga0070693_100491255
856 Ga0070665_100015294
857 Ga0070704_100012650
858 Ga0070704_100436524
859 Ga0070704_100467489
860 Ga0070704_101004599
861 Ga0070704_101416077
862 Ga0070664_100390411
863 Ga0070664_101192177
864 Ga0068857_100019268
865 Ga0068857_100488095
866 Ga0068857_100811124
867 Ga0068857_101890413
868 Ga0068854_100078093
869 Ga0068854_100214136
870 Ga0068854_100231108
871 Ga0068854_100675688
872 Ga0068856_100294308
873 Ga0068856_100606911
874 Ga0070702_100008463
875 Ga0070702_100083592
876 Ga0070702_100098100
877 Ga0068852_100564081
878 Ga0068859_100005956
879 Ga0068859_100016039
880 Ga0068859_100061637
881 Ga0068859_100117825
882 Ga0068859_100266400
883 Ga0068859_100291942
884 Ga0068859_100316808
885 Ga0068859_100399041
886 Ga0068859_100500506
887 Ga0068859_100596732
888 Ga0068859_101274975
889 Ga0068859_101325256
890 Ga0068864_100064570
891 Ga0068864_100215296
892 Ga0068864_100266487
893 Ga0068864_100409597
894 Ga0068864_100486273
895 Ga0068864_101025348
896 Ga0068864_101073627
897 Ga0068866_10125579
898 Ga0068861_100103880
899 Ga0068861_100292087
900 Ga0068870_10128473
901 Ga0068870_10184695
902 Ga0068863_100220369
903 Ga0068863_100220430
904 Ga0068863_100584937
905 Ga0068863_101234045
906 Ga0068863_101583138
907 Ga0068863_102029759
908 Ga0068858_100096208
909 Ga0068858_100189019
910 Ga0068858_100209450
911 Ga0068858_100504025
912 Ga0068858_100516458
913 Ga0068858_101022931
914 Ga0068858_101251309
915 Ga0068858_102560518
916 Ga0068860_100039244
917 Ga0068860_100274456
918 Ga0068860_100295619
919 Ga0068860_100429332
920 Ga0068860_101277188
921 Ga0068862_100578068
922 Ga0068862_100623423
923 Ga0068862_101702498
924 Ga0081538_10277857
925 Ga0081539_10240214
926 Ga0070715_10006993
927 Ga0070716_100002793
928 Ga0070716_100574634
929 Ga0070712_100082624
930 Ga0097621_100034180
931 Ga0097621_100240057
932 Ga0068871_100006206
933 Ga0068871_100096083
934 Ga0068871_100466677
935 Ga0075428_100067874
936 Ga0075428_100470222
937 Ga0075428_101941859
938 Ga0075428_102631405
939 Ga0075430_100028772
940 Ga0075430_100151065
941 Ga0075430_100217688
942 Ga0075431_100073867
943 Ga0075431_100134908
944 Ga0075431_100334483
945 Ga0075433_10011055
946 Ga0075433_10028365
947 Ga0075433_10060519
948 Ga0075433_10072241
949 Ga0075433_10150870
950 Ga0075433_10219254
951 Ga0075433_10597636
952 Ga0075433_10726050
953 Ga0075433_11121084
954 Ga0075434_100610695
955 Ga0075429_100002912
956 Ga0075429_100206166
957 Ga0075429_100362277
958 Ga0068865_100378563
959 Ga0075436_100102764
960 Ga0075436_100676550
961 Ga0097620_100005956
962 Ga0097620_100016039
963 Ga0097620_100061636
964 Ga0097620_100117823
965 Ga0097620_100266404
966 Ga0097620_100291945
967 Ga0097620_100316801
968 Ga0097620_100399080
969 Ga0097620_100500500
970 Ga0097620_100596710
971 Ga0097620_101274981
972 Ga0097620_101325168
973 Ga0075435_100223383
974 Ga0105251_10242928
975 Ga0105251_10370171
976 Ga0105240_10310141
977 Ga0105240_10465098
978 Ga0105240_10471245
979 Ga0105240_11762911
980 Ga0111539_10031691
981 Ga0111539_10057182
982 Ga0111539_10564471
983 Ga0111539_10908648
984 Ga0111539_11181959
985 Ga0111539_13515789
986 Ga0105245_10276384
987 Ga0105245_10322131
988 Ga0105245_11188529
989 Ga0105245_11763825
990 Ga0105247_10001051
991 Ga0105247_10196874
992 Ga0105247_10236741
993 Ga0105247_11158484
994 Ga0105247_11622183
995 Ga0114129_10052303
996 Ga0114129_10060671
997 Ga0114129_10089963
998 Ga0114129_10102281
999 Ga0114129_10324393
1000 Ga0114129_11011814
1001 Ga0114129_11030980
1002 Ga0114129_11316089
1003 Ga0114129_11795688
1004 Ga0114129_11890346
1005 Ga0114129_12287770
1006 Ga0105243_10103715
1007 Ga0105243_10195333
1008 Ga0105243_10202398
1009 Ga0105243_10519752
1010 Ga0105243_10555174
1011 Ga0105243_10574959
1012 Ga0105243_10803853
1013 Ga0105243_11002619
1014 Ga0105243_11299457
1015 Ga0105243_12211111
1016 Ga0105241_10037519
1017 Ga0105241_10061500
1018 Ga0105241_10080344
1019 Ga0105241_10141442
1020 Ga0105241_10172902
1021 Ga0105241_10468220
1022 Ga0105241_10795383
1023 Ga0105242_10029970
1024 Ga0105242_10463176
1025 Ga0105242_10654150
1026 Ga0105242_11357440
1027 Ga0105248_10001795
1028 Ga0105248_10006777
1029 Ga0105248_10266171
1030 Ga0105248_10502699
1031 Ga0105248_10530663
1032 Ga0105248_11072486
1033 Ga0105248_13299968
1034 Ga0105237_10304812
1035 Ga0105237_10345175
1036 Ga0105237_10508931
1037 Ga0105238_10241019
1038 Ga0105238_10258589
1039 Ga0105249_10063743
1040 Ga0105249_10115789
1041 Ga0105249_10939339
1042 Ga0105239_10137693
1043 Ga0105239_10357418
1044 Ga0105239_10417570
1045 Ga0105239_11193055
1046 Ga0105246_10067191
1047 Ga0105246_10198433
1048 Ga0105246_10560554
1049 Ga0157339_1027500
1050 Ga0157338_1083837
1051 Ga0157373_10256616
1052 Ga0157373_11023305
1053 Ga0157371_11192004
1054 Ga0157371_11538123
1055 Ga0157369_10588288
1056 Ga0157369_12009304
1057 Ga0157374_10033334
1058 Ga0157374_10173080
1059 Ga0157374_10541998
1060 Ga0157374_11024154
1061 Ga0157378_10014873
1062 Ga0157378_10041776
1063 Ga0157378_10208158
1064 Ga0157378_10261556
1065 Ga0157378_10303944
1066 Ga0157378_10722547
1067 Ga0157378_11724246
1068 Ga0157378_12349426
1069 Ga0163162_10054248
1070 Ga0163162_10085281
1071 Ga0163162_10141456
1072 Ga0163162_10530367
1073 Ga0163162_10554069
1074 Ga0163162_10584982
1075 Ga0163162_11020011
1076 Ga0163162_12169313
1077 Ga0157372_10194105
1078 Ga0157375_11012371
1079 Ga0157375_11553431
1080 Ga0157375_12974070
1081 Ga0163163_10000277
1082 Ga0163163_10011916
1083 Ga0163163_10144926
1084 Ga0163163_10451479
1085 Ga0163163_10629696
1086 Ga0157380_10046154
1087 Ga0157380_10258219
1088 Ga0157380_10635783
1089 Ga0157380_12967530
1090 Ga0157377_10081697
1091 Ga0157377_10132505
1092 Ga0157377_10159816
1093 Ga0157379_10052260
1094 Ga0157379_11067337
1095 Ga0157379_11203147
1096 Ga0157376_10015328
1097 Ga0157376_10059076
1098 Ga0157376_11472994
1099 Ga0157376_12219680
1100 Ga0163161_11183266
1101 Ga0207656_10443574
1102 Ga0207653_10000027
1103 Ga0207692_10214945
1104 Ga0207642_10288586
1105 Ga0207642_10336784
1106 Ga0207688_10080108
1107 Ga0207688_10551373
1108 Ga0207647_10004971
1109 Ga0207647_10217928
1110 Ga0207685_10006894
1111 Ga0207699_10103029
1112 Ga0207699_10828331
1113 Ga0207645_10987127
1114 Ga0207643_10032725
1115 Ga0207643_10203918
1116 Ga0207684_10000130
1117 Ga0207654_10183828
1118 Ga0207654_10241357
1119 Ga0207654_10243594
1120 Ga0207654_10866633
1121 Ga0207707_10102077
1122 Ga0207707_10294142
1123 Ga0207695_10062816
1124 Ga0207671_10586058
1125 Ga0207693_10084881
1126 Ga0207663_10003003
1127 Ga0207660_10525164
1128 Ga0207662_10026825
1129 Ga0207662_10445577
1130 Ga0207662_11124443
1131 Ga0207662_11232489
1132 Ga0207657_11056727
1133 Ga0207652_10283732
1134 Ga0207652_11771199
1135 Ga0207646_10020280
1136 Ga0207646_10096525
1137 Ga0207681_10014337
1138 Ga0207694_10003503
1139 Ga0207694_10071194
1140 Ga0207650_10000027
1141 Ga0207650_10052605
1142 Ga0207650_10677914
1143 Ga0207687_10256495
1144 Ga0207706_10735204
1145 Ga0207686_10269887
1146 Ga0207686_10696869
1147 Ga0207709_10043082
1148 Ga0207709_10117104
1149 Ga0207709_10408410
1150 Ga0207709_10483023
1151 Ga0207670_10200592
1152 Ga0207670_11330589
1153 Ga0207665_10024003
1154 Ga0207691_10553404
1155 Ga0207691_10578154
1156 Ga0207711_10005876
1157 Ga0207711_10038047
1158 Ga0207711_10071805
1159 Ga0207711_10453538
1160 Ga0207711_11062235
1161 Ga0207689_10015307
1162 Ga0207689_10237875
1163 Ga0207689_10357145
1164 Ga0207689_10586249
1165 Ga0207689_11090794
1166 Ga0207661_10141807
1167 Ga0207661_11519399
1168 Ga0207679_10853928
1169 Ga0207679_11696272
1170 Ga0207679_11835157
1171 Ga0207651_10211369
1172 Ga0207651_10394548
1173 Ga0207651_10494178
1174 Ga0207651_11196179
1175 Ga0207712_10057719
1176 Ga0207712_10105897
1177 Ga0207640_10104523
1178 Ga0207640_10224734
1179 Ga0207658_10476418
1180 Ga0207677_10546098
1181 Ga0207703_10081204
1182 Ga0207703_10223068
1183 Ga0207703_10286651
1184 Ga0207703_11370944
1185 Ga0207639_11838065
1186 Ga0207708_10000028
1187 Ga0207708_10017384
1188 Ga0207708_10053117
1189 Ga0207708_10144443
1190 Ga0207708_10505524
1191 Ga0207702_10218768
1192 Ga0207641_10394726
1193 Ga0207641_10792300
1194 Ga0207641_10851322
1195 Ga0207641_11210833
1196 Ga0207641_11549417
1197 Ga0207648_10032182
1198 Ga0207648_10059837
1199 Ga0207648_10148635
1200 Ga0207648_10150716
1201 Ga0207648_10535380
1202 Ga0207676_10128886
1203 Ga0207676_10373507
1204 Ga0207674_10026983
1205 Ga0207674_10079621
1206 Ga0207674_10449400
1207 Ga0207674_10529151
1208 Ga0207674_10585392
1209 Ga0207674_11167275
1210 Ga0207675_100062682
1211 Ga0207675_100313772
1212 Ga0207675_100978310
1213 Ga0207675_102423223
1214 Ga0207683_10074588
1215 Ga0207698_10309892
1216 Ga0207698_10350129
1217 Ga0207698_11385985
1218 Ga0207428_10017260
1219 Ga0268265_10096775
1220 Ga0268264_10159252
1221 Ga0268264_10205016
1222 Ga0268264_10523570
1223 Ga0268264_10536780
1224 Ga0268264_10890958
1225 Ga0265319_1039615
1226 Ga0265318_10026566
1227 Ga0265336_10078788
1228 Ga0265338_10000025
1229 Ga0265338_10052712
1230 Ga0265338_10064414
1231 Ga0265324_10031562
1232 Ga0316182_1105733
1233 Ga0265325_10002394
1234 Ga0265325_10121315
1235 Ga0265340_10295857
1236 Ga0265339_10182296
1237 Ga0265316_10082646
1238 Ga0307408_100633616
1239 Ga0316579_10130494
1240 Ga0316579_10144764
1241 Ga0316579_10193656
1242 Ga0265314_10278573
1243 Ga0316576_10002781
1244 Ga0316576_10016609
1245 Ga0316576_10061512
1246 Ga0316578_10031833
1247 Ga0316578_10082727
1248 Ga0316578_10255932
1249 Ga0307405_10045886
1250 Ga0307405_10251660
1251 Ga0316577_10016492
1252 Ga0316577_10033722
1253 Ga0316577_10266961
1254 Ga0316577_10281787
1255 Ga0316577_10299913
1256 Ga0307413_10552501
1257 Ga0307413_10712723
1258 Ga0307410_10071635
1259 Ga0307410_11330155
1260 Ga0307406_10019144
1261 Ga0307412_10125244
1262 Ga0307416_100196502
1263 Ga0307416_101374927
1264 Ga0307416_101533139
1265 Ga0307414_10001533
1266 Ga0307414_10708611
1267 Ga0307414_10791978
1268 Ga0307411_10194120
1269 Ga0307411_10294641
1270 Ga0307411_11063229
1271 Ga0307415_100025330
1272 Ga0373930_0064614
1273 Ga0373941_0052781
1274 Ga0373943_0662523
1275 Ga0373943_0776857
1276 Ga0316574_0130667
1277 Ga0316574_0174893
1278 Ga0373924_0434147
1279 Ga0373931_0361402
1280 Ga0373937_0104524
1281 Ga0373937_0507598
1282 Ga0316582_0019289
1283 Ga0316582_0048650
1284 Ga0316582_0190411
1285 Ga0316582_0601446
1286 Ga0316584_0012464
1287 Ga0316584_0044456
1288 Ga0316584_0076991
1289 Ga0316584_0229920
1290 Ga0316584_0355625
1291 Ga0373925_0741941
1292 Ga0395900_0085691
1293 Ga0395900_1157067
1294 Ga0395898_0363545
1295 Ga0395905_0705454
1296 Ga0316581_0058858
1297 Ga0436364_0222681
1298 Ga0436364_0523199
1299 Ga0395901_0318045
1300 Ga0395901_0898177
1301 Ga0400489_42784
1302 Ga0400489_50738
1303 Ga0436360_0584398
1304 Ga0436362_0629763
1305 Ga0451839_1040140
1306 Ga0439443_094807
1307 Ga0451577_0820660
1308 Ga0453683_0002587
1309 Ga0453683_0334417
1310 Ga0453684_0017704
1311 Ga0453684_0035067
1312 Ga0453684_0158868
1313 Ga0453684_0331407
1314 Ga0453684_0485496
1315 Ga0453684_1279722
1316 Ga0453684_2093802
1317 Ga0451576_0885065
1318 Ga0451576_0939981
1319 Ga0451576_1107269
1320 Ga0495618_0012029
1321 Ga0495618_0305037
1322 Ga0495640_0296927
1323 Ga0495586_0217339
1324 Ga0495622_0008910
1325 Ga0495657_0093949
1326 Ga0495658_0484553
1327 Ga0495613_0002983
1328 Ga0495604_0560251
1329 Ga0495674_0067329
1330 Ga0495676_0657302
1331 Ga0495675_0091363
1332 Ga0495684_0073663
1333 Ga0495684_0417741
1334 Ga0496100_0647664
1335 Ga0496101_0105679
1336 Ga0496102_0241419
1337 Ga0496104_0521492
1338 Ga0496106_0079194
1339 Ga0496106_1119129
1340 Ga0496107_0037942
1341 Ga0496108_0197856
1342 Ga0496109_0365237
1343 Ga0496110_0190532
1344 Ga0496111_0205568
1345 Ga0496112_0961705
1346 Ga0496113_0108155
1347 Ga0496114_0368502
1348 Ga0501292_024355
1349 Ga0501294_014529
1350 Ga0501297_048505
1351 Ga0501298_118264
1352 Ga0501298_135647
1353 Ga0501303_007894
1354 Ga0501312_021466
1355 Ga0501032_0026177
1356 Ga0501037_0004823
1357 Ga0501038_0004530
1358 Ga0501038_0915360
1359 Ga0501039_0240188
1360 Ga0501039_1082003
1361 Ga0501043_0915573
1362 Ga0501046_0031731
1363 Ga0501047_0132499
1364 Ga0501070_0089531
1365 Ga0501071_0515766
1366 Ga0501075_0731943
1367 Ga0501076_0201357
1368 Ga0501076_0596760
1369 Ga0501198_000807
1370 Ga0501202_059651
1371 Ga0501202_175370
1372 Ga0501207_009058
1373 Ga0501207_054048
1374 Ga0501209_003691
1375 Ga0501209_161490
1376 Ga0501217_103102
1377 Ga0501217_125741
1378 Ga0501223_000424
1379 Ga0501223_016100
1380 Ga0501223_020721
1381 Ga0501224_001820
1382 Ga0501227_050931
1383 Ga0501227_125348
1384 Ga0501230_002628
1385 Ga0501230_070216
1386 Ga0501233_000801
1387 Ga0501233_044975
1388 Ga0501235_012415
1389 Ga0501236_012954
1390 Ga0501239_014248
1391 Ga0501239_047430
1392 Ga0501239_052852
1393 Ga0501242_016567
1394 Ga0501243_021120
1395 Ga0501243_028532
1396 Ga0501249_022097
1397 Ga0501249_055377
1398 Ga0501249_084989
1399 Ga0501250_023805
1400 Ga0501253_032489
1401 Ga0501253_117999
1402 Ga0501256_007242
1403 Ga0501257_027913
1404 Ga0501259_021253
1405 Ga0501261_027099
1406 Ga0501221_044626
1407 Ga0501225_0005135
1408 Ga0501225_0140733
1409 Ga0501229_002712
1410 Ga0501229_051019
1411 Ga0501234_001233
1412 Ga0501245_006509
1413 Ga0501079_0692538
1414 Ga0501241_060625
1415 Ga0501263_022016
1416 Ga0501268_111588
1417 Ga0501272_008028
1418 Ga0501273_007563
1419 Ga0501283_006170
1420 Ga0501283_025347
1421 Ga0501044_1146916
1422 Ga0501200_03802
1423 Ga0501204_008498
1424 Ga0501212_010825
1425 Ga0501212_018645
1426 Ga0501220_06552
1427 Ga0501226_006474
1428 Ga0501226_027512
1429 nmdc:mga05p37_189463_c1
1430 nmdc:mga05p37_234_c1
1431 nmdc:mga05p37_415748_c1
1432 nmdc:mga05p37_50778_c1
1433 nmdc:mga05p37_818410_c1
1434 nmdc:mga05p37_868722_c1
1435 nmdc:mga05p37_89863_c1
1436 nmdc:mga09592_1977_c1
1437 nmdc:mga09592_341663_c1
1438 nmdc:mga09592_522257_c1
1439 nmdc:mga0qj67_203740_c1
1440 nmdc:mga0qj67_311498_c1
1441 nmdc:mga0qj67_74674_c1
1442 nmdc:mga06r32_1301588_c1
1443 nmdc:mga06r32_203980_c1
1444 nmdc:mga06r32_578888_c1
1445 nmdc:mga08y16_12478_c1
1446 nmdc:mga08y16_316480_c1
1447 nmdc:mga08y16_7183_c1
1448 nmdc:mga08y16_998123_c1
1449 nmdc:mga0n895_1832878_c1
1450 nmdc:mga0n895_351624_c1
1451 nmdc:mga0n895_37399_c1
1452 nmdc:mga0n895_694768_c1
1453 nmdc:mga0n895_780093_c1
1454 nmdc:mga0n895_834330_c1
1455 nmdc:mga0rr50_118755_c1
1456 nmdc:mga0rr50_215476_c1
1457 nmdc:mga08x19_1210425_c1
1458 nmdc:mga08x19_144943_c1
1459 nmdc:mga08x19_265718_c1
1460 nmdc:mga0a205_120977_c1
1461 nmdc:mga0a205_1455679_c1
1462 nmdc:mga0a205_20922_c1
1463 nmdc:mga0a205_39282_c1
1464 nmdc:mga0a205_511877_c1
1465 nmdc:mga0a205_60517_c1
1466 nmdc:mga0a205_83349_c1
1467 nmdc:mga0a205_92519_c1
1468 Ga0501084_1371294
1469 Ga0590074_023713
1470 Ga0530510_0331848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

41

156

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.988 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9728 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9659 1 139
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9643 5 137
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.9524 5 139
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9724 1 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9655 1 139 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9527 5 139 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9416 6 137 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9323 5 139 2.60.120.460
ID Description Score Start End GO Terms
AF-C8W673-F1-model_v4 Polynucleotide adenylyltransferase/metal dependent phosphohydrolase (EC 2.7.7.72) 0.9987 1 139 GO:0000049
GO:0000166
GO:0008033
GO:0016787
GO:0160016
AF-A7C3B4-F1-model_v4 deleted 0.9973 2 139
AF-A0A1V4XI05-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9969 2 139
AF-A0A524H0L6-F1-model_v4 YjbQ family protein 0.9961 1 139
AF-A0A2N5YRF0-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9951 1 139

Map