F478031

General Info

Members Datasets Scaffolds Average Seq Length
732 273 1464 262

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10279580|Ga0111539_102795802
Length 280
Sequence VGLVAGSRHRRRVLLMSPIAWQAGSITVAGTTVNVTRAGRGAPVLVLHHDIGSPAAVPFADTLAQQFTVIRPSHPGYDGSARPDWMRSVRDIAVVYQGLLAEDTATRGRSDVSVIGLGFGGWIAAEMATMAPRAFHRLVLVGAMGIKPERGDIFDQALVSYLDYAQAGFAERSAFERVYGAEPPTAMLEQWDLNREMTFRIAWKPYMYNPTLPHLLGAVGAPALVVWGRQDRIVPLECGERYAKLLPRARLELVDGAGHLVDMEKPDVLASLVTRFLSEA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 0
Rhizoplane 0.82
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10279580 3300009094 Bacteria 1942
2 JGI25406J46586_10032880 3300003203 Bacteria 1922
3 JGI26128J50194_1001222 3300003347 Bacteria 1605
4 JGI25405J52794_10017385 3300003911 Bacteria 1427
5 Ga0065707_10018562 3300005295 Bacteria 2448
6 Ga0070676_10017806 3300005328 Bacteria 3933
7 Ga0070676_10134219 3300005328 Bacteria 1569
8 Ga0070683_100047433 3300005329 Bacteria 3969
9 Ga0070690_100124733 3300005330 Bacteria 1732
10 Ga0070690_100151503 3300005330 Bacteria 1583
11 Ga0070690_100174810 3300005330 Bacteria 1480
12 Ga0070670_100013240 3300005331 Bacteria 7066
13 Ga0068869_100012226 3300005334 Bacteria 5665
14 Ga0068869_100016723 3300005334 Bacteria 4950
15 Ga0070680_100012479 3300005336 Bacteria 6604
16 Ga0070680_100070100 3300005336 Bacteria 2879
17 Ga0070680_100180106 3300005336 Bacteria 1780
18 Ga0070680_100484965 3300005336 Bacteria 1057
19 Ga0070682_100002633 3300005337 Bacteria 9917
20 Ga0070682_100359995 3300005337 Bacteria 1087
21 Ga0070660_100010506 3300005339 Bacteria 6541
22 Ga0070689_100037684 3300005340 Bacteria 3697
23 Ga0070689_100227970 3300005340 Bacteria 1530
24 Ga0070661_100077375 3300005344 Bacteria 2452
25 Ga0070692_10000628 3300005345 Bacteria 11134
26 Ga0070692_10036323 3300005345 Bacteria 2499
27 Ga0070668_100294806 3300005347 Bacteria 1359
28 Ga0070669_100015281 3300005353 Bacteria 5469
29 Ga0070669_100228581 3300005353 Bacteria 1474
30 Ga0070669_100595253 3300005353 Bacteria 926
31 Ga0070675_100482348 3300005354 Bacteria 1115
32 Ga0070673_100462554 3300005364 Bacteria 1142
33 Ga0070659_100000818 3300005366 Bacteria 22732
34 Ga0070667_100400216 3300005367 Bacteria 1250
35 Ga0070703_10023507 3300005406 Bacteria 1816
36 Ga0070713_100034481 3300005436 Bacteria 4067
37 Ga0070711_100025953 3300005439 Bacteria 3836
38 Ga0070711_100297221 3300005439 Bacteria 1283
39 Ga0070705_100004975 3300005440 Bacteria 6472
40 Ga0070705_100008202 3300005440 Bacteria 5168
41 Ga0070694_100004473 3300005444 Bacteria 8406
42 Ga0070694_100007779 3300005444 Bacteria 6539
43 Ga0070694_100022574 3300005444 Bacteria 4033
44 Ga0070694_100118225 3300005444 Bacteria 1898
45 Ga0070694_100143549 3300005444 Bacteria 1736
46 Ga0070694_100330637 3300005444 Bacteria 1175
47 Ga0070708_100007637 3300005445 Bacteria 8662
48 Ga0070708_100012015 3300005445 Bacteria 7057
49 Ga0070708_100056105 3300005445 Bacteria 3503
50 Ga0070708_100092213 3300005445 Bacteria 2760
51 Ga0070708_100246119 3300005445 Bacteria 1679
52 Ga0070708_100256131 3300005445 Bacteria 1644
53 Ga0070663_100012303 3300005455 Bacteria 5408
54 Ga0070678_100008334 3300005456 Bacteria 6206
55 Ga0070662_100009000 3300005457 Bacteria 6514
56 Ga0070662_100016023 3300005457 Bacteria 5029
57 Ga0070662_100207415 3300005457 Bacteria 1558
58 Ga0068867_100021117 3300005459 Bacteria 4644
59 Ga0070706_100020267 3300005467 Bacteria 6129
60 Ga0070706_100105509 3300005467 Bacteria 2621
61 Ga0070706_100114524 3300005467 Bacteria 2511
62 Ga0070706_100220057 3300005467 Bacteria 1772
63 Ga0070706_100507555 3300005467 Bacteria 1122
64 Ga0070707_100011004 3300005468 Bacteria 8427
65 Ga0070707_100028928 3300005468 Bacteria 5274
66 Ga0070707_100041080 3300005468 Bacteria 4426
67 Ga0070707_100245969 3300005468 Bacteria 1741
68 Ga0070707_100329124 3300005468 Bacteria 1484
69 Ga0070707_100443988 3300005468 Bacteria 1258
70 Ga0070698_100007463 3300005471 Bacteria 11829
71 Ga0070698_100018371 3300005471 Bacteria 7361
72 Ga0070698_100036496 3300005471 Bacteria 5076
73 Ga0070698_100179506 3300005471 Bacteria 2056
74 Ga0070698_100197889 3300005471 Bacteria 1946
75 Ga0070698_100504865 3300005471 Bacteria 1147
76 Ga0070699_100012237 3300005518 Bacteria 7404
77 Ga0070699_100092967 3300005518 Bacteria 2638
78 Ga0070699_100158101 3300005518 Bacteria 2005
79 Ga0070699_100249501 3300005518 Bacteria 1585
80 Ga0070699_100320163 3300005518 Bacteria 1394
81 Ga0070699_100527355 3300005518 Bacteria 1074
82 Ga0070679_100004125 3300005530 Bacteria 13394
83 Ga0070684_100264160 3300005535 Bacteria 1575
84 Ga0070697_100031089 3300005536 Bacteria 4292
85 Ga0070697_100032208 3300005536 Bacteria 4217
86 Ga0070697_100110449 3300005536 Bacteria 2291
87 Ga0068853_100064434 3300005539 Bacteria 3178
88 Ga0068853_100272262 3300005539 Bacteria 1559
89 Ga0070672_100101360 3300005543 Bacteria 2336
90 Ga0070686_100023516 3300005544 Bacteria 3684
91 Ga0070695_100001263 3300005545 Bacteria 13915
92 Ga0070695_100003353 3300005545 Bacteria 9359
93 Ga0070695_100003683 3300005545 Bacteria 8931
94 Ga0070695_100008735 3300005545 Bacteria 6020
95 Ga0070696_100002860 3300005546 Bacteria 11478
96 Ga0070696_100016002 3300005546 Bacteria 5044
97 Ga0070696_100053547 3300005546 Bacteria 2809
98 Ga0070696_100063264 3300005546 Bacteria 2592
99 Ga0070696_100152640 3300005546 Bacteria 1696
100 Ga0070693_100000604 3300005547 Bacteria 15892
101 Ga0070693_100095003 3300005547 Bacteria 1805
102 Ga0070665_100119438 3300005548 Bacteria 2638
103 Ga0070665_100402708 3300005548 Bacteria 1376
104 Ga0070704_100036103 3300005549 Bacteria 3365
105 Ga0070704_100112354 3300005549 Bacteria 2076
106 Ga0070704_100125961 3300005549 Bacteria 1976
107 Ga0070704_100138215 3300005549 Bacteria 1898
108 Ga0070704_100150919 3300005549 Bacteria 1827
109 Ga0070704_100212999 3300005549 Bacteria 1567
110 Ga0070704_100263203 3300005549 Bacteria 1422
111 Ga0070704_100397274 3300005549 Bacteria 1175
112 Ga0068855_100004425 3300005563 Bacteria 17170
113 Ga0068855_100416844 3300005563 Bacteria 1469
114 Ga0070664_100044225 3300005564 Bacteria 3760
115 Ga0068857_100086536 3300005577 Bacteria 2802
116 Ga0068857_100141604 3300005577 Bacteria 2174
117 Ga0068857_100149578 3300005577 Bacteria 2115
118 Ga0068854_100001692 3300005578 Bacteria 13424
119 Ga0068856_100002103 3300005614 Bacteria 20655
120 Ga0068856_100228896 3300005614 Bacteria 1874
121 Ga0068852_100173952 3300005616 Bacteria 2020
122 Ga0068852_100587483 3300005616 Bacteria 1117
123 Ga0068859_100011476 3300005617 Bacteria 8908
124 Ga0068859_100070823 3300005617 Bacteria 3522
125 Ga0068859_100166564 3300005617 Bacteria 2284
126 Ga0068859_100634668 3300005617 Bacteria 1160
127 Ga0068864_100019210 3300005618 Bacteria 5712
128 Ga0068864_100381993 3300005618 Bacteria 1335
129 Ga0068861_100079955 3300005719 Bacteria 2557
130 Ga0068870_10070595 3300005840 Bacteria 1904
131 Ga0068863_100126007 3300005841 Bacteria 2443
132 Ga0068863_100153511 3300005841 Bacteria 2204
133 Ga0068863_100162568 3300005841 Bacteria 2140
134 Ga0068860_100012365 3300005843 Bacteria 8410
135 Ga0068860_100017833 3300005843 Bacteria 6913
136 Ga0068860_100053944 3300005843 Bacteria 3821
137 Ga0068860_100109202 3300005843 Bacteria 2644
138 Ga0068862_100032906 3300005844 Bacteria 4379
139 Ga0068862_100066959 3300005844 Bacteria 3096
140 Ga0081455_10000060 3300005937 Bacteria 119012
141 Ga0081455_10000637 3300005937 Bacteria 45442
142 Ga0081455_10009675 3300005937 Bacteria 9886
143 Ga0081455_10067455 3300005937 Bacteria 2981
144 Ga0081538_10001131 3300005981 Bacteria 28183
145 Ga0081540_1015870 3300005983 Bacteria 4747
146 Ga0081539_10000044 3300005985 Bacteria 284021
147 Ga0081539_10003955 3300005985 Bacteria 17165
148 Ga0081539_10005454 3300005985 Bacteria 12974
149 Ga0070717_10527263 3300006028 Bacteria 1069
150 Ga0075365_10015709 3300006038 Bacteria 4585
151 Ga0075368_10144391 3300006042 Bacteria 993
152 Ga0075363_100126074 3300006048 Bacteria 1433
153 Ga0075363_100137773 3300006048 Bacteria 1372
154 Ga0075432_10049257 3300006058 Bacteria 1484
155 Ga0070716_100014911 3300006173 Bacteria 3987
156 Ga0070716_100055197 3300006173 Bacteria 2272
157 Ga0070712_100083353 3300006175 Bacteria 2321
158 Ga0075362_10003030 3300006177 Bacteria 5777
159 Ga0075362_10018626 3300006177 Bacteria 2876
160 Ga0075362_10018754 3300006177 Bacteria 2867
161 Ga0075362_10067858 3300006177 Bacteria 1623
162 Ga0075367_10016984 3300006178 Bacteria 3985
163 Ga0075367_10073608 3300006178 Bacteria 2059
164 Ga0075367_10311979 3300006178 Bacteria 991
165 Ga0075369_10005171 3300006186 Bacteria 4863
166 Ga0075369_10027644 3300006186 Bacteria 2372
167 Ga0075366_10077802 3300006195 Bacteria 1979
168 Ga0075366_10119851 3300006195 Bacteria 1585
169 Ga0075366_10394591 3300006195 Bacteria 851
170 Ga0075366_10416128 3300006195 Bacteria 828
171 Ga0097621_100159410 3300006237 Bacteria 1939
172 Ga0075370_10074598 3300006353 Bacteria 1944
173 Ga0075370_10086062 3300006353 Bacteria 1810
174 Ga0075370_10196769 3300006353 Bacteria 1188
175 Ga0075428_100005380 3300006844 Bacteria 14235
176 Ga0075428_100005808 3300006844 Bacteria 13706
177 Ga0075428_100007462 3300006844 Bacteria 12114
178 Ga0075428_100012568 3300006844 Bacteria 9413
179 Ga0075428_100026502 3300006844 Bacteria 6416
180 Ga0075428_100066754 3300006844 Bacteria 3938
181 Ga0075428_100104955 3300006844 Bacteria 3082
182 Ga0075428_100206885 3300006844 Bacteria 2121
183 Ga0075428_100222848 3300006844 Bacteria 2036
184 Ga0075428_100411698 3300006844 Bacteria 1449
185 Ga0075430_100000104 3300006846 Bacteria 50931
186 Ga0075430_100005124 3300006846 Bacteria 11032
187 Ga0075430_100014071 3300006846 Bacteria 6820
188 Ga0075430_100055487 3300006846 Bacteria 3331
189 Ga0075430_100073010 3300006846 Bacteria 2877
190 Ga0075430_100187697 3300006846 Bacteria 1719
191 Ga0075430_100249415 3300006846 Unclassified 1471
192 Ga0075431_100000744 3300006847 Bacteria 28129
193 Ga0075431_100001263 3300006847 Bacteria 23035
194 Ga0075431_100002958 3300006847 Bacteria 16443
195 Ga0075431_100006226 3300006847 Bacteria 11852
196 Ga0075431_100009171 3300006847 Bacteria 9922
197 Ga0075431_100030094 3300006847 Bacteria 5590
198 Ga0075431_100033914 3300006847 Bacteria 5260
199 Ga0075431_100050763 3300006847 Bacteria 4276
200 Ga0075431_100099116 3300006847 Bacteria 3007
201 Ga0075431_100210836 3300006847 Bacteria 1984
202 Ga0075433_10000689 3300006852 Bacteria 23036
203 Ga0075433_10001833 3300006852 Bacteria 15943
204 Ga0075433_10002923 3300006852 Bacteria 13108
205 Ga0075433_10007237 3300006852 Bacteria 8790
206 Ga0075433_10012554 3300006852 Bacteria 6848
207 Ga0075433_10014201 3300006852 Bacteria 6501
208 Ga0075433_10027748 3300006852 Bacteria 4806
209 Ga0075433_10031474 3300006852 Bacteria 4536
210 Ga0075433_10044466 3300006852 Bacteria 3858
211 Ga0075433_10060999 3300006852 Bacteria 3303
212 Ga0075433_10126848 3300006852 Bacteria 2266
213 Ga0075433_10173945 3300006852 Bacteria 1916
214 Ga0075433_10194339 3300006852 Bacteria 1805
215 Ga0075433_10469349 3300006852 Bacteria 1109
216 Ga0075434_100002812 3300006871 Bacteria 15417
217 Ga0075434_100011407 3300006871 Bacteria 8383
218 Ga0075434_100028924 3300006871 Bacteria 5449
219 Ga0075434_100035476 3300006871 Bacteria 4931
220 Ga0075434_100063159 3300006871 Bacteria 3686
221 Ga0075434_100070517 3300006871 Bacteria 3485
222 Ga0075434_100138725 3300006871 Bacteria 2451
223 Ga0075434_100177102 3300006871 Bacteria 2152
224 Ga0075434_100262420 3300006871 Bacteria 1746
225 Ga0075434_100288595 3300006871 Bacteria 1660
226 Ga0075429_100004295 3300006880 Bacteria 12238
227 Ga0075429_100011495 3300006880 Bacteria 7675
228 Ga0075429_100011744 3300006880 Bacteria 7596
229 Ga0075429_100015165 3300006880 Bacteria 6679
230 Ga0075429_100031590 3300006880 Bacteria 4602
231 Ga0075429_100032014 3300006880 Bacteria 4572
232 Ga0075429_100041105 3300006880 Bacteria 4027
233 Ga0075429_100071722 3300006880 Bacteria 3016
234 Ga0075429_100120272 3300006880 Bacteria 2295
235 Ga0075429_100292962 3300006880 Bacteria 1425
236 Ga0075429_100478183 3300006880 Bacteria 1091
237 Ga0068865_100122425 3300006881 Bacteria 1936
238 Ga0068865_100225043 3300006881 Bacteria 1468
239 Ga0075436_100002206 3300006914 Bacteria 13445
240 Ga0075436_100030550 3300006914 Bacteria 3708
241 Ga0075436_100090454 3300006914 Bacteria 2128
242 Ga0075436_100292355 3300006914 Bacteria 1166
243 Ga0097620_100011474 3300006931 Bacteria 8908
244 Ga0097620_100070822 3300006931 Bacteria 3522
245 Ga0097620_100166562 3300006931 Bacteria 2284
246 Ga0097620_100634627 3300006931 Bacteria 1160
247 Ga0075435_100011144 3300007076 Bacteria 6595
248 Ga0075435_100012339 3300007076 Bacteria 6321
249 Ga0075435_100035982 3300007076 Bacteria 3932
250 Ga0075435_100044687 3300007076 Bacteria 3549
251 Ga0075435_100166194 3300007076 Bacteria 1860
252 Ga0075435_100170599 3300007076 Bacteria 1835
253 Ga0099794_10002485 3300007265 Bacteria 6804
254 Ga0099794_10007340 3300007265 Bacteria 4523
255 Ga0099794_10019394 3300007265 Bacteria 3063
256 Ga0099794_10047434 3300007265 Bacteria 2060
257 Ga0099795_10129867 3300007788 Bacteria 1016
258 Ga0111539_10000526 3300009094 Bacteria 48478
259 Ga0111539_10001138 3300009094 Bacteria 35180
260 Ga0111539_10001599 3300009094 Bacteria 30206
261 Ga0111539_10022370 3300009094 Bacteria 7770
262 Ga0111539_10366607 3300009094 Bacteria 1677
263 Ga0111539_10451019 3300009094 Bacteria 1498
264 Ga0105245_10809373 3300009098 Bacteria 975
265 Ga0105247_10022686 3300009101 Bacteria 3781
266 Ga0114129_10000853 3300009147 Bacteria 39495
267 Ga0114129_10007360 3300009147 Bacteria 15671
268 Ga0114129_10016980 3300009147 Bacteria 10362
269 Ga0114129_10022779 3300009147 Bacteria 8881
270 Ga0114129_10023043 3300009147 Bacteria 8834
271 Ga0114129_10041689 3300009147 Bacteria 6465
272 Ga0114129_10048747 3300009147 Bacteria 5952
273 Ga0114129_10070439 3300009147 Bacteria 4876
274 Ga0114129_10092226 3300009147 Bacteria 4197
275 Ga0114129_10128589 3300009147 Bacteria 3481
276 Ga0114129_10156437 3300009147 Bacteria 3116
277 Ga0114129_10183152 3300009147 Bacteria 2848
278 Ga0114129_10198902 3300009147 Bacteria 2716
279 Ga0114129_10267375 3300009147 Bacteria 2289
280 Ga0114129_10352808 3300009147 Bacteria 1948
281 Ga0114129_10469304 3300009147 Bacteria 1648
282 Ga0114129_10522014 3300009147 Bacteria 1548
283 Ga0114129_10788442 3300009147 Bacteria 1213
284 Ga0114129_10933261 3300009147 Bacteria 1097
285 Ga0105243_10137649 3300009148 Bacteria 2079
286 Ga0105243_10181952 3300009148 Bacteria 1829
287 Ga0105243_10349120 3300009148 Bacteria 1358
288 Ga0105241_10001791 3300009174 Bacteria 16319
289 Ga0105241_10032487 3300009174 Bacteria 3913
290 Ga0105242_10050126 3300009176 Bacteria 3399
291 Ga0105248_10236665 3300009177 Bacteria 2055
292 Ga0105248_10452421 3300009177 Bacteria 1447
293 Ga0105237_10516927 3300009545 Bacteria 1200
294 Ga0105238_10212792 3300009551 Bacteria 1909
295 Ga0105249_10019517 3300009553 Bacteria 6049
296 Ga0105249_10195407 3300009553 Bacteria 1977
297 Ga0105249_10503586 3300009553 Bacteria 1256
298 Ga0105239_10176022 3300010375 Bacteria 2393
299 Ga0105246_10229092 3300011119 Bacteria 1462
300 Ga0157373_10001444 3300013100 Bacteria 18151
301 Ga0157369_10025458 3300013105 Bacteria 6571
302 Ga0157369_10297291 3300013105 Bacteria 1680
303 Ga0157378_10483991 3300013297 Bacteria 1234
304 Ga0157372_10001335 3300013307 Bacteria 26660
305 Ga0157372_10057660 3300013307 Bacteria 4341
306 Ga0157372_10594197 3300013307 Bacteria 1290
307 Ga0157372_10977895 3300013307 Bacteria 981
308 Ga0157380_10024855 3300014326 Bacteria 4537
309 Ga0157380_10952373 3300014326 Bacteria 888
310 Ga0182008_10096678 3300014497 Bacteria 1458
311 Ga0182008_10174823 3300014497 Bacteria 1085
312 Ga0157379_10084258 3300014968 Bacteria 2849
313 Ga0197907_10048030 3300020069 Bacteria 3849
314 Ga0206352_10614594 3300020078 Bacteria 1293
315 Ga0206350_10785658 3300020080 Bacteria 3719
316 Ga0213875_10002261 3300021388 Bacteria 11682
317 Ga0213871_10008181 3300021441 Bacteria 2295
318 Ga0224712_10004681 3300022467 Bacteria 3718
319 Ga0207426_1009481 3300025302 Bacteria 3850
320 Ga0207653_10005898 3300025885 Bacteria 3822
321 Ga0207710_10021991 3300025900 Bacteria 2735
322 Ga0207688_10020093 3300025901 Bacteria 3644
323 Ga0207688_10183104 3300025901 Bacteria 1250
324 Ga0207647_10100603 3300025904 Bacteria 1716
325 Ga0207645_10001090 3300025907 Bacteria 22399
326 Ga0207643_10000057 3300025908 Bacteria 73664
327 Ga0207684_10000746 3300025910 Bacteria 37987
328 Ga0207684_10007001 3300025910 Bacteria 10199
329 Ga0207684_10027806 3300025910 Bacteria 4817
330 Ga0207684_10050591 3300025910 Bacteria 3525
331 Ga0207684_10072055 3300025910 Bacteria 2935
332 Ga0207684_10158529 3300025910 Bacteria 1948
333 Ga0207684_10329008 3300025910 Bacteria 1317
334 Ga0207684_10450838 3300025910 Bacteria 1104
335 Ga0207684_10527154 3300025910 Bacteria 1011
336 Ga0207654_10009113 3300025911 Bacteria 5034
337 Ga0207654_10028402 3300025911 Bacteria 3049
338 Ga0207707_10001689 3300025912 Bacteria 20305
339 Ga0207693_10011370 3300025915 Bacteria 7208
340 Ga0207663_10195767 3300025916 Bacteria 1455
341 Ga0207660_10021604 3300025917 Bacteria 4329
342 Ga0207660_10111038 3300025917 Bacteria 2063
343 Ga0207660_10264125 3300025917 Bacteria 1362
344 Ga0207662_10192556 3300025918 Bacteria 1316
345 Ga0207657_10001291 3300025919 Bacteria 26609
346 Ga0207657_10077295 3300025919 Bacteria 2806
347 Ga0207649_10007560 3300025920 Bacteria 5908
348 Ga0207652_10001723 3300025921 Bacteria 19088
349 Ga0207652_10225296 3300025921 Bacteria 1689
350 Ga0207652_10509811 3300025921 Bacteria 1083
351 Ga0207646_10004639 3300025922 Bacteria 14839
352 Ga0207646_10013001 3300025922 Bacteria 7975
353 Ga0207646_10025603 3300025922 Bacteria 5396
354 Ga0207646_10057838 3300025922 Bacteria 3464
355 Ga0207646_10107779 3300025922 Bacteria 2499
356 Ga0207681_10112306 3300025923 Bacteria 1984
357 Ga0207681_10121621 3300025923 Bacteria 1915
358 Ga0207681_10366254 3300025923 Bacteria 1157
359 Ga0207694_10064754 3300025924 Bacteria 2849
360 Ga0207650_10018055 3300025925 Bacteria 4944
361 Ga0207690_10293300 3300025932 Bacteria 1270
362 Ga0207706_10009132 3300025933 Bacteria 9115
363 Ga0207706_10064650 3300025933 Bacteria 3221
364 Ga0207686_10279143 3300025934 Bacteria 1232
365 Ga0207709_10077482 3300025935 Bacteria 2131
366 Ga0207709_10329844 3300025935 Bacteria 1145
367 Ga0207704_10024601 3300025938 Bacteria 3270
368 Ga0207704_10073152 3300025938 Bacteria 2182
369 Ga0207665_10003742 3300025939 Bacteria 10160
370 Ga0207691_10287841 3300025940 Bacteria 1413
371 Ga0207689_10001050 3300025942 Bacteria 26544
372 Ga0207689_10019747 3300025942 Bacteria 5678
373 Ga0207661_10055155 3300025944 Bacteria 3186
374 Ga0207679_10031596 3300025945 Bacteria 3707
375 Ga0207667_10003708 3300025949 Bacteria 18845
376 Ga0207667_10531703 3300025949 Bacteria 1190
377 Ga0207651_10331395 3300025960 Bacteria 1276
378 Ga0207712_10047246 3300025961 Bacteria 2988
379 Ga0207712_10104292 3300025961 Bacteria 2114
380 Ga0207712_10201854 3300025961 Bacteria 1577
381 Ga0207712_10523727 3300025961 Bacteria 1016
382 Ga0207668_10195665 3300025972 Bacteria 1606
383 Ga0207640_10063000 3300025981 Bacteria 2462
384 Ga0207658_10165812 3300025986 Bacteria 1815
385 Ga0207639_10047855 3300026041 Bacteria 3234
386 Ga0207639_10231236 3300026041 Bacteria 1603
387 Ga0207678_10101560 3300026067 Bacteria 2456
388 Ga0207708_10152018 3300026075 Bacteria 1823
389 Ga0207708_10290881 3300026075 Bacteria 1326
390 Ga0207702_10019648 3300026078 Bacteria 5592
391 Ga0207702_10024261 3300026078 Bacteria 5032
392 Ga0207641_10075301 3300026088 Bacteria 2915
393 Ga0207641_10103106 3300026088 Bacteria 2516
394 Ga0207648_10093601 3300026089 Bacteria 2628
395 Ga0207648_10110838 3300026089 Bacteria 2409
396 Ga0207648_10203087 3300026089 Bacteria 1758
397 Ga0207674_10002538 3300026116 Bacteria 23000
398 Ga0207674_10060924 3300026116 Bacteria 3814
399 Ga0207674_10111753 3300026116 Bacteria 2706
400 Ga0207674_10246903 3300026116 Bacteria 1732
401 Ga0207675_100006436 3300026118 Bacteria 11121
402 Ga0207675_100735879 3300026118 Bacteria 997
403 Ga0207683_10021776 3300026121 Bacteria 5495
404 Ga0207698_10047510 3300026142 Bacteria 3252
405 Ga0209969_1006978 3300027360 Bacteria 1594
406 Ga0209995_1001244 3300027471 Bacteria 3917
407 Ga0209968_1000514 3300027526 Bacteria 6085
408 Ga0209999_1001506 3300027543 Bacteria 4008
409 Ga0209983_1000156 3300027665 Bacteria 12776
410 Ga0209588_1022051 3300027671 Bacteria 2004
411 Ga0209588_1048608 3300027671 Bacteria 1373
412 Ga0209971_1000358 3300027682 Bacteria 12455
413 Ga0209971_1007358 3300027682 Bacteria 2612
414 Ga0209966_1000705 3300027695 Bacteria 7205
415 Ga0209998_10000751 3300027717 Bacteria 8505
416 Ga0209974_10046290 3300027876 Bacteria 1454
417 Ga0207428_10000121 3300027907 Bacteria 106184
418 Ga0207428_10000503 3300027907 Bacteria 46699
419 Ga0207428_10006405 3300027907 Bacteria 10877
420 Ga0207428_10014375 3300027907 Bacteria 6881
421 Ga0268266_10087876 3300028379 Bacteria 2720
422 Ga0268265_10007965 3300028380 Bacteria 7152
423 Ga0268265_10190273 3300028380 Bacteria 1771
424 Ga0268264_10115295 3300028381 Bacteria 2360
425 Ga0268264_10191392 3300028381 Bacteria 1865
426 Ga0268264_10200229 3300028381 Bacteria 1826
427 Ga0265334_10045861 3300028573 Bacteria 1691
428 Ga0265325_10130115 3300031241 Bacteria 1206
429 Ga0265340_10106084 3300031247 Bacteria 1302
430 Ga0307408_100006975 3300031548 Bacteria 7474
431 Ga0307408_100046973 3300031548 Bacteria 3090
432 Ga0307408_100077439 3300031548 Bacteria 2476
433 Ga0307408_100095597 3300031548 Bacteria 2252
434 Ga0307408_100610299 3300031548 Bacteria 971
435 Ga0307410_10190561 3300031852 Bacteria 1559
436 Ga0307406_10221739 3300031901 Bacteria 1406
437 Ga0307409_100188286 3300031995 Bacteria 1834
438 Ga0307416_100247611 3300032002 Bacteria 1732
439 Ga0373959_0009013 3300034820 Bacteria 1711
440 Ga0373940_0007460 3300035088 Bacteria 2470
441 Ga0373940_0072661 3300035088 Bacteria 1004
442 Ga0373949_0013215 3300035090 Bacteria 1829
443 Ga0373949_0030083 3300035090 Bacteria 1289
444 Ga0373951_0035574 3300035091 Bacteria 1186
445 Ga0373942_0019908 3300035207 Bacteria 1680
446 Ga0373961_0072674 3300035241 Bacteria 1067
447 Ga0373962_0002365 3300035242 Bacteria 4507
448 Ga0373931_0112753 3300035691 Bacteria 1545
449 Ga0395899_0004527 3300037312 Bacteria 10834
450 Ga0395899_0161202 3300037312 Bacteria 1584
451 Ga0395900_0008202 3300037418 Bacteria 10752
452 Ga0395900_0012819 3300037418 Bacteria 8566
453 Ga0395900_0181046 3300037418 Bacteria 2142
454 Ga0395898_0010787 3300037466 Bacteria 9544
455 Ga0395898_0012497 3300037466 Bacteria 8778
456 Ga0395905_0283250 3300037471 Bacteria 1544
457 Ga0436364_0022735 3300037853 Bacteria 162985
458 Ga0436364_0657016 3300037853 Bacteria 1691
459 Ga0395901_0003669 3300038443 Bacteria 15483
460 Ga0395901_0009095 3300038443 Bacteria 10058
461 Ga0395901_0014831 3300038443 Bacteria 7916
462 Ga0395901_0267004 3300038443 Bacteria 1780
463 Ga0395901_0329934 3300038443 Bacteria 1577
464 Ga0436365_0006349 3300039437 Bacteria 1159
465 Ga0436365_0531035 3300039437 Bacteria 2463
466 Ga0436360_0986850 3300039438 Bacteria 5443
467 Ga0436360_1329032 3300039438 Bacteria 1114
468 Ga0436361_0578553 3300039447 Unclassified 2782
469 Ga0436361_1042281 3300039447 Bacteria 5664
470 Ga0436363_0339556 3300039450 Bacteria 1464
471 Ga0439448_0078940 3300042005 Bacteria 1103
472 Ga0439455_0012216 3300042012 Bacteria 1924
473 Ga0439458_0016687 3300042157 Bacteria 1671
474 Ga0439459_0001932 3300042438 Bacteria 3147
475 Ga0439460_0000779 3300042461 Bacteria 7194
476 Ga0439460_0035908 3300042461 Bacteria 1435
477 Ga0451577_0004015 3300042876 Bacteria 15822
478 Ga0451577_0134489 3300042876 Bacteria 2219
479 Ga0451577_0139958 3300042876 Bacteria 2174
480 Ga0451577_0171193 3300042876 Bacteria 1957
481 Ga0451577_0230601 3300042876 Bacteria 1674
482 Ga0451577_0390606 3300042876 Bacteria 1263
483 Ga0453683_0046730 3300044673 Bacteria 2714
484 Ga0466963_0187468 3300044694 Bacteria 1445
485 Ga0453684_0018943 3300044712 Bacteria 10520
486 Ga0466957_0017067 3300044842 Bacteria 4248
487 Ga0451576_0006403 3300045051 Bacteria 14449
488 Ga0451576_0008349 3300045051 Bacteria 12170
489 Ga0451576_0024197 3300045051 Bacteria 6561
490 Ga0451576_0043155 3300045051 Bacteria 4758
491 Ga0451576_0250121 3300045051 Bacteria 1852
492 Ga0451576_0338379 3300045051 Bacteria 1575
493 Ga0451576_0435782 3300045051 Bacteria 1375
494 Ga0495603_0031340 3300046455 Bacteria 3201
495 Ga0495580_0001701 3300046472 Bacteria 19339
496 Ga0495580_0029304 3300046472 Bacteria 3996
497 Ga0495656_0158792 3300046615 Unclassified 1097
498 Ga0495669_0010940 3300046684 Bacteria 3841
499 Ga0495669_0045849 3300046684 Bacteria 1950
500 Ga0496102_0013925 3300048905 Bacteria 6980
501 Ga0496102_0022219 3300048905 Bacteria 5619
502 Ga0496103_0274667 3300048906 Bacteria 1084
503 Ga0496106_0506326 3300048909 Bacteria 970
504 Ga0496112_0549126 3300048915 Bacteria 1089
505 Ga0496113_0585345 3300048916 Bacteria 894
506 Ga0501031_0090656 3300049568 Bacteria 1994
507 Ga0501033_0357642 3300049570 Bacteria 1022
508 Ga0501034_0039865 3300049571 Bacteria 4757
509 Ga0501034_0230105 3300049571 Bacteria 1803
510 Ga0501034_0252972 3300049571 Bacteria 1706
511 Ga0501034_0282793 3300049571 Bacteria 1598
512 Ga0501036_0399460 3300049572 Bacteria 1147
513 Ga0501038_0083331 3300049574 Bacteria 2692
514 Ga0501038_0214392 3300049574 Bacteria 1539
515 Ga0501039_0051197 3300049575 Bacteria 3196
516 Ga0501039_0171219 3300049575 Bacteria 1707
517 Ga0501040_0011871 3300049576 Bacteria 5699
518 Ga0501040_0012639 3300049576 Bacteria 5537
519 Ga0501040_0077372 3300049576 Bacteria 2301
520 Ga0501040_0179506 3300049576 Bacteria 1501
521 Ga0501040_0324804 3300049576 Bacteria 1101
522 Ga0501041_0023889 3300049577 Bacteria 3667
523 Ga0501041_0023937 3300049577 Bacteria 3663
524 Ga0501041_0216591 3300049577 Bacteria 1201
525 Ga0501042_0010481 3300049578 Bacteria 6219
526 Ga0501042_0011445 3300049578 Bacteria 5987
527 Ga0501042_0043470 3300049578 Bacteria 3200
528 Ga0501042_0176763 3300049578 Bacteria 1540
529 Ga0501046_0011529 3300049580 Bacteria 7558
530 Ga0501046_0086915 3300049580 Bacteria 2410
531 Ga0501046_0257239 3300049580 Bacteria 1284
532 Ga0501048_0008599 3300049582 Bacteria 7710
533 Ga0501048_0078267 3300049582 Bacteria 2333
534 Ga0501048_0116541 3300049582 Bacteria 1887
535 Ga0501048_0138621 3300049582 Bacteria 1720
536 Ga0501048_0138681 3300049582 Bacteria 1719
537 Ga0501067_0047489 3300049583 Bacteria 2381
538 Ga0501068_0045873 3300049584 Bacteria 2634
539 Ga0501068_0133558 3300049584 Bacteria 1553
540 Ga0501068_0157533 3300049584 Bacteria 1430
541 Ga0501069_0055194 3300049585 Bacteria 2213
542 Ga0501070_0223120 3300049586 Bacteria 1545
543 Ga0501070_0290887 3300049586 Bacteria 1332
544 Ga0501070_0312965 3300049586 Bacteria 1278
545 Ga0501070_0427626 3300049586 Bacteria 1069
546 Ga0501071_0028921 3300049587 Bacteria 3908
547 Ga0501071_0053948 3300049587 Bacteria 2900
548 Ga0501071_0061509 3300049587 Bacteria 2720
549 Ga0501071_0231089 3300049587 Bacteria 1393
550 Ga0501071_0397231 3300049587 Bacteria 1052
551 Ga0501072_0007431 3300049588 Bacteria 8314
552 Ga0501072_0007773 3300049588 Bacteria 8143
553 Ga0501072_0012820 3300049588 Bacteria 6409
554 Ga0501072_0049769 3300049588 Bacteria 3299
555 Ga0501072_0052060 3300049588 Bacteria 3224
556 Ga0501072_0117763 3300049588 Bacteria 2116
557 Ga0501072_0120446 3300049588 Bacteria 2091
558 Ga0501072_0145640 3300049588 Bacteria 1889
559 Ga0501072_0238971 3300049588 Bacteria 1447
560 Ga0501072_0602469 3300049588 Bacteria 866
561 Ga0501073_0429316 3300049589 Bacteria 913
562 Ga0501075_0002375 3300049591 Bacteria 12524
563 Ga0501075_0006827 3300049591 Bacteria 7880
564 Ga0501075_0082159 3300049591 Bacteria 2440
565 Ga0501075_0114832 3300049591 Bacteria 2047
566 Ga0501075_0128471 3300049591 Bacteria 1930
567 Ga0501075_0140636 3300049591 Bacteria 1839
568 Ga0501075_0234494 3300049591 Bacteria 1399
569 Ga0501075_0236445 3300049591 Bacteria 1393
570 Ga0501075_0452929 3300049591 Bacteria 979
571 Ga0501076_0019736 3300049592 Bacteria 5155
572 Ga0501076_0137827 3300049592 Bacteria 1981
573 Ga0501076_0297690 3300049592 Bacteria 1322
574 Ga0501077_0000731 3300049593 Bacteria 19868
575 Ga0501077_0004780 3300049593 Bacteria 8232
576 Ga0501077_0024929 3300049593 Bacteria 3798
577 Ga0501077_0183809 3300049593 Bacteria 1328
578 Ga0501077_0261331 3300049593 Bacteria 1101
579 Ga0501077_0357588 3300049593 Bacteria 932
580 Ga0501079_0000872 3300049741 Bacteria 20703
581 Ga0501079_0001700 3300049741 Bacteria 15676
582 Ga0501079_0002699 3300049741 Bacteria 12922
583 Ga0501079_0095394 3300049741 Bacteria 2305
584 Ga0501079_0439435 3300049741 Bacteria 1024
585 Ga0501080_0018762 3300049742 Bacteria 6402
586 Ga0501080_0049557 3300049742 Bacteria 3909
587 Ga0501080_0502070 3300049742 Bacteria 1084
588 Ga0501081_0004324 3300049743 Bacteria 9107
589 Ga0501081_0009497 3300049743 Bacteria 6343
590 Ga0501081_0016939 3300049743 Bacteria 4817
591 Ga0501081_0077484 3300049743 Bacteria 2323
592 Ga0501081_0188994 3300049743 Bacteria 1491
593 Ga0501081_0190327 3300049743 Unclassified 1486
594 Ga0501081_0209846 3300049743 Bacteria 1414
595 Ga0501081_0212035 3300049743 Bacteria 1407
596 Ga0501083_0020499 3300049744 Bacteria 4600
597 Ga0501083_0184144 3300049744 Bacteria 1363
598 Ga0501045_0007769 3300049824 Bacteria 7457
599 Ga0501045_0032240 3300049824 Bacteria 3796
600 Ga0501045_0090907 3300049824 Bacteria 2256
601 Ga0501045_0419021 3300049824 Bacteria 996
602 nmdc:mga03683_107746_c1 3300050489 Bacteria 1229
603 nmdc:mga03683_12616_c1 3300050489 Bacteria 3092
604 nmdc:mga03683_1660_c1 3300050489 Bacteria 6694
605 nmdc:mga03683_83449_c1 3300050489 Bacteria 1383
606 nmdc:mga03n38_120104_c1 3300050490 Bacteria 1290
607 nmdc:mga03n38_49334_c1 3300050490 Bacteria 1871
608 nmdc:mga03n38_55401_c1 3300050490 Bacteria 1786
609 nmdc:mga00v17_160194_c1 3300050491 Bacteria 1448
610 nmdc:mga0yw44_106900_c1 3300050492 Bacteria 1789
611 nmdc:mga0yw44_30694_c1 3300050492 Bacteria 3118
612 nmdc:mga0yw44_33612_c1 3300050492 Bacteria 2998
613 nmdc:mga0k408_224878_c1 3300050493 Bacteria 1120
614 nmdc:mga0k408_25011_c1 3300050493 Bacteria 3379
615 nmdc:mga0k408_68487_c1 3300050493 Bacteria 2070
616 nmdc:mga06z11_45116_c1 3300050494 Bacteria 2227
617 nmdc:mga06z11_590_c1 3300050494 Bacteria 13276
618 nmdc:mga06z11_6309_c1 3300050494 Bacteria 4813
619 nmdc:mga04h51_81387_c1 3300050495 Bacteria 1150
620 nmdc:mga07m45_47813_c1 3300050496 Bacteria 2405
621 nmdc:mga07m45_8936_c2 3300050496 Bacteria 2376
622 nmdc:mga05p37_12090_c2 3300050507 Bacteria 8053
623 nmdc:mga05p37_16877_c1 3300050507 Bacteria 8803
624 nmdc:mga05p37_232332_c1 3300050507 Bacteria 1221
625 nmdc:mga05p37_247581_c1 3300050507 Bacteria 2139
626 nmdc:mga05p37_25621_c1 3300050507 Bacteria 7174
627 nmdc:mga05p37_259178_c1 3300050507 Bacteria 2082
628 nmdc:mga05p37_265476_c1 3300050507 Bacteria 2053
629 nmdc:mga05p37_34095_c1 3300050507 Bacteria 6235
630 nmdc:mga05p37_37915_c1 3300050507 Bacteria 5911
631 nmdc:mga05p37_384890_c1 3300050507 Bacteria 1642
632 nmdc:mga05p37_38677_c1 3300050507 Bacteria 5854
633 nmdc:mga05p37_396457_c1 3300050507 Bacteria 1613
634 nmdc:mga05p37_399380_c1 3300050507 Unclassified 1605
635 nmdc:mga05p37_478137_c1 3300050507 Bacteria 1436
636 nmdc:mga05p37_49361_c1 3300050507 Bacteria 5176
637 nmdc:mga05p37_55463_c1 3300050507 Bacteria 4877
638 nmdc:mga05p37_61064_c1 3300050507 Bacteria 4641
639 nmdc:mga05p37_67228_c1 3300050507 Bacteria 4409
640 nmdc:mga05p37_81118_c1 3300050507 Bacteria 3996
641 nmdc:mga05p37_854_c1 3300050507 Bacteria 34328
642 nmdc:mga09592_130475_c1 3300050508 Bacteria 2162
643 nmdc:mga09592_14152_c1 3300050508 Bacteria 6507
644 nmdc:mga09592_156291_c1 3300050508 Bacteria 1969
645 nmdc:mga09592_1608_c1 3300050508 Bacteria 18215
646 nmdc:mga09592_385116_c1 3300050508 Bacteria 1212
647 nmdc:mga09592_42183_c1 3300050508 Bacteria 3838
648 nmdc:mga09592_71837_c1 3300050508 Bacteria 2938
649 nmdc:mga09592_8360_c1 3300050508 Bacteria 8411
650 nmdc:mga09592_9669_c1 3300050508 Bacteria 7836
651 nmdc:mga0qj67_10857_c1 3300050509 Bacteria 6813
652 nmdc:mga0qj67_30906_c1 3300050509 Bacteria 4170
653 nmdc:mga0qj67_321481_c1 3300050509 Bacteria 1253
654 nmdc:mga0qj67_38756_c1 3300050509 Bacteria 3739
655 nmdc:mga0qj67_437011_c1 3300050509 Bacteria 1054
656 nmdc:mga0qj67_49460_c1 3300050509 Bacteria 3323
657 nmdc:mga0qj67_7568_c1 3300050509 Bacteria 8027
658 nmdc:mga0qj67_8848_c1 3300050509 Bacteria 7471
659 nmdc:mga06r32_102247_c1 3300050510 Bacteria 2813
660 nmdc:mga06r32_11511_c1 3300050510 Bacteria 7969
661 nmdc:mga06r32_124096_c1 3300050510 Bacteria 2549
662 nmdc:mga06r32_142_c1 3300050510 Bacteria 53686
663 nmdc:mga06r32_20346_c1 3300050510 Bacteria 6109
664 nmdc:mga06r32_214713_c1 3300050510 Bacteria 1912
665 nmdc:mga06r32_2636_c1 3300050510 Bacteria 16020
666 nmdc:mga06r32_3307_c1 3300050510 Bacteria 14445
667 nmdc:mga06r32_563_c1 3300050510 Bacteria 32272
668 nmdc:mga06r32_75348_c1 3300050510 Bacteria 3274
669 nmdc:mga06r32_7643_c1 3300050510 Bacteria 9721
670 nmdc:mga08y16_1556_c1 3300050511 Bacteria 23117
671 nmdc:mga08y16_1975_c1 3300050511 Bacteria 20910
672 nmdc:mga08y16_256654_c1 3300050511 Bacteria 1806
673 nmdc:mga0n895_107708_c1 3300050512 Bacteria 2801
674 nmdc:mga0n895_116482_c1 3300050512 Bacteria 2691
675 nmdc:mga0n895_257562_c1 3300050512 Bacteria 1077
676 nmdc:mga0n895_28765_c1 3300050512 Bacteria 5291
677 nmdc:mga0n895_296709_c1 3300050512 Bacteria 1639
678 nmdc:mga0n895_320917_c1 3300050512 Bacteria 1570
679 nmdc:mga0n895_350208_c1 3300050512 Bacteria 1496
680 nmdc:mga0n895_41627_c1 3300050512 Bacteria 4467
681 nmdc:mga0n895_793_c1 3300050512 Bacteria 22553
682 nmdc:mga0n895_8409_c1 3300050512 Bacteria 8936
683 nmdc:mga0rr50_148429_c1 3300050513 Bacteria 1892
684 nmdc:mga0rr50_167295_c1 3300050513 Bacteria 1789
685 nmdc:mga0rr50_172782_c1 3300050513 Bacteria 1762
686 nmdc:mga0rr50_17497_c1 3300050513 Bacteria 4788
687 nmdc:mga0rr50_236121_c1 3300050513 Bacteria 1514
688 nmdc:mga0rr50_2746_c1 3300050513 Bacteria 9997
689 nmdc:mga0rr50_28279_c1 3300050513 Bacteria 3939
690 nmdc:mga0rr50_301701_c1 3300050513 Bacteria 1340
691 nmdc:mga0rr50_320382_c1 3300050513 Bacteria 1300
692 nmdc:mga0rr50_63146_c1 3300050513 Bacteria 2796
693 nmdc:mga08x19_23829_c1 3300050514 Bacteria 3798
694 nmdc:mga08x19_31353_c1 3300050514 Bacteria 3344
695 nmdc:mga08x19_69286_c1 3300050514 Bacteria 2297
696 nmdc:mga0a205_10795_c1 3300050515 Bacteria 8402
697 nmdc:mga0a205_11007_c1 3300050515 Bacteria 8326
698 nmdc:mga0a205_143276_c1 3300050515 Bacteria 2290
699 nmdc:mga0a205_15690_c1 3300050515 Bacteria 7079
700 nmdc:mga0a205_179999_c1 3300050515 Bacteria 2008
701 nmdc:mga0a205_197288_c1 3300050515 Bacteria 1904
702 nmdc:mga0a205_219805_c1 3300050515 Bacteria 1786
703 nmdc:mga0a205_259909_c1 3300050515 Bacteria 1614
704 nmdc:mga0a205_28063_c1 3300050515 Bacteria 5379
705 nmdc:mga0a205_3559_c2 3300050515 Bacteria 13263
706 nmdc:mga0a205_36866_c1 3300050515 Bacteria 4701
707 nmdc:mga0a205_75063_c1 3300050515 Bacteria 3266
708 nmdc:mga0sz30_112146_c1 3300050516 Bacteria 1196
709 nmdc:mga0sz30_1316_c1 3300050516 Bacteria 8831
710 Ga0500641_0000586 3300053096 Bacteria 13113
711 Ga0500568_0036762 3300053139 Bacteria 1991
712 Ga0500616_0005290 3300053153 Bacteria 8818
713 Ga0500552_000950 3300053733 Bacteria 2736
714 Ga0501084_0002636 3300054114 Bacteria 14456
715 Ga0501084_0005617 3300054114 Bacteria 10299
716 Ga0501084_0017737 3300054114 Bacteria 5924
717 Ga0501084_0026857 3300054114 Bacteria 4809
718 Ga0501084_0028751 3300054114 Bacteria 4648
719 Ga0501084_0059477 3300054114 Bacteria 3199
720 Ga0501084_0167413 3300054114 Bacteria 1855
721 Ga0501084_0341903 3300054114 Bacteria 1264
722 Ga0590074_009378 3300059423 Bacteria 1631
723 Ga0501082_0003434 3300060353 Bacteria 13830
724 Ga0501082_0052648 3300060353 Bacteria 3509
725 Ga0501082_0058273 3300060353 Bacteria 3328
726 Ga0501082_0261772 3300060353 Bacteria 1505
727 Ga0530510_0053920 3300061734 Bacteria 2906
728 Ga0530510_0064107 3300061734 Bacteria 2661
729 Ga0530510_0081238 3300061734 Bacteria 2360
730 Ga0530510_0092790 3300061734 Bacteria 2204
731 Ga0530510_0216417 3300061734 Bacteria 1423
732 Ga0530510_0458035 3300061734 Bacteria 965
733 Ga0111539_10279580
734 JGI25406J46586_10032880
735 JGI26128J50194_1001222
736 JGI25405J52794_10017385
737 Ga0065707_10018562
738 Ga0070676_10017806
739 Ga0070676_10134219
740 Ga0070683_100047433
741 Ga0070690_100124733
742 Ga0070690_100151503
743 Ga0070690_100174810
744 Ga0070670_100013240
745 Ga0068869_100012226
746 Ga0068869_100016723
747 Ga0070680_100012479
748 Ga0070680_100070100
749 Ga0070680_100180106
750 Ga0070680_100484965
751 Ga0070682_100002633
752 Ga0070682_100359995
753 Ga0070660_100010506
754 Ga0070689_100037684
755 Ga0070689_100227970
756 Ga0070661_100077375
757 Ga0070692_10000628
758 Ga0070692_10036323
759 Ga0070668_100294806
760 Ga0070669_100015281
761 Ga0070669_100228581
762 Ga0070669_100595253
763 Ga0070675_100482348
764 Ga0070673_100462554
765 Ga0070659_100000818
766 Ga0070667_100400216
767 Ga0070703_10023507
768 Ga0070713_100034481
769 Ga0070711_100025953
770 Ga0070711_100297221
771 Ga0070705_100004975
772 Ga0070705_100008202
773 Ga0070694_100004473
774 Ga0070694_100007779
775 Ga0070694_100022574
776 Ga0070694_100118225
777 Ga0070694_100143549
778 Ga0070694_100330637
779 Ga0070708_100007637
780 Ga0070708_100012015
781 Ga0070708_100056105
782 Ga0070708_100092213
783 Ga0070708_100246119
784 Ga0070708_100256131
785 Ga0070663_100012303
786 Ga0070678_100008334
787 Ga0070662_100009000
788 Ga0070662_100016023
789 Ga0070662_100207415
790 Ga0068867_100021117
791 Ga0070706_100020267
792 Ga0070706_100105509
793 Ga0070706_100114524
794 Ga0070706_100220057
795 Ga0070706_100507555
796 Ga0070707_100011004
797 Ga0070707_100028928
798 Ga0070707_100041080
799 Ga0070707_100245969
800 Ga0070707_100329124
801 Ga0070707_100443988
802 Ga0070698_100007463
803 Ga0070698_100018371
804 Ga0070698_100036496
805 Ga0070698_100179506
806 Ga0070698_100197889
807 Ga0070698_100504865
808 Ga0070699_100012237
809 Ga0070699_100092967
810 Ga0070699_100158101
811 Ga0070699_100249501
812 Ga0070699_100320163
813 Ga0070699_100527355
814 Ga0070679_100004125
815 Ga0070684_100264160
816 Ga0070697_100031089
817 Ga0070697_100032208
818 Ga0070697_100110449
819 Ga0068853_100064434
820 Ga0068853_100272262
821 Ga0070672_100101360
822 Ga0070686_100023516
823 Ga0070695_100001263
824 Ga0070695_100003353
825 Ga0070695_100003683
826 Ga0070695_100008735
827 Ga0070696_100002860
828 Ga0070696_100016002
829 Ga0070696_100053547
830 Ga0070696_100063264
831 Ga0070696_100152640
832 Ga0070693_100000604
833 Ga0070693_100095003
834 Ga0070665_100119438
835 Ga0070665_100402708
836 Ga0070704_100036103
837 Ga0070704_100112354
838 Ga0070704_100125961
839 Ga0070704_100138215
840 Ga0070704_100150919
841 Ga0070704_100212999
842 Ga0070704_100263203
843 Ga0070704_100397274
844 Ga0068855_100004425
845 Ga0068855_100416844
846 Ga0070664_100044225
847 Ga0068857_100086536
848 Ga0068857_100141604
849 Ga0068857_100149578
850 Ga0068854_100001692
851 Ga0068856_100002103
852 Ga0068856_100228896
853 Ga0068852_100173952
854 Ga0068852_100587483
855 Ga0068859_100011476
856 Ga0068859_100070823
857 Ga0068859_100166564
858 Ga0068859_100634668
859 Ga0068864_100019210
860 Ga0068864_100381993
861 Ga0068861_100079955
862 Ga0068870_10070595
863 Ga0068863_100126007
864 Ga0068863_100153511
865 Ga0068863_100162568
866 Ga0068860_100012365
867 Ga0068860_100017833
868 Ga0068860_100053944
869 Ga0068860_100109202
870 Ga0068862_100032906
871 Ga0068862_100066959
872 Ga0081455_10000060
873 Ga0081455_10000637
874 Ga0081455_10009675
875 Ga0081455_10067455
876 Ga0081538_10001131
877 Ga0081540_1015870
878 Ga0081539_10000044
879 Ga0081539_10003955
880 Ga0081539_10005454
881 Ga0070717_10527263
882 Ga0075365_10015709
883 Ga0075368_10144391
884 Ga0075363_100126074
885 Ga0075363_100137773
886 Ga0075432_10049257
887 Ga0070716_100014911
888 Ga0070716_100055197
889 Ga0070712_100083353
890 Ga0075362_10003030
891 Ga0075362_10018626
892 Ga0075362_10018754
893 Ga0075362_10067858
894 Ga0075367_10016984
895 Ga0075367_10073608
896 Ga0075367_10311979
897 Ga0075369_10005171
898 Ga0075369_10027644
899 Ga0075366_10077802
900 Ga0075366_10119851
901 Ga0075366_10394591
902 Ga0075366_10416128
903 Ga0097621_100159410
904 Ga0075370_10074598
905 Ga0075370_10086062
906 Ga0075370_10196769
907 Ga0075428_100005380
908 Ga0075428_100005808
909 Ga0075428_100007462
910 Ga0075428_100012568
911 Ga0075428_100026502
912 Ga0075428_100066754
913 Ga0075428_100104955
914 Ga0075428_100206885
915 Ga0075428_100222848
916 Ga0075428_100411698
917 Ga0075430_100000104
918 Ga0075430_100005124
919 Ga0075430_100014071
920 Ga0075430_100055487
921 Ga0075430_100073010
922 Ga0075430_100187697
923 Ga0075430_100249415
924 Ga0075431_100000744
925 Ga0075431_100001263
926 Ga0075431_100002958
927 Ga0075431_100006226
928 Ga0075431_100009171
929 Ga0075431_100030094
930 Ga0075431_100033914
931 Ga0075431_100050763
932 Ga0075431_100099116
933 Ga0075431_100210836
934 Ga0075433_10000689
935 Ga0075433_10001833
936 Ga0075433_10002923
937 Ga0075433_10007237
938 Ga0075433_10012554
939 Ga0075433_10014201
940 Ga0075433_10027748
941 Ga0075433_10031474
942 Ga0075433_10044466
943 Ga0075433_10060999
944 Ga0075433_10126848
945 Ga0075433_10173945
946 Ga0075433_10194339
947 Ga0075433_10469349
948 Ga0075434_100002812
949 Ga0075434_100011407
950 Ga0075434_100028924
951 Ga0075434_100035476
952 Ga0075434_100063159
953 Ga0075434_100070517
954 Ga0075434_100138725
955 Ga0075434_100177102
956 Ga0075434_100262420
957 Ga0075434_100288595
958 Ga0075429_100004295
959 Ga0075429_100011495
960 Ga0075429_100011744
961 Ga0075429_100015165
962 Ga0075429_100031590
963 Ga0075429_100032014
964 Ga0075429_100041105
965 Ga0075429_100071722
966 Ga0075429_100120272
967 Ga0075429_100292962
968 Ga0075429_100478183
969 Ga0068865_100122425
970 Ga0068865_100225043
971 Ga0075436_100002206
972 Ga0075436_100030550
973 Ga0075436_100090454
974 Ga0075436_100292355
975 Ga0097620_100011474
976 Ga0097620_100070822
977 Ga0097620_100166562
978 Ga0097620_100634627
979 Ga0075435_100011144
980 Ga0075435_100012339
981 Ga0075435_100035982
982 Ga0075435_100044687
983 Ga0075435_100166194
984 Ga0075435_100170599
985 Ga0099794_10002485
986 Ga0099794_10007340
987 Ga0099794_10019394
988 Ga0099794_10047434
989 Ga0099795_10129867
990 Ga0111539_10000526
991 Ga0111539_10001138
992 Ga0111539_10001599
993 Ga0111539_10022370
994 Ga0111539_10366607
995 Ga0111539_10451019
996 Ga0105245_10809373
997 Ga0105247_10022686
998 Ga0114129_10000853
999 Ga0114129_10007360
1000 Ga0114129_10016980
1001 Ga0114129_10022779
1002 Ga0114129_10023043
1003 Ga0114129_10041689
1004 Ga0114129_10048747
1005 Ga0114129_10070439
1006 Ga0114129_10092226
1007 Ga0114129_10128589
1008 Ga0114129_10156437
1009 Ga0114129_10183152
1010 Ga0114129_10198902
1011 Ga0114129_10267375
1012 Ga0114129_10352808
1013 Ga0114129_10469304
1014 Ga0114129_10522014
1015 Ga0114129_10788442
1016 Ga0114129_10933261
1017 Ga0105243_10137649
1018 Ga0105243_10181952
1019 Ga0105243_10349120
1020 Ga0105241_10001791
1021 Ga0105241_10032487
1022 Ga0105242_10050126
1023 Ga0105248_10236665
1024 Ga0105248_10452421
1025 Ga0105237_10516927
1026 Ga0105238_10212792
1027 Ga0105249_10019517
1028 Ga0105249_10195407
1029 Ga0105249_10503586
1030 Ga0105239_10176022
1031 Ga0105246_10229092
1032 Ga0157373_10001444
1033 Ga0157369_10025458
1034 Ga0157369_10297291
1035 Ga0157378_10483991
1036 Ga0157372_10001335
1037 Ga0157372_10057660
1038 Ga0157372_10594197
1039 Ga0157372_10977895
1040 Ga0157380_10024855
1041 Ga0157380_10952373
1042 Ga0182008_10096678
1043 Ga0182008_10174823
1044 Ga0157379_10084258
1045 Ga0197907_10048030
1046 Ga0206352_10614594
1047 Ga0206350_10785658
1048 Ga0213875_10002261
1049 Ga0213871_10008181
1050 Ga0224712_10004681
1051 Ga0207426_1009481
1052 Ga0207653_10005898
1053 Ga0207710_10021991
1054 Ga0207688_10020093
1055 Ga0207688_10183104
1056 Ga0207647_10100603
1057 Ga0207645_10001090
1058 Ga0207643_10000057
1059 Ga0207684_10000746
1060 Ga0207684_10007001
1061 Ga0207684_10027806
1062 Ga0207684_10050591
1063 Ga0207684_10072055
1064 Ga0207684_10158529
1065 Ga0207684_10329008
1066 Ga0207684_10450838
1067 Ga0207684_10527154
1068 Ga0207654_10009113
1069 Ga0207654_10028402
1070 Ga0207707_10001689
1071 Ga0207693_10011370
1072 Ga0207663_10195767
1073 Ga0207660_10021604
1074 Ga0207660_10111038
1075 Ga0207660_10264125
1076 Ga0207662_10192556
1077 Ga0207657_10001291
1078 Ga0207657_10077295
1079 Ga0207649_10007560
1080 Ga0207652_10001723
1081 Ga0207652_10225296
1082 Ga0207652_10509811
1083 Ga0207646_10004639
1084 Ga0207646_10013001
1085 Ga0207646_10025603
1086 Ga0207646_10057838
1087 Ga0207646_10107779
1088 Ga0207681_10112306
1089 Ga0207681_10121621
1090 Ga0207681_10366254
1091 Ga0207694_10064754
1092 Ga0207650_10018055
1093 Ga0207690_10293300
1094 Ga0207706_10009132
1095 Ga0207706_10064650
1096 Ga0207686_10279143
1097 Ga0207709_10077482
1098 Ga0207709_10329844
1099 Ga0207704_10024601
1100 Ga0207704_10073152
1101 Ga0207665_10003742
1102 Ga0207691_10287841
1103 Ga0207689_10001050
1104 Ga0207689_10019747
1105 Ga0207661_10055155
1106 Ga0207679_10031596
1107 Ga0207667_10003708
1108 Ga0207667_10531703
1109 Ga0207651_10331395
1110 Ga0207712_10047246
1111 Ga0207712_10104292
1112 Ga0207712_10201854
1113 Ga0207712_10523727
1114 Ga0207668_10195665
1115 Ga0207640_10063000
1116 Ga0207658_10165812
1117 Ga0207639_10047855
1118 Ga0207639_10231236
1119 Ga0207678_10101560
1120 Ga0207708_10152018
1121 Ga0207708_10290881
1122 Ga0207702_10019648
1123 Ga0207702_10024261
1124 Ga0207641_10075301
1125 Ga0207641_10103106
1126 Ga0207648_10093601
1127 Ga0207648_10110838
1128 Ga0207648_10203087
1129 Ga0207674_10002538
1130 Ga0207674_10060924
1131 Ga0207674_10111753
1132 Ga0207674_10246903
1133 Ga0207675_100006436
1134 Ga0207675_100735879
1135 Ga0207683_10021776
1136 Ga0207698_10047510
1137 Ga0209969_1006978
1138 Ga0209995_1001244
1139 Ga0209968_1000514
1140 Ga0209999_1001506
1141 Ga0209983_1000156
1142 Ga0209588_1022051
1143 Ga0209588_1048608
1144 Ga0209971_1000358
1145 Ga0209971_1007358
1146 Ga0209966_1000705
1147 Ga0209998_10000751
1148 Ga0209974_10046290
1149 Ga0207428_10000121
1150 Ga0207428_10000503
1151 Ga0207428_10006405
1152 Ga0207428_10014375
1153 Ga0268266_10087876
1154 Ga0268265_10007965
1155 Ga0268265_10190273
1156 Ga0268264_10115295
1157 Ga0268264_10191392
1158 Ga0268264_10200229
1159 Ga0265334_10045861
1160 Ga0265325_10130115
1161 Ga0265340_10106084
1162 Ga0307408_100006975
1163 Ga0307408_100046973
1164 Ga0307408_100077439
1165 Ga0307408_100095597
1166 Ga0307408_100610299
1167 Ga0307410_10190561
1168 Ga0307406_10221739
1169 Ga0307409_100188286
1170 Ga0307416_100247611
1171 Ga0373959_0009013
1172 Ga0373940_0007460
1173 Ga0373940_0072661
1174 Ga0373949_0013215
1175 Ga0373949_0030083
1176 Ga0373951_0035574
1177 Ga0373942_0019908
1178 Ga0373961_0072674
1179 Ga0373962_0002365
1180 Ga0373931_0112753
1181 Ga0395899_0004527
1182 Ga0395899_0161202
1183 Ga0395900_0008202
1184 Ga0395900_0012819
1185 Ga0395900_0181046
1186 Ga0395898_0010787
1187 Ga0395898_0012497
1188 Ga0395905_0283250
1189 Ga0436364_0022735
1190 Ga0436364_0657016
1191 Ga0395901_0003669
1192 Ga0395901_0009095
1193 Ga0395901_0014831
1194 Ga0395901_0267004
1195 Ga0395901_0329934
1196 Ga0436365_0006349
1197 Ga0436365_0531035
1198 Ga0436360_0986850
1199 Ga0436360_1329032
1200 Ga0436361_0578553
1201 Ga0436361_1042281
1202 Ga0436363_0339556
1203 Ga0439448_0078940
1204 Ga0439455_0012216
1205 Ga0439458_0016687
1206 Ga0439459_0001932
1207 Ga0439460_0000779
1208 Ga0439460_0035908
1209 Ga0451577_0004015
1210 Ga0451577_0134489
1211 Ga0451577_0139958
1212 Ga0451577_0171193
1213 Ga0451577_0230601
1214 Ga0451577_0390606
1215 Ga0453683_0046730
1216 Ga0466963_0187468
1217 Ga0453684_0018943
1218 Ga0466957_0017067
1219 Ga0451576_0006403
1220 Ga0451576_0008349
1221 Ga0451576_0024197
1222 Ga0451576_0043155
1223 Ga0451576_0250121
1224 Ga0451576_0338379
1225 Ga0451576_0435782
1226 Ga0495603_0031340
1227 Ga0495580_0001701
1228 Ga0495580_0029304
1229 Ga0495656_0158792
1230 Ga0495669_0010940
1231 Ga0495669_0045849
1232 Ga0496102_0013925
1233 Ga0496102_0022219
1234 Ga0496103_0274667
1235 Ga0496106_0506326
1236 Ga0496112_0549126
1237 Ga0496113_0585345
1238 Ga0501031_0090656
1239 Ga0501033_0357642
1240 Ga0501034_0039865
1241 Ga0501034_0230105
1242 Ga0501034_0252972
1243 Ga0501034_0282793
1244 Ga0501036_0399460
1245 Ga0501038_0083331
1246 Ga0501038_0214392
1247 Ga0501039_0051197
1248 Ga0501039_0171219
1249 Ga0501040_0011871
1250 Ga0501040_0012639
1251 Ga0501040_0077372
1252 Ga0501040_0179506
1253 Ga0501040_0324804
1254 Ga0501041_0023889
1255 Ga0501041_0023937
1256 Ga0501041_0216591
1257 Ga0501042_0010481
1258 Ga0501042_0011445
1259 Ga0501042_0043470
1260 Ga0501042_0176763
1261 Ga0501046_0011529
1262 Ga0501046_0086915
1263 Ga0501046_0257239
1264 Ga0501048_0008599
1265 Ga0501048_0078267
1266 Ga0501048_0116541
1267 Ga0501048_0138621
1268 Ga0501048_0138681
1269 Ga0501067_0047489
1270 Ga0501068_0045873
1271 Ga0501068_0133558
1272 Ga0501068_0157533
1273 Ga0501069_0055194
1274 Ga0501070_0223120
1275 Ga0501070_0290887
1276 Ga0501070_0312965
1277 Ga0501070_0427626
1278 Ga0501071_0028921
1279 Ga0501071_0053948
1280 Ga0501071_0061509
1281 Ga0501071_0231089
1282 Ga0501071_0397231
1283 Ga0501072_0007431
1284 Ga0501072_0007773
1285 Ga0501072_0012820
1286 Ga0501072_0049769
1287 Ga0501072_0052060
1288 Ga0501072_0117763
1289 Ga0501072_0120446
1290 Ga0501072_0145640
1291 Ga0501072_0238971
1292 Ga0501072_0602469
1293 Ga0501073_0429316
1294 Ga0501075_0002375
1295 Ga0501075_0006827
1296 Ga0501075_0082159
1297 Ga0501075_0114832
1298 Ga0501075_0128471
1299 Ga0501075_0140636
1300 Ga0501075_0234494
1301 Ga0501075_0236445
1302 Ga0501075_0452929
1303 Ga0501076_0019736
1304 Ga0501076_0137827
1305 Ga0501076_0297690
1306 Ga0501077_0000731
1307 Ga0501077_0004780
1308 Ga0501077_0024929
1309 Ga0501077_0183809
1310 Ga0501077_0261331
1311 Ga0501077_0357588
1312 Ga0501079_0000872
1313 Ga0501079_0001700
1314 Ga0501079_0002699
1315 Ga0501079_0095394
1316 Ga0501079_0439435
1317 Ga0501080_0018762
1318 Ga0501080_0049557
1319 Ga0501080_0502070
1320 Ga0501081_0004324
1321 Ga0501081_0009497
1322 Ga0501081_0016939
1323 Ga0501081_0077484
1324 Ga0501081_0188994
1325 Ga0501081_0190327
1326 Ga0501081_0209846
1327 Ga0501081_0212035
1328 Ga0501083_0020499
1329 Ga0501083_0184144
1330 Ga0501045_0007769
1331 Ga0501045_0032240
1332 Ga0501045_0090907
1333 Ga0501045_0419021
1334 nmdc:mga03683_107746_c1
1335 nmdc:mga03683_12616_c1
1336 nmdc:mga03683_1660_c1
1337 nmdc:mga03683_83449_c1
1338 nmdc:mga03n38_120104_c1
1339 nmdc:mga03n38_49334_c1
1340 nmdc:mga03n38_55401_c1
1341 nmdc:mga00v17_160194_c1
1342 nmdc:mga0yw44_106900_c1
1343 nmdc:mga0yw44_30694_c1
1344 nmdc:mga0yw44_33612_c1
1345 nmdc:mga0k408_224878_c1
1346 nmdc:mga0k408_25011_c1
1347 nmdc:mga0k408_68487_c1
1348 nmdc:mga06z11_45116_c1
1349 nmdc:mga06z11_590_c1
1350 nmdc:mga06z11_6309_c1
1351 nmdc:mga04h51_81387_c1
1352 nmdc:mga07m45_47813_c1
1353 nmdc:mga07m45_8936_c2
1354 nmdc:mga05p37_12090_c2
1355 nmdc:mga05p37_16877_c1
1356 nmdc:mga05p37_232332_c1
1357 nmdc:mga05p37_247581_c1
1358 nmdc:mga05p37_25621_c1
1359 nmdc:mga05p37_259178_c1
1360 nmdc:mga05p37_265476_c1
1361 nmdc:mga05p37_34095_c1
1362 nmdc:mga05p37_37915_c1
1363 nmdc:mga05p37_384890_c1
1364 nmdc:mga05p37_38677_c1
1365 nmdc:mga05p37_396457_c1
1366 nmdc:mga05p37_399380_c1
1367 nmdc:mga05p37_478137_c1
1368 nmdc:mga05p37_49361_c1
1369 nmdc:mga05p37_55463_c1
1370 nmdc:mga05p37_61064_c1
1371 nmdc:mga05p37_67228_c1
1372 nmdc:mga05p37_81118_c1
1373 nmdc:mga05p37_854_c1
1374 nmdc:mga09592_130475_c1
1375 nmdc:mga09592_14152_c1
1376 nmdc:mga09592_156291_c1
1377 nmdc:mga09592_1608_c1
1378 nmdc:mga09592_385116_c1
1379 nmdc:mga09592_42183_c1
1380 nmdc:mga09592_71837_c1
1381 nmdc:mga09592_8360_c1
1382 nmdc:mga09592_9669_c1
1383 nmdc:mga0qj67_10857_c1
1384 nmdc:mga0qj67_30906_c1
1385 nmdc:mga0qj67_321481_c1
1386 nmdc:mga0qj67_38756_c1
1387 nmdc:mga0qj67_437011_c1
1388 nmdc:mga0qj67_49460_c1
1389 nmdc:mga0qj67_7568_c1
1390 nmdc:mga0qj67_8848_c1
1391 nmdc:mga06r32_102247_c1
1392 nmdc:mga06r32_11511_c1
1393 nmdc:mga06r32_124096_c1
1394 nmdc:mga06r32_142_c1
1395 nmdc:mga06r32_20346_c1
1396 nmdc:mga06r32_214713_c1
1397 nmdc:mga06r32_2636_c1
1398 nmdc:mga06r32_3307_c1
1399 nmdc:mga06r32_563_c1
1400 nmdc:mga06r32_75348_c1
1401 nmdc:mga06r32_7643_c1
1402 nmdc:mga08y16_1556_c1
1403 nmdc:mga08y16_1975_c1
1404 nmdc:mga08y16_256654_c1
1405 nmdc:mga0n895_107708_c1
1406 nmdc:mga0n895_116482_c1
1407 nmdc:mga0n895_257562_c1
1408 nmdc:mga0n895_28765_c1
1409 nmdc:mga0n895_296709_c1
1410 nmdc:mga0n895_320917_c1
1411 nmdc:mga0n895_350208_c1
1412 nmdc:mga0n895_41627_c1
1413 nmdc:mga0n895_793_c1
1414 nmdc:mga0n895_8409_c1
1415 nmdc:mga0rr50_148429_c1
1416 nmdc:mga0rr50_167295_c1
1417 nmdc:mga0rr50_172782_c1
1418 nmdc:mga0rr50_17497_c1
1419 nmdc:mga0rr50_236121_c1
1420 nmdc:mga0rr50_2746_c1
1421 nmdc:mga0rr50_28279_c1
1422 nmdc:mga0rr50_301701_c1
1423 nmdc:mga0rr50_320382_c1
1424 nmdc:mga0rr50_63146_c1
1425 nmdc:mga08x19_23829_c1
1426 nmdc:mga08x19_31353_c1
1427 nmdc:mga08x19_69286_c1
1428 nmdc:mga0a205_10795_c1
1429 nmdc:mga0a205_11007_c1
1430 nmdc:mga0a205_143276_c1
1431 nmdc:mga0a205_15690_c1
1432 nmdc:mga0a205_179999_c1
1433 nmdc:mga0a205_197288_c1
1434 nmdc:mga0a205_219805_c1
1435 nmdc:mga0a205_259909_c1
1436 nmdc:mga0a205_28063_c1
1437 nmdc:mga0a205_3559_c2
1438 nmdc:mga0a205_36866_c1
1439 nmdc:mga0a205_75063_c1
1440 nmdc:mga0sz30_112146_c1
1441 nmdc:mga0sz30_1316_c1
1442 Ga0500641_0000586
1443 Ga0500568_0036762
1444 Ga0500616_0005290
1445 Ga0500552_000950
1446 Ga0501084_0002636
1447 Ga0501084_0005617
1448 Ga0501084_0017737
1449 Ga0501084_0026857
1450 Ga0501084_0028751
1451 Ga0501084_0059477
1452 Ga0501084_0167413
1453 Ga0501084_0341903
1454 Ga0590074_009378
1455 Ga0501082_0003434
1456 Ga0501082_0052648
1457 Ga0501082_0058273
1458 Ga0501082_0261772
1459 Ga0530510_0053920
1460 Ga0530510_0064107
1461 Ga0530510_0081238
1462 Ga0530510_0092790
1463 Ga0530510_0216417
1464 Ga0530510_0458035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

43

266

0.86

PF12146

Hydrolase_4

Serine aminopeptidase, S33

55

266

0.81

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

44

272

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2og1-assembly1.cif.gz_A crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 0.8507 6 260
3v1k-assembly1.cif.gz_A crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400. 0.8493 6 260
4lxg-assembly1.cif.gz_A-2 crystal structure of dxnb2, a carbon - carbon bond hydrolase from sphingomonas wittichii rw1 0.8364 5 260
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8349 6 123
2puh-assembly1.cif.gz_A crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda 0.833 6 260
ID Description Score Start End Superfamily
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8379 3 112 3.40.50.12270
2puhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.833 6 260 3.40.50.1820
4i3fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8251 4 258 3.40.50.1820
af_E9QD39_49_328_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.822 6 259 3.40.50.1820
1iunA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8212 8 260 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6B1AAK0-F1-model_v4 Alpha/beta hydrolase 0.9749 1 253 GO:0016787
AF-A0A6B1AAK0-F1-model_v4 Alpha/beta hydrolase 0.9636 1 253 GO:0016787
AF-A0A2N0MBI2-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9549 31 255
AF-A0A523P200-F1-model_v4 Alpha/beta hydrolase 0.9529 6 259 GO:0016020
GO:0016787
AF-A0A2V8IKH5-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9482 4 258

Map