F477834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 416 | 1456 | 166 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8054160619|8054166577 |
| Length | 206 |
| Sequence | PPSADAAPGAAPPTGCELQLMVLDVNGEQHEVITEPRRTLVDVLRHDLRLTGTHVGCEHGICGACTVLLDGRPVRSCLMFAAQAEGAALRTVESLAPDGAPTEGPEEGPEAGAQAPPAPGDRLSDLQQAFRAHHALQCGFCTPGFLMLAEGFLAERPDPDEAEIREVVAANLCRCTGYQPLVAAIAQCAAARRAARENRSAQRKEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 184 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 185 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 218 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 219 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 368 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 369 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 370 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 371 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 372 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 373 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 376 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 379 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 382 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 389 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 390 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 391 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 392 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 396 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 397 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 398 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 399 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 400 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 401 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 402 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 403 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 404 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 405 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 406 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 407 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 408 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 409 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 410 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 411 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 412 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 413 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 414 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 415 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 416 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.25 |
| Metatranscriptomes | 0 |
| Isolates | 2.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.73 |
| Nodule | 0.14 |
| Rhizoplane | 4.81 |
| Rhizosphere | 76.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214800762 | 2209111006 | Bacteria | 10804 |
| 2 | ARcpr5oldR_c000446 | 3300000041 | Bacteria | 5488 |
| 3 | ARSoilYngRDRAFT_c00556 | 3300000042 | Bacteria | 4157 |
| 4 | ARcpr5yngRDRAFT_c000070 | 3300000043 | Bacteria | 16857 |
| 5 | ARSoilOldRDRAFT_c000067 | 3300000044 | Bacteria | 20226 |
| 6 | ARCol0yngRDRAFT_1000193 | 3300000652 | Bacteria | 10259 |
| 7 | Ga0065716_1003993 | 3300005277 | Bacteria | 1088 |
| 8 | Ga0065712_10076534 | 3300005290 | Bacteria | 3637 |
| 9 | Ga0065715_10616772 | 3300005293 | Bacteria | 696 |
| 10 | Ga0070658_10108111 | 3300005327 | Bacteria | 2302 |
| 11 | Ga0070683_100008747 | 3300005329 | Bacteria | 8607 |
| 12 | Ga0070683_100209957 | 3300005329 | Bacteria | 1849 |
| 13 | Ga0070683_100796466 | 3300005329 | Bacteria | 906 |
| 14 | Ga0070683_100813056 | 3300005329 | Bacteria | 896 |
| 15 | Ga0070683_101098190 | 3300005329 | Bacteria | 764 |
| 16 | Ga0070666_11129222 | 3300005335 | Bacteria | 583 |
| 17 | Ga0070680_100229131 | 3300005336 | Bacteria | 1569 |
| 18 | Ga0070680_100453644 | 3300005336 | Bacteria | 1095 |
| 19 | Ga0070682_100007844 | 3300005337 | Bacteria | 6008 |
| 20 | Ga0068868_100005522 | 3300005338 | Bacteria | 8893 |
| 21 | Ga0068868_100729344 | 3300005338 | Bacteria | 889 |
| 22 | Ga0070660_100083064 | 3300005339 | Bacteria | 2516 |
| 23 | Ga0070689_100237244 | 3300005340 | Bacteria | 1501 |
| 24 | Ga0070691_10022954 | 3300005341 | Bacteria | 2896 |
| 25 | Ga0070687_100389892 | 3300005343 | Bacteria | 910 |
| 26 | Ga0070668_100059432 | 3300005347 | Bacteria | 2959 |
| 27 | Ga0070669_100026214 | 3300005353 | Bacteria | 4193 |
| 28 | Ga0070675_100024093 | 3300005354 | Bacteria | 4872 |
| 29 | Ga0070675_100215185 | 3300005354 | Bacteria | 1672 |
| 30 | Ga0070675_100413386 | 3300005354 | Bacteria | 1205 |
| 31 | Ga0070671_100002215 | 3300005355 | Bacteria | 15011 |
| 32 | Ga0070671_100714594 | 3300005355 | Bacteria | 870 |
| 33 | Ga0070674_100477317 | 3300005356 | Bacteria | 1034 |
| 34 | Ga0070673_100061776 | 3300005364 | Bacteria | 2974 |
| 35 | Ga0070688_100053201 | 3300005365 | Bacteria | 2531 |
| 36 | Ga0070688_100173768 | 3300005365 | Bacteria | 1489 |
| 37 | Ga0070659_100047803 | 3300005366 | Bacteria | 3358 |
| 38 | Ga0070659_100092062 | 3300005366 | Bacteria | 2431 |
| 39 | Ga0070659_100541196 | 3300005366 | Bacteria | 996 |
| 40 | Ga0070667_101659418 | 3300005367 | Bacteria | 601 |
| 41 | Ga0070709_10316054 | 3300005434 | Bacteria | 1145 |
| 42 | Ga0070714_100001413 | 3300005435 | Bacteria | 17421 |
| 43 | Ga0070714_100192637 | 3300005435 | Bacteria | 1861 |
| 44 | Ga0070713_100006384 | 3300005436 | Bacteria | 8170 |
| 45 | Ga0070713_100405551 | 3300005436 | Bacteria | 1274 |
| 46 | Ga0070710_10015107 | 3300005437 | Bacteria | 3900 |
| 47 | Ga0070710_10125681 | 3300005437 | Bacteria | 1558 |
| 48 | Ga0070711_100057100 | 3300005439 | Bacteria | 2702 |
| 49 | Ga0070711_100442748 | 3300005439 | Bacteria | 1062 |
| 50 | Ga0070711_100444004 | 3300005439 | Bacteria | 1061 |
| 51 | Ga0070711_100490290 | 3300005439 | Bacteria | 1012 |
| 52 | Ga0070705_100642430 | 3300005440 | Bacteria | 826 |
| 53 | Ga0070700_100001758 | 3300005441 | Bacteria | 10896 |
| 54 | Ga0070700_100332340 | 3300005441 | Bacteria | 1120 |
| 55 | Ga0070708_100645047 | 3300005445 | Bacteria | 998 |
| 56 | Ga0070708_101429973 | 3300005445 | Bacteria | 645 |
| 57 | Ga0070663_100007556 | 3300005455 | Bacteria | 6625 |
| 58 | Ga0070663_101040900 | 3300005455 | Bacteria | 713 |
| 59 | Ga0070662_100068362 | 3300005457 | Bacteria | 2611 |
| 60 | Ga0070662_100136337 | 3300005457 | Bacteria | 1898 |
| 61 | Ga0070681_10243404 | 3300005458 | Bacteria | 1712 |
| 62 | Ga0070681_10270148 | 3300005458 | Bacteria | 1612 |
| 63 | Ga0070681_10379751 | 3300005458 | Bacteria | 1324 |
| 64 | Ga0070681_10473407 | 3300005458 | Bacteria | 1165 |
| 65 | Ga0068867_100488734 | 3300005459 | Bacteria | 1056 |
| 66 | Ga0070698_100001534 | 3300005471 | Bacteria | 25641 |
| 67 | Ga0070698_100016842 | 3300005471 | Bacteria | 7708 |
| 68 | Ga0070698_100069221 | 3300005471 | Bacteria | 3544 |
| 69 | Ga0070679_100085062 | 3300005530 | Bacteria | 3150 |
| 70 | Ga0070679_100086884 | 3300005530 | Bacteria | 3114 |
| 71 | Ga0070679_100773490 | 3300005530 | Bacteria | 903 |
| 72 | Ga0070684_100030916 | 3300005535 | Bacteria | 4554 |
| 73 | Ga0068853_100343521 | 3300005539 | Bacteria | 1387 |
| 74 | Ga0070672_100390803 | 3300005543 | Bacteria | 1191 |
| 75 | Ga0070686_100714812 | 3300005544 | Bacteria | 800 |
| 76 | Ga0070695_100122805 | 3300005545 | Bacteria | 1779 |
| 77 | Ga0070695_100725187 | 3300005545 | Bacteria | 791 |
| 78 | Ga0070695_101309261 | 3300005545 | Bacteria | 599 |
| 79 | Ga0070696_100020433 | 3300005546 | Bacteria | 4488 |
| 80 | Ga0070696_100121446 | 3300005546 | Bacteria | 1891 |
| 81 | Ga0070693_100049467 | 3300005547 | Bacteria | 2398 |
| 82 | Ga0070665_100001501 | 3300005548 | Bacteria | 27159 |
| 83 | Ga0070665_100544926 | 3300005548 | Bacteria | 1172 |
| 84 | Ga0070704_100018089 | 3300005549 | Bacteria | 4497 |
| 85 | Ga0070664_100541257 | 3300005564 | Bacteria | 1076 |
| 86 | Ga0070664_101051574 | 3300005564 | Bacteria | 766 |
| 87 | Ga0070702_100029125 | 3300005615 | Bacteria | 3000 |
| 88 | Ga0070702_100320099 | 3300005615 | Bacteria | 1081 |
| 89 | Ga0070702_100453080 | 3300005615 | Bacteria | 931 |
| 90 | Ga0068859_100106258 | 3300005617 | Bacteria | 2866 |
| 91 | Ga0068859_100670348 | 3300005617 | Bacteria | 1129 |
| 92 | Ga0068864_100077554 | 3300005618 | Bacteria | 2906 |
| 93 | Ga0068861_100718861 | 3300005719 | Bacteria | 930 |
| 94 | Ga0068861_100968508 | 3300005719 | Bacteria | 810 |
| 95 | Ga0068861_101145800 | 3300005719 | Bacteria | 749 |
| 96 | Ga0068863_100085035 | 3300005841 | Bacteria | 2998 |
| 97 | Ga0068863_100331404 | 3300005841 | Bacteria | 1480 |
| 98 | Ga0068860_100002999 | 3300005843 | Bacteria | 17439 |
| 99 | Ga0068860_100003607 | 3300005843 | Bacteria | 15907 |
| 100 | Ga0068860_100388569 | 3300005843 | Bacteria | 1378 |
| 101 | Ga0068860_100445501 | 3300005843 | Bacteria | 1287 |
| 102 | Ga0068860_100867170 | 3300005843 | Bacteria | 918 |
| 103 | Ga0068862_100192698 | 3300005844 | Bacteria | 1835 |
| 104 | Ga0081455_10227417 | 3300005937 | Bacteria | 1379 |
| 105 | Ga0081538_10000527 | 3300005981 | Bacteria | 42416 |
| 106 | Ga0081538_10016841 | 3300005981 | Bacteria | 5579 |
| 107 | Ga0081538_10105882 | 3300005981 | Bacteria | 1398 |
| 108 | Ga0081540_1028469 | 3300005983 | Bacteria | 3137 |
| 109 | Ga0081540_1080844 | 3300005983 | Bacteria | 1463 |
| 110 | Ga0070717_10054851 | 3300006028 | Bacteria | 3288 |
| 111 | Ga0070717_10101143 | 3300006028 | Bacteria | 2448 |
| 112 | Ga0075365_10186117 | 3300006038 | Bacteria | 1452 |
| 113 | Ga0075365_10296209 | 3300006038 | Bacteria | 1138 |
| 114 | Ga0075368_10004789 | 3300006042 | Bacteria | 4610 |
| 115 | Ga0075363_100113574 | 3300006048 | Bacteria | 1507 |
| 116 | Ga0075364_10404144 | 3300006051 | Bacteria | 932 |
| 117 | Ga0075432_10033172 | 3300006058 | Bacteria | 1790 |
| 118 | Ga0070716_100298537 | 3300006173 | Bacteria | 1119 |
| 119 | Ga0070712_100002998 | 3300006175 | Bacteria | 10452 |
| 120 | Ga0070712_100019314 | 3300006175 | Bacteria | 4444 |
| 121 | Ga0070712_100085171 | 3300006175 | Bacteria | 2300 |
| 122 | Ga0070712_100214162 | 3300006175 | Bacteria | 1521 |
| 123 | Ga0070712_100691514 | 3300006175 | Bacteria | 869 |
| 124 | Ga0075367_10005037 | 3300006178 | Bacteria | 6513 |
| 125 | Ga0097621_100990265 | 3300006237 | Bacteria | 786 |
| 126 | Ga0068871_101792336 | 3300006358 | Bacteria | 583 |
| 127 | Ga0075430_100298286 | 3300006846 | Bacteria | 1333 |
| 128 | Ga0075431_100126184 | 3300006847 | Bacteria | 2640 |
| 129 | Ga0075433_10196534 | 3300006852 | Bacteria | 1794 |
| 130 | Ga0075434_100064070 | 3300006871 | Bacteria | 3659 |
| 131 | Ga0075434_100071307 | 3300006871 | Bacteria | 3466 |
| 132 | Ga0075434_101735361 | 3300006871 | Bacteria | 632 |
| 133 | Ga0068865_100230426 | 3300006881 | Bacteria | 1453 |
| 134 | Ga0068865_101195414 | 3300006881 | Bacteria | 673 |
| 135 | Ga0075436_100085479 | 3300006914 | Bacteria | 2190 |
| 136 | Ga0097620_100106260 | 3300006931 | Bacteria | 2866 |
| 137 | Ga0097620_100670324 | 3300006931 | Bacteria | 1129 |
| 138 | Ga0075435_100004162 | 3300007076 | Bacteria | 9921 |
| 139 | Ga0075435_100470903 | 3300007076 | Bacteria | 1084 |
| 140 | Ga0075435_100614116 | 3300007076 | Bacteria | 943 |
| 141 | Ga0075435_100933193 | 3300007076 | Bacteria | 757 |
| 142 | Ga0099795_10000092 | 3300007788 | Bacteria | 15117 |
| 143 | Ga0105240_11284954 | 3300009093 | Bacteria | 772 |
| 144 | Ga0111539_10020125 | 3300009094 | Bacteria | 8222 |
| 145 | Ga0111539_10190763 | 3300009094 | Bacteria | 2391 |
| 146 | Ga0111539_11219505 | 3300009094 | Bacteria | 874 |
| 147 | Ga0105245_10153495 | 3300009098 | Bacteria | 2179 |
| 148 | Ga0105245_11346420 | 3300009098 | Bacteria | 763 |
| 149 | Ga0105245_12062001 | 3300009098 | Bacteria | 624 |
| 150 | Ga0105247_10005076 | 3300009101 | Bacteria | 8342 |
| 151 | Ga0105247_10133477 | 3300009101 | Bacteria | 1620 |
| 152 | Ga0114129_10013624 | 3300009147 | Bacteria | 11586 |
| 153 | Ga0114129_10689956 | 3300009147 | Bacteria | 1313 |
| 154 | Ga0105243_10062762 | 3300009148 | Bacteria | 2975 |
| 155 | Ga0105243_10215312 | 3300009148 | Bacteria | 1694 |
| 156 | Ga0105241_10077219 | 3300009174 | Bacteria | 2599 |
| 157 | Ga0105241_11154935 | 3300009174 | Bacteria | 731 |
| 158 | Ga0105242_10109619 | 3300009176 | Bacteria | 2351 |
| 159 | Ga0105248_10025309 | 3300009177 | Bacteria | 6598 |
| 160 | Ga0105248_10242782 | 3300009177 | Bacteria | 2028 |
| 161 | Ga0105237_10235354 | 3300009545 | Bacteria | 1833 |
| 162 | Ga0105237_10623556 | 3300009545 | Bacteria | 1085 |
| 163 | Ga0105237_10962068 | 3300009545 | Bacteria | 861 |
| 164 | Ga0105238_10399418 | 3300009551 | Bacteria | 1367 |
| 165 | Ga0105238_11414038 | 3300009551 | Bacteria | 723 |
| 166 | Ga0105249_10015588 | 3300009553 | Bacteria | 6728 |
| 167 | Ga0105249_10064947 | 3300009553 | Bacteria | 3356 |
| 168 | Ga0105249_10453574 | 3300009553 | Bacteria | 1321 |
| 169 | Ga0099796_10003919 | 3300010159 | Bacteria | 3527 |
| 170 | Ga0105239_10009877 | 3300010375 | Bacteria | 10720 |
| 171 | Ga0105239_10109708 | 3300010375 | Bacteria | 3058 |
| 172 | Ga0105246_10163957 | 3300011119 | Bacteria | 1696 |
| 173 | Ga0105246_11263826 | 3300011119 | Bacteria | 682 |
| 174 | Ga0157342_1050605 | 3300012507 | Bacteria | 583 |
| 175 | Ga0157369_10606169 | 3300013105 | Bacteria | 1130 |
| 176 | Ga0157374_10009417 | 3300013296 | Bacteria | 8382 |
| 177 | Ga0157374_11075169 | 3300013296 | Bacteria | 825 |
| 178 | Ga0157378_12320861 | 3300013297 | Bacteria | 588 |
| 179 | Ga0163162_10170220 | 3300013306 | Bacteria | 2303 |
| 180 | Ga0163162_11188342 | 3300013306 | Bacteria | 865 |
| 181 | Ga0163162_11227218 | 3300013306 | Bacteria | 851 |
| 182 | Ga0157372_10029090 | 3300013307 | Bacteria | 6029 |
| 183 | Ga0157372_10418591 | 3300013307 | Bacteria | 1561 |
| 184 | Ga0163163_10009747 | 3300014325 | Bacteria | 8601 |
| 185 | Ga0163163_10097190 | 3300014325 | Bacteria | 2965 |
| 186 | Ga0163163_10827047 | 3300014325 | Bacteria | 990 |
| 187 | Ga0182008_10247495 | 3300014497 | Bacteria | 919 |
| 188 | Ga0157377_10001064 | 3300014745 | Bacteria | 11594 |
| 189 | Ga0157379_10005209 | 3300014968 | Bacteria | 11167 |
| 190 | Ga0157379_10538002 | 3300014968 | Bacteria | 1086 |
| 191 | Ga0157379_10555563 | 3300014968 | Bacteria | 1068 |
| 192 | Ga0157376_10042271 | 3300014969 | Bacteria | 3736 |
| 193 | Ga0163161_10444667 | 3300017792 | Bacteria | 1047 |
| 194 | Ga0213874_10070723 | 3300021377 | Bacteria | 1112 |
| 195 | Ga0213876_10047462 | 3300021384 | Bacteria | 2270 |
| 196 | Ga0213876_10242218 | 3300021384 | Bacteria | 958 |
| 197 | Ga0213875_10000074 | 3300021388 | Bacteria | 118349 |
| 198 | Ga0213875_10083738 | 3300021388 | Bacteria | 1488 |
| 199 | Ga0213875_10218784 | 3300021388 | Bacteria | 897 |
| 200 | Ga0207697_10016459 | 3300025315 | Bacteria | 3046 |
| 201 | Ga0207692_10010423 | 3300025898 | Bacteria | 3916 |
| 202 | Ga0207710_10329507 | 3300025900 | Bacteria | 775 |
| 203 | Ga0207688_10015212 | 3300025901 | Bacteria | 4174 |
| 204 | Ga0207688_10070790 | 3300025901 | Bacteria | 1979 |
| 205 | Ga0207688_10569247 | 3300025901 | Bacteria | 713 |
| 206 | Ga0207647_10178837 | 3300025904 | Bacteria | 1233 |
| 207 | Ga0207685_10109340 | 3300025905 | Bacteria | 1195 |
| 208 | Ga0207685_10116224 | 3300025905 | Bacteria | 1167 |
| 209 | Ga0207705_10087822 | 3300025909 | Bacteria | 2274 |
| 210 | Ga0207684_10014054 | 3300025910 | Bacteria | 6914 |
| 211 | Ga0207684_10175140 | 3300025910 | Bacteria | 1850 |
| 212 | Ga0207654_10568465 | 3300025911 | Bacteria | 807 |
| 213 | Ga0207707_10066192 | 3300025912 | Bacteria | 3146 |
| 214 | Ga0207707_10228863 | 3300025912 | Bacteria | 1618 |
| 215 | Ga0207671_10174075 | 3300025914 | Bacteria | 1672 |
| 216 | Ga0207693_10004345 | 3300025915 | Bacteria | 11993 |
| 217 | Ga0207693_10011832 | 3300025915 | Bacteria | 7053 |
| 218 | Ga0207663_10014943 | 3300025916 | Bacteria | 4268 |
| 219 | Ga0207663_10280875 | 3300025916 | Bacteria | 1237 |
| 220 | Ga0207660_10352029 | 3300025917 | Bacteria | 1180 |
| 221 | Ga0207662_10287704 | 3300025918 | Bacteria | 1089 |
| 222 | Ga0207662_10424706 | 3300025918 | Bacteria | 905 |
| 223 | Ga0207657_10025235 | 3300025919 | Bacteria | 5485 |
| 224 | Ga0207657_10046602 | 3300025919 | Bacteria | 3797 |
| 225 | Ga0207649_10137568 | 3300025920 | Bacteria | 1667 |
| 226 | Ga0207652_10110725 | 3300025921 | Bacteria | 2435 |
| 227 | Ga0207694_10984364 | 3300025924 | Bacteria | 714 |
| 228 | Ga0207659_10072132 | 3300025926 | Bacteria | 2523 |
| 229 | Ga0207659_10336308 | 3300025926 | Bacteria | 1249 |
| 230 | Ga0207687_10062939 | 3300025927 | Bacteria | 2625 |
| 231 | Ga0207687_10167001 | 3300025927 | Bacteria | 1694 |
| 232 | Ga0207700_10053165 | 3300025928 | Bacteria | 3033 |
| 233 | Ga0207664_10000800 | 3300025929 | Bacteria | 21281 |
| 234 | Ga0207664_10134351 | 3300025929 | Bacteria | 2086 |
| 235 | Ga0207664_10396794 | 3300025929 | Bacteria | 1226 |
| 236 | Ga0207664_11289383 | 3300025929 | Bacteria | 650 |
| 237 | Ga0207644_10003127 | 3300025931 | Bacteria | 10658 |
| 238 | Ga0207644_10790756 | 3300025931 | Bacteria | 793 |
| 239 | Ga0207690_10010595 | 3300025932 | Bacteria | 5487 |
| 240 | Ga0207690_10219795 | 3300025932 | Bacteria | 1453 |
| 241 | Ga0207690_10365409 | 3300025932 | Bacteria | 1144 |
| 242 | Ga0207706_10067682 | 3300025933 | Bacteria | 3142 |
| 243 | Ga0207706_10068728 | 3300025933 | Bacteria | 3116 |
| 244 | Ga0207706_10159690 | 3300025933 | Bacteria | 1982 |
| 245 | Ga0207686_10310744 | 3300025934 | Bacteria | 1174 |
| 246 | Ga0207709_10081950 | 3300025935 | Bacteria | 2082 |
| 247 | Ga0207709_10187643 | 3300025935 | Bacteria | 1466 |
| 248 | Ga0207670_10367097 | 3300025936 | Bacteria | 1143 |
| 249 | Ga0207669_10476838 | 3300025937 | Bacteria | 994 |
| 250 | Ga0207704_10365499 | 3300025938 | Bacteria | 1128 |
| 251 | Ga0207665_10249411 | 3300025939 | Bacteria | 1311 |
| 252 | Ga0207691_11359313 | 3300025940 | Bacteria | 585 |
| 253 | Ga0207661_10028254 | 3300025944 | Bacteria | 4293 |
| 254 | Ga0207661_10212835 | 3300025944 | Bacteria | 1704 |
| 255 | Ga0207661_10405595 | 3300025944 | Bacteria | 1237 |
| 256 | Ga0207661_10729062 | 3300025944 | Bacteria | 912 |
| 257 | Ga0207661_11249223 | 3300025944 | Unclassified | 683 |
| 258 | Ga0207679_10465288 | 3300025945 | Bacteria | 1123 |
| 259 | Ga0207651_10051881 | 3300025960 | Bacteria | 2794 |
| 260 | Ga0207712_10058288 | 3300025961 | Bacteria | 2728 |
| 261 | Ga0207712_10324601 | 3300025961 | Bacteria | 1271 |
| 262 | Ga0207712_10491330 | 3300025961 | Bacteria | 1048 |
| 263 | Ga0207668_10080494 | 3300025972 | Bacteria | 2360 |
| 264 | Ga0207668_10527160 | 3300025972 | Bacteria | 1020 |
| 265 | Ga0207658_10533121 | 3300025986 | Bacteria | 1049 |
| 266 | Ga0207677_10367516 | 3300026023 | Bacteria | 1210 |
| 267 | Ga0207703_10018798 | 3300026035 | Bacteria | 5396 |
| 268 | Ga0207703_10093625 | 3300026035 | Bacteria | 2531 |
| 269 | Ga0207703_10671945 | 3300026035 | Bacteria | 984 |
| 270 | Ga0207639_10177218 | 3300026041 | Bacteria | 1810 |
| 271 | Ga0207639_10386948 | 3300026041 | Bacteria | 1257 |
| 272 | Ga0207678_10021491 | 3300026067 | Bacteria | 5659 |
| 273 | Ga0207678_10835469 | 3300026067 | Bacteria | 814 |
| 274 | Ga0207708_10000722 | 3300026075 | Bacteria | 24877 |
| 275 | Ga0207708_10090323 | 3300026075 | Bacteria | 2361 |
| 276 | Ga0207641_10464408 | 3300026088 | Bacteria | 1225 |
| 277 | Ga0207648_10421286 | 3300026089 | Bacteria | 1212 |
| 278 | Ga0207676_10082679 | 3300026095 | Bacteria | 2613 |
| 279 | Ga0207675_100303376 | 3300026118 | Bacteria | 1556 |
| 280 | Ga0207675_100663148 | 3300026118 | Bacteria | 1050 |
| 281 | Ga0207675_100986255 | 3300026118 | Bacteria | 861 |
| 282 | Ga0207675_101230805 | 3300026118 | Bacteria | 769 |
| 283 | Ga0207698_10869070 | 3300026142 | Bacteria | 908 |
| 284 | Ga0209984_1006808 | 3300027424 | Bacteria | 1408 |
| 285 | Ga0209179_1002556 | 3300027512 | Bacteria | 2478 |
| 286 | Ga0209998_10029173 | 3300027717 | Bacteria | 1216 |
| 287 | Ga0209998_10045794 | 3300027717 | Bacteria | 1003 |
| 288 | Ga0209974_10024913 | 3300027876 | Bacteria | 1980 |
| 289 | Ga0207428_10005312 | 3300027907 | Bacteria | 12017 |
| 290 | Ga0207428_10052112 | 3300027907 | Bacteria | 3269 |
| 291 | Ga0268266_10325064 | 3300028379 | Bacteria | 1440 |
| 292 | Ga0268266_10570942 | 3300028379 | Bacteria | 1085 |
| 293 | Ga0268265_10048213 | 3300028380 | Bacteria | 3197 |
| 294 | Ga0268265_10587506 | 3300028380 | Bacteria | 1062 |
| 295 | Ga0268264_10000119 | 3300028381 | Bacteria | 192507 |
| 296 | Ga0268264_10003330 | 3300028381 | Bacteria | 13888 |
| 297 | Ga0268264_10174690 | 3300028381 | Bacteria | 1946 |
| 298 | Ga0268264_10388597 | 3300028381 | Bacteria | 1338 |
| 299 | Ga0307517_10014916 | 3300028786 | Bacteria | 10379 |
| 300 | Ga0307517_10044999 | 3300028786 | Bacteria | 4650 |
| 301 | Ga0307515_10000025 | 3300028794 | Bacteria | 390205 |
| 302 | Ga0307515_10012166 | 3300028794 | Bacteria | 16224 |
| 303 | Ga0307515_10024738 | 3300028794 | Bacteria | 10438 |
| 304 | Ga0307515_10029689 | 3300028794 | Bacteria | 9226 |
| 305 | Ga0307515_10072557 | 3300028794 | Bacteria | 4642 |
| 306 | Ga0307515_10176271 | 3300028794 | Bacteria | 2107 |
| 307 | Ga0307515_10281381 | 3300028794 | Bacteria | 1370 |
| 308 | Ga0307511_10004686 | 3300030521 | Bacteria | 13981 |
| 309 | Ga0307511_10110106 | 3300030521 | Bacteria | 1757 |
| 310 | Ga0307511_10247809 | 3300030521 | Bacteria | 860 |
| 311 | Ga0307512_10002952 | 3300030522 | Bacteria | 20535 |
| 312 | Ga0307512_10004206 | 3300030522 | Bacteria | 15910 |
| 313 | Ga0307512_10012997 | 3300030522 | Bacteria | 7825 |
| 314 | Ga0307512_10163618 | 3300030522 | Bacteria | 1295 |
| 315 | Ga0307513_10008140 | 3300031456 | Bacteria | 13460 |
| 316 | Ga0307513_10009327 | 3300031456 | Bacteria | 12425 |
| 317 | Ga0307513_10359149 | 3300031456 | Bacteria | 1202 |
| 318 | Ga0307509_10007842 | 3300031507 | Bacteria | 13806 |
| 319 | Ga0307509_10012362 | 3300031507 | Bacteria | 10220 |
| 320 | Ga0307509_10028165 | 3300031507 | Bacteria | 6248 |
| 321 | Ga0307509_10038694 | 3300031507 | Bacteria | 5202 |
| 322 | Ga0307509_10054861 | 3300031507 | Bacteria | 4240 |
| 323 | Ga0307509_10435209 | 3300031507 | Bacteria | 1009 |
| 324 | Ga0307408_100077930 | 3300031548 | Bacteria | 2469 |
| 325 | Ga0307508_10000627 | 3300031616 | Bacteria | 42456 |
| 326 | Ga0307508_10045944 | 3300031616 | Bacteria | 3900 |
| 327 | Ga0307508_10059091 | 3300031616 | Bacteria | 3392 |
| 328 | Ga0307508_10059877 | 3300031616 | Bacteria | 3368 |
| 329 | Ga0307508_10075682 | 3300031616 | Bacteria | 2943 |
| 330 | Ga0307508_10201051 | 3300031616 | Bacteria | 1593 |
| 331 | Ga0307508_10328127 | 3300031616 | Bacteria | 1122 |
| 332 | Ga0307514_10002480 | 3300031649 | Bacteria | 19123 |
| 333 | Ga0307514_10123001 | 3300031649 | Bacteria | 1804 |
| 334 | Ga0307514_10350973 | 3300031649 | Bacteria | 786 |
| 335 | Ga0307516_10001908 | 3300031730 | Bacteria | 28553 |
| 336 | Ga0307516_10019620 | 3300031730 | Bacteria | 6999 |
| 337 | Ga0307516_10030055 | 3300031730 | Bacteria | 5486 |
| 338 | Ga0307516_10324135 | 3300031730 | Bacteria | 1211 |
| 339 | Ga0307516_10537083 | 3300031730 | Bacteria | 823 |
| 340 | Ga0307410_10033280 | 3300031852 | Bacteria | 3327 |
| 341 | Ga0307406_10265283 | 3300031901 | Bacteria | 1301 |
| 342 | Ga0307416_100462691 | 3300032002 | Bacteria | 1324 |
| 343 | Ga0307507_10024849 | 3300033179 | Bacteria | 6514 |
| 344 | Ga0307507_10026989 | 3300033179 | Bacteria | 6172 |
| 345 | Ga0307507_10116918 | 3300033179 | Bacteria | 2152 |
| 346 | Ga0307507_10178558 | 3300033179 | Bacteria | 1523 |
| 347 | Ga0307510_10004705 | 3300033180 | Bacteria | 16125 |
| 348 | Ga0307510_10025114 | 3300033180 | Bacteria | 6876 |
| 349 | Ga0307510_10034361 | 3300033180 | Bacteria | 5680 |
| 350 | Ga0307510_10069533 | 3300033180 | Bacteria | 3525 |
| 351 | Ga0307510_10078190 | 3300033180 | Bacteria | 3238 |
| 352 | Ga0307510_10299809 | 3300033180 | Bacteria | 1070 |
| 353 | Ga0373930_0001567 | 3300034816 | Bacteria | 3431 |
| 354 | Ga0373958_0000580 | 3300034819 | Bacteria | 4539 |
| 355 | Ga0373928_0000280 | 3300035084 | Bacteria | 10071 |
| 356 | Ga0373940_0001444 | 3300035088 | Bacteria | 4300 |
| 357 | Ga0373949_0002668 | 3300035090 | Bacteria | 4485 |
| 358 | Ga0373951_0005177 | 3300035091 | Bacteria | 3046 |
| 359 | Ga0373952_0003660 | 3300035092 | Bacteria | 2772 |
| 360 | Ga0373932_0001203 | 3300035112 | Bacteria | 7373 |
| 361 | Ga0373939_0001268 | 3300035114 | Bacteria | 6172 |
| 362 | Ga0373941_0000810 | 3300035115 | Bacteria | 6412 |
| 363 | Ga0373957_0131245 | 3300035120 | Bacteria | 1020 |
| 364 | Ga0373960_0004662 | 3300035121 | Bacteria | 3149 |
| 365 | Ga0373943_0103805 | 3300035170 | Bacteria | 1490 |
| 366 | Ga0373942_0012849 | 3300035207 | Bacteria | 2005 |
| 367 | Ga0373961_0004256 | 3300035241 | Bacteria | 3470 |
| 368 | Ga0373962_0002764 | 3300035242 | Bacteria | 4184 |
| 369 | Ga0373924_0068290 | 3300035410 | Bacteria | 1496 |
| 370 | Ga0373931_0058043 | 3300035691 | Bacteria | 2077 |
| 371 | Ga0373931_0192761 | 3300035691 | Bacteria | 1213 |
| 372 | Ga0373931_0215008 | 3300035691 | Bacteria | 1155 |
| 373 | Ga0373935_0141054 | 3300035692 | Bacteria | 1628 |
| 374 | Ga0373935_0587877 | 3300035692 | Bacteria | 813 |
| 375 | Ga0373927_0039399 | 3300035695 | Bacteria | 3067 |
| 376 | Ga0373933_0045841 | 3300035724 | Bacteria | 2594 |
| 377 | Ga0373947_0105164 | 3300035725 | Bacteria | 1778 |
| 378 | Ga0373937_0018204 | 3300036401 | Bacteria | 6269 |
| 379 | Ga0373937_0541008 | 3300036401 | Bacteria | 1106 |
| 380 | Ga0373925_0200509 | 3300037068 | Bacteria | 1587 |
| 381 | Ga0373925_0613290 | 3300037068 | Bacteria | 896 |
| 382 | Ga0395899_0115731 | 3300037312 | Bacteria | 1924 |
| 383 | Ga0395900_0232277 | 3300037418 | Bacteria | 1854 |
| 384 | Ga0436364_0459773 | 3300037853 | Bacteria | 2353 |
| 385 | Ga0436364_0737000 | 3300037853 | Bacteria | 4393 |
| 386 | Ga0436364_1034674 | 3300037853 | Bacteria | 2829 |
| 387 | Ga0436364_1494924 | 3300037853 | Bacteria | 1111 |
| 388 | Ga0395901_0246435 | 3300038443 | Bacteria | 1862 |
| 389 | Ga0395901_0551761 | 3300038443 | Bacteria | 1168 |
| 390 | Ga0436365_0073382 | 3300039437 | Bacteria | 4911 |
| 391 | Ga0436365_1794781 | 3300039437 | Bacteria | 817 |
| 392 | Ga0436365_1804874 | 3300039437 | Bacteria | 4035 |
| 393 | Ga0436363_0715612 | 3300039450 | Bacteria | 666 |
| 394 | Ga0436362_0399580 | 3300039453 | Bacteria | 1155 |
| 395 | Ga0436362_0406741 | 3300039453 | Bacteria | 774 |
| 396 | Ga0439461_0159308 | 3300041410 | Bacteria | 587 |
| 397 | Ga0451802_1201114 | 3300041460 | Bacteria | 844 |
| 398 | Ga0439452_068361 | 3300042010 | Bacteria | 786 |
| 399 | Ga0450902_026053 | 3300042137 | Bacteria | 977 |
| 400 | Ga0439446_0027614 | 3300042156 | Bacteria | 1630 |
| 401 | Ga0439464_0047193 | 3300042439 | Bacteria | 1239 |
| 402 | Ga0439460_0079371 | 3300042461 | Bacteria | 1028 |
| 403 | Ga0451577_0062823 | 3300042876 | Bacteria | 3312 |
| 404 | Ga0451577_0436270 | 3300042876 | Bacteria | 1189 |
| 405 | Ga0466972_0000820 | 3300044658 | Bacteria | 14864 |
| 406 | Ga0453683_0100189 | 3300044673 | Unclassified | 1818 |
| 407 | Ga0466965_0002113 | 3300044683 | Bacteria | 8341 |
| 408 | Ga0466963_0116972 | 3300044694 | Bacteria | 1832 |
| 409 | Ga0466963_0506159 | 3300044694 | Bacteria | 853 |
| 410 | Ga0466970_0005554 | 3300044765 | Bacteria | 6267 |
| 411 | Ga0466970_0120005 | 3300044765 | Bacteria | 1440 |
| 412 | Ga0466960_0001965 | 3300044901 | Bacteria | 7609 |
| 413 | Ga0466960_0011636 | 3300044901 | Bacteria | 3690 |
| 414 | Ga0466959_0200948 | 3300045049 | Bacteria | 1388 |
| 415 | Ga0451576_0146333 | 3300045051 | Bacteria | 2463 |
| 416 | Ga0451576_0279148 | 3300045051 | Bacteria | 1747 |
| 417 | Ga0466967_0885733 | 3300045976 | Bacteria | 887 |
| 418 | Ga0466967_1307818 | 3300045976 | Bacteria | 722 |
| 419 | Ga0495592_0003230 | 3300046454 | Bacteria | 11685 |
| 420 | Ga0495592_0117172 | 3300046454 | Bacteria | 1878 |
| 421 | Ga0495603_0006944 | 3300046455 | Bacteria | 6791 |
| 422 | Ga0495603_0153903 | 3300046455 | Bacteria | 1335 |
| 423 | Ga0495629_0008343 | 3300046459 | Bacteria | 7618 |
| 424 | Ga0495629_0008698 | 3300046459 | Bacteria | 7470 |
| 425 | Ga0495629_0010044 | 3300046459 | Bacteria | 6907 |
| 426 | Ga0495629_0053023 | 3300046459 | Bacteria | 2838 |
| 427 | Ga0495638_0332073 | 3300046460 | Bacteria | 808 |
| 428 | Ga0495651_0000641 | 3300046462 | Bacteria | 27005 |
| 429 | Ga0495651_0005504 | 3300046462 | Bacteria | 9662 |
| 430 | Ga0495651_0051986 | 3300046462 | Bacteria | 3157 |
| 431 | Ga0495653_0000532 | 3300046463 | Bacteria | 29172 |
| 432 | Ga0495580_0137480 | 3300046472 | Bacteria | 1694 |
| 433 | Ga0495582_0011499 | 3300046473 | Bacteria | 4877 |
| 434 | Ga0495582_0188928 | 3300046473 | Bacteria | 1175 |
| 435 | Ga0495662_0000382 | 3300046476 | Bacteria | 19658 |
| 436 | Ga0495664_0001758 | 3300046477 | Bacteria | 11511 |
| 437 | Ga0495664_0343604 | 3300046477 | Bacteria | 899 |
| 438 | Ga0495584_0021930 | 3300046491 | Bacteria | 3243 |
| 439 | Ga0495606_0030447 | 3300046507 | Bacteria | 3771 |
| 440 | Ga0495606_0082485 | 3300046507 | Bacteria | 1996 |
| 441 | Ga0495608_0004541 | 3300046511 | Bacteria | 9920 |
| 442 | Ga0495618_0009578 | 3300046514 | Bacteria | 5848 |
| 443 | Ga0495618_0036261 | 3300046514 | Bacteria | 3094 |
| 444 | Ga0495618_0619805 | 3300046514 | Bacteria | 642 |
| 445 | Ga0495628_0027352 | 3300046516 | Bacteria | 4642 |
| 446 | Ga0495628_0170838 | 3300046516 | Bacteria | 1648 |
| 447 | Ga0495628_0500797 | 3300046516 | Bacteria | 877 |
| 448 | Ga0495630_0004892 | 3300046517 | Bacteria | 9410 |
| 449 | Ga0495630_0103220 | 3300046517 | Bacteria | 2157 |
| 450 | Ga0495630_0233407 | 3300046517 | Bacteria | 1406 |
| 451 | Ga0495631_0215362 | 3300046518 | Bacteria | 820 |
| 452 | Ga0495648_0028394 | 3300046524 | Bacteria | 3727 |
| 453 | Ga0495648_0121078 | 3300046524 | Bacteria | 1406 |
| 454 | Ga0495652_0001336 | 3300046529 | Bacteria | 27452 |
| 455 | Ga0495652_0009215 | 3300046529 | Bacteria | 8974 |
| 456 | Ga0495652_0026992 | 3300046529 | Bacteria | 5065 |
| 457 | Ga0495652_0111893 | 3300046529 | Bacteria | 2194 |
| 458 | Ga0495665_0103788 | 3300046531 | Bacteria | 1491 |
| 459 | Ga0495665_0473075 | 3300046531 | Bacteria | 632 |
| 460 | Ga0495640_0189746 | 3300046533 | Bacteria | 1307 |
| 461 | Ga0495586_0132076 | 3300046535 | Bacteria | 1398 |
| 462 | Ga0495587_0000512 | 3300046536 | Bacteria | 26945 |
| 463 | Ga0495587_0062518 | 3300046536 | Bacteria | 2179 |
| 464 | Ga0495645_0004214 | 3300046543 | Bacteria | 9838 |
| 465 | Ga0495645_0074448 | 3300046543 | Bacteria | 2445 |
| 466 | Ga0495667_0001063 | 3300046559 | Bacteria | 17859 |
| 467 | Ga0495634_0001377 | 3300046642 | Bacteria | 21944 |
| 468 | Ga0495634_0007540 | 3300046642 | Bacteria | 8159 |
| 469 | Ga0495634_0074455 | 3300046642 | Bacteria | 2231 |
| 470 | Ga0495611_0016735 | 3300046648 | Bacteria | 3134 |
| 471 | Ga0495611_0135868 | 3300046648 | Bacteria | 1148 |
| 472 | Ga0495625_0034416 | 3300046660 | Bacteria | 3739 |
| 473 | Ga0495635_0000455 | 3300046663 | Bacteria | 25907 |
| 474 | Ga0495635_0001032 | 3300046663 | Bacteria | 18442 |
| 475 | Ga0495635_0008433 | 3300046663 | Bacteria | 7196 |
| 476 | Ga0495635_0728454 | 3300046663 | Bacteria | 642 |
| 477 | Ga0495661_0160153 | 3300046665 | Bacteria | 1209 |
| 478 | Ga0495588_0177286 | 3300046674 | Bacteria | 1126 |
| 479 | Ga0495657_0000556 | 3300046675 | Bacteria | 34468 |
| 480 | Ga0495657_0006059 | 3300046675 | Bacteria | 9494 |
| 481 | Ga0495599_0000308 | 3300046678 | Bacteria | 29564 |
| 482 | Ga0495599_0231636 | 3300046678 | Bacteria | 1128 |
| 483 | Ga0495623_0000694 | 3300046679 | Bacteria | 22387 |
| 484 | Ga0495623_0250247 | 3300046679 | Bacteria | 997 |
| 485 | Ga0495623_0294993 | 3300046679 | Bacteria | 898 |
| 486 | Ga0495646_0003088 | 3300046680 | Bacteria | 10333 |
| 487 | Ga0495646_0061235 | 3300046680 | Bacteria | 2242 |
| 488 | Ga0495646_0066491 | 3300046680 | Bacteria | 2132 |
| 489 | Ga0495647_0334442 | 3300046681 | Bacteria | 687 |
| 490 | Ga0495658_0004671 | 3300046683 | Bacteria | 6737 |
| 491 | Ga0495658_0074852 | 3300046683 | Bacteria | 1974 |
| 492 | Ga0495658_0414639 | 3300046683 | Bacteria | 859 |
| 493 | Ga0495669_0000684 | 3300046684 | Bacteria | 14764 |
| 494 | Ga0495613_0001129 | 3300046689 | Bacteria | 20328 |
| 495 | Ga0495613_0003840 | 3300046689 | Bacteria | 11245 |
| 496 | Ga0495613_0076432 | 3300046689 | Bacteria | 2437 |
| 497 | Ga0495613_0243399 | 3300046689 | Bacteria | 1257 |
| 498 | Ga0495624_0070725 | 3300046690 | Bacteria | 2172 |
| 499 | Ga0495670_0042134 | 3300046691 | Bacteria | 2278 |
| 500 | Ga0495671_0028098 | 3300046692 | Bacteria | 2900 |
| 501 | Ga0495671_0089728 | 3300046692 | Bacteria | 1505 |
| 502 | Ga0495589_0040052 | 3300046794 | Bacteria | 2340 |
| 503 | Ga0495600_0002183 | 3300046809 | Bacteria | 11112 |
| 504 | Ga0495581_0023636 | 3300047315 | Bacteria | 3561 |
| 505 | Ga0495581_0316848 | 3300047315 | Bacteria | 911 |
| 506 | Ga0495604_0000213 | 3300047317 | Bacteria | 53409 |
| 507 | Ga0495604_0002124 | 3300047317 | Bacteria | 15957 |
| 508 | Ga0495636_0000883 | 3300047318 | Bacteria | 11091 |
| 509 | Ga0495636_0096107 | 3300047318 | Bacteria | 1291 |
| 510 | Ga0495674_0011928 | 3300047319 | Bacteria | 8194 |
| 511 | Ga0495674_0137770 | 3300047319 | Bacteria | 2052 |
| 512 | Ga0495672_0027939 | 3300047320 | Bacteria | 3577 |
| 513 | Ga0495672_0116323 | 3300047320 | Bacteria | 1428 |
| 514 | Ga0495676_0000413 | 3300047321 | Bacteria | 34737 |
| 515 | Ga0495676_0012477 | 3300047321 | Bacteria | 7651 |
| 516 | Ga0495676_0013907 | 3300047321 | Bacteria | 7214 |
| 517 | Ga0495687_003190 | 3300047443 | Bacteria | 12170 |
| 518 | Ga0495687_004123 | 3300047443 | Bacteria | 10027 |
| 519 | Ga0495687_017067 | 3300047443 | Bacteria | 3634 |
| 520 | Ga0495675_0001609 | 3300047444 | Bacteria | 13573 |
| 521 | Ga0495677_0149711 | 3300047445 | Bacteria | 898 |
| 522 | Ga0495685_003174 | 3300047447 | Bacteria | 5218 |
| 523 | Ga0495685_064440 | 3300047447 | Bacteria | 1232 |
| 524 | Ga0495673_0001012 | 3300047469 | Bacteria | 24787 |
| 525 | Ga0495681_0006963 | 3300047470 | Bacteria | 7324 |
| 526 | Ga0495684_0000903 | 3300047471 | Bacteria | 24073 |
| 527 | Ga0495686_0100409 | 3300047472 | Bacteria | 1746 |
| 528 | Ga0495593_0001416 | 3300047673 | Bacteria | 14059 |
| 529 | Ga0495593_0139624 | 3300047673 | Bacteria | 1228 |
| 530 | Ga0495593_0462388 | 3300047673 | Bacteria | 635 |
| 531 | Ga0495602_0001348 | 3300048088 | Bacteria | 24232 |
| 532 | Ga0495602_0028433 | 3300048088 | Bacteria | 5350 |
| 533 | Ga0495614_0000735 | 3300048089 | Bacteria | 13871 |
| 534 | Ga0495614_0116982 | 3300048089 | Bacteria | 1173 |
| 535 | Ga0496100_0219890 | 3300048903 | Bacteria | 1393 |
| 536 | Ga0496102_0025311 | 3300048905 | Bacteria | 5282 |
| 537 | Ga0496102_0073457 | 3300048905 | Bacteria | 3143 |
| 538 | Ga0496103_0186610 | 3300048906 | Bacteria | 1333 |
| 539 | Ga0496104_0005007 | 3300048907 | Bacteria | 11555 |
| 540 | Ga0496104_0110184 | 3300048907 | Bacteria | 2639 |
| 541 | Ga0496104_0143428 | 3300048907 | Bacteria | 2294 |
| 542 | Ga0496105_0028661 | 3300048908 | Bacteria | 4554 |
| 543 | Ga0496105_0235737 | 3300048908 | Bacteria | 1486 |
| 544 | Ga0496105_0323321 | 3300048908 | Archaea | 1236 |
| 545 | Ga0496106_0008827 | 3300048909 | Bacteria | 7449 |
| 546 | Ga0496106_0042912 | 3300048909 | Bacteria | 3392 |
| 547 | Ga0496106_0060164 | 3300048909 | Bacteria | 2879 |
| 548 | Ga0496106_0278104 | 3300048909 | Bacteria | 1341 |
| 549 | Ga0496107_0014180 | 3300048910 | Bacteria | 5581 |
| 550 | Ga0496107_0021859 | 3300048910 | Bacteria | 4521 |
| 551 | Ga0496107_0163846 | 3300048910 | Bacteria | 1648 |
| 552 | Ga0496108_0001304 | 3300048911 | Bacteria | 19616 |
| 553 | Ga0496108_0073389 | 3300048911 | Bacteria | 2889 |
| 554 | Ga0496108_0092467 | 3300048911 | Bacteria | 2572 |
| 555 | Ga0496108_0714523 | 3300048911 | Bacteria | 868 |
| 556 | Ga0496109_0003457 | 3300048912 | Bacteria | 13191 |
| 557 | Ga0496109_0005799 | 3300048912 | Bacteria | 10340 |
| 558 | Ga0496109_0013836 | 3300048912 | Bacteria | 7011 |
| 559 | Ga0496110_0009849 | 3300048913 | Bacteria | 7745 |
| 560 | Ga0496110_0056983 | 3300048913 | Bacteria | 3439 |
| 561 | Ga0496112_0003458 | 3300048915 | Bacteria | 13050 |
| 562 | Ga0496112_0036812 | 3300048915 | Bacteria | 4774 |
| 563 | Ga0496113_0067309 | 3300048916 | Bacteria | 2715 |
| 564 | Ga0496113_0081135 | 3300048916 | Bacteria | 2485 |
| 565 | Ga0496114_0248171 | 3300048917 | Bacteria | 1566 |
| 566 | Ga0496115_0030116 | 3300048918 | Bacteria | 4267 |
| 567 | Ga0496115_0409242 | 3300048918 | Bacteria | 1100 |
| 568 | Ga0496117_0046970 | 3300048920 | Bacteria | 3101 |
| 569 | Ga0496118_0008644 | 3300048921 | Bacteria | 10479 |
| 570 | Ga0496119_0124966 | 3300048922 | Bacteria | 1409 |
| 571 | Ga0496121_0000668 | 3300048924 | Bacteria | 64093 |
| 572 | Ga0496124_0000955 | 3300048927 | Bacteria | 46091 |
| 573 | Ga0496124_0824984 | 3300048927 | Bacteria | 571 |
| 574 | Ga0496125_0015321 | 3300048928 | Bacteria | 7420 |
| 575 | Ga0496125_0459411 | 3300048928 | Bacteria | 727 |
| 576 | Ga0496126_0007074 | 3300048929 | Bacteria | 12359 |
| 577 | Ga0496126_0294409 | 3300048929 | Bacteria | 1341 |
| 578 | Ga0496126_0463440 | 3300048929 | Bacteria | 1018 |
| 579 | Ga0501033_0009826 | 3300049570 | Bacteria | 7344 |
| 580 | Ga0501034_0038412 | 3300049571 | Bacteria | 4848 |
| 581 | Ga0501036_0011904 | 3300049572 | Bacteria | 7211 |
| 582 | Ga0501036_0526581 | 3300049572 | Bacteria | 983 |
| 583 | Ga0501037_0053217 | 3300049573 | Bacteria | 2961 |
| 584 | Ga0501038_0003213 | 3300049574 | Bacteria | 15250 |
| 585 | Ga0501038_0246682 | 3300049574 | Bacteria | 1416 |
| 586 | Ga0501038_0347854 | 3300049574 | Bacteria | 1155 |
| 587 | Ga0501039_0001002 | 3300049575 | Bacteria | 20580 |
| 588 | Ga0501040_0000976 | 3300049576 | Bacteria | 18083 |
| 589 | Ga0501040_0193357 | 3300049576 | Bacteria | 1444 |
| 590 | Ga0501041_0000633 | 3300049577 | Bacteria | 18386 |
| 591 | Ga0501041_0150905 | 3300049577 | Bacteria | 1451 |
| 592 | Ga0501042_0000928 | 3300049578 | Bacteria | 16503 |
| 593 | Ga0501043_0025356 | 3300049579 | Bacteria | 4652 |
| 594 | Ga0501046_0002250 | 3300049580 | Bacteria | 18209 |
| 595 | Ga0501046_0407735 | 3300049580 | Bacteria | 981 |
| 596 | Ga0501047_0003179 | 3300049581 | Bacteria | 15567 |
| 597 | Ga0501047_0013145 | 3300049581 | Bacteria | 7840 |
| 598 | Ga0501047_0233904 | 3300049581 | Bacteria | 1690 |
| 599 | Ga0501048_0001788 | 3300049582 | Bacteria | 16340 |
| 600 | Ga0501048_0198836 | 3300049582 | Bacteria | 1421 |
| 601 | Ga0501067_0410490 | 3300049583 | Bacteria | 755 |
| 602 | Ga0501068_0009389 | 3300049584 | Bacteria | 5471 |
| 603 | Ga0501069_0055980 | 3300049585 | Bacteria | 2197 |
| 604 | Ga0501069_0318971 | 3300049585 | Bacteria | 913 |
| 605 | Ga0501070_0058039 | 3300049586 | Bacteria | 3209 |
| 606 | Ga0501070_0742791 | 3300049586 | Bacteria | 774 |
| 607 | Ga0501071_0000518 | 3300049587 | Bacteria | 19663 |
| 608 | Ga0501072_0004996 | 3300049588 | Bacteria | 10091 |
| 609 | Ga0501073_0066103 | 3300049589 | Bacteria | 2521 |
| 610 | Ga0501073_0617820 | 3300049589 | Bacteria | 748 |
| 611 | Ga0501074_0049015 | 3300049590 | Bacteria | 3050 |
| 612 | Ga0501074_0392050 | 3300049590 | Bacteria | 985 |
| 613 | Ga0501075_0004425 | 3300049591 | Bacteria | 9506 |
| 614 | Ga0501076_0021850 | 3300049592 | Bacteria | 4912 |
| 615 | Ga0501077_0000169 | 3300049593 | Bacteria | 37313 |
| 616 | Ga0501079_0001306 | 3300049741 | Bacteria | 17540 |
| 617 | Ga0501079_0352451 | 3300049741 | Bacteria | 1153 |
| 618 | Ga0501079_0462559 | 3300049741 | Bacteria | 996 |
| 619 | Ga0501080_0005909 | 3300049742 | Bacteria | 10962 |
| 620 | Ga0501080_0449665 | 3300049742 | Bacteria | 1155 |
| 621 | Ga0501081_0000045 | 3300049743 | Bacteria | 47062 |
| 622 | Ga0501083_0019006 | 3300049744 | Bacteria | 4783 |
| 623 | Ga0501035_0018417 | 3300049822 | Bacteria | 6435 |
| 624 | Ga0501035_0330881 | 3300049822 | Bacteria | 1278 |
| 625 | Ga0501035_0499727 | 3300049822 | Bacteria | 1001 |
| 626 | Ga0501044_0019766 | 3300049823 | Bacteria | 7196 |
| 627 | Ga0501044_0039232 | 3300049823 | Bacteria | 4941 |
| 628 | Ga0501044_0104244 | 3300049823 | Bacteria | 2850 |
| 629 | Ga0501044_0303115 | 3300049823 | Bacteria | 1526 |
| 630 | Ga0501044_1104406 | 3300049823 | Bacteria | 662 |
| 631 | Ga0501045_0001264 | 3300049824 | Bacteria | 16786 |
| 632 | Ga0501045_0095507 | 3300049824 | Bacteria | 2199 |
| 633 | nmdc:mga03n38_823490_c1 | 3300050490 | Bacteria | 542 |
| 634 | nmdc:mga00v17_722887_c1 | 3300050491 | Bacteria | 637 |
| 635 | nmdc:mga0yw44_163548_c1 | 3300050492 | Unclassified | 1458 |
| 636 | nmdc:mga0yw44_29605_c1 | 3300050492 | Bacteria | 3162 |
| 637 | nmdc:mga06z11_7499_c1 | 3300050494 | Bacteria | 4492 |
| 638 | nmdc:mga05p37_128369_c1 | 3300050507 | Bacteria | 3112 |
| 639 | nmdc:mga05p37_20494_c1 | 3300050507 | Bacteria | 7998 |
| 640 | nmdc:mga05p37_470153_c1 | 3300050507 | Bacteria | 1149 |
| 641 | nmdc:mga0qj67_310234_c1 | 3300050509 | Bacteria | 1277 |
| 642 | nmdc:mga06r32_1311537_c1 | 3300050510 | Bacteria | 668 |
| 643 | nmdc:mga08y16_13298_c1 | 3300050511 | Bacteria | 8656 |
| 644 | nmdc:mga08y16_40442_c1 | 3300050511 | Bacteria | 4888 |
| 645 | nmdc:mga0n895_102785_c1 | 3300050512 | Bacteria | 2869 |
| 646 | nmdc:mga0n895_2166187_c1 | 3300050512 | Bacteria | 512 |
| 647 | nmdc:mga0n895_240225_c1 | 3300050512 | Bacteria | 1838 |
| 648 | nmdc:mga0rr50_1032947_c1 | 3300050513 | Bacteria | 700 |
| 649 | nmdc:mga0rr50_1119532_c1 | 3300050513 | Bacteria | 670 |
| 650 | nmdc:mga0rr50_412937_c1 | 3300050513 | Bacteria | 1141 |
| 651 | nmdc:mga0rr50_57431_c1 | 3300050513 | Bacteria | 2911 |
| 652 | nmdc:mga08x19_76577_c1 | 3300050514 | Bacteria | 2189 |
| 653 | nmdc:mga08x19_826620_c1 | 3300050514 | Bacteria | 658 |
| 654 | nmdc:mga08x19_87379_c1 | 3300050514 | Bacteria | 2054 |
| 655 | nmdc:mga0a205_277738_c1 | 3300050515 | Bacteria | 1551 |
| 656 | nmdc:mga0a205_95019_c1 | 3300050515 | Bacteria | 2880 |
| 657 | Ga0495601_0015103 | 3300053077 | Bacteria | 4664 |
| 658 | Ga0495601_0048787 | 3300053077 | Bacteria | 2667 |
| 659 | Ga0495601_0065794 | 3300053077 | Bacteria | 2307 |
| 660 | Ga0495612_0003965 | 3300053078 | Bacteria | 6146 |
| 661 | Ga0495612_0011152 | 3300053078 | Bacteria | 3628 |
| 662 | Ga0495612_0332280 | 3300053078 | Bacteria | 685 |
| 663 | Ga0495619_0082153 | 3300053085 | Bacteria | 2171 |
| 664 | Ga0495619_0131409 | 3300053085 | Bacteria | 1721 |
| 665 | Ga0500644_0014454 | 3300053088 | Bacteria | 2230 |
| 666 | Ga0500644_0020409 | 3300053088 | Bacteria | 1969 |
| 667 | Ga0500646_0047703 | 3300053090 | Bacteria | 1226 |
| 668 | Ga0500651_0046293 | 3300053093 | Bacteria | 2736 |
| 669 | Ga0500651_0081699 | 3300053093 | Bacteria | 2001 |
| 670 | Ga0500566_0030101 | 3300053094 | Bacteria | 3167 |
| 671 | Ga0500566_0169412 | 3300053094 | Bacteria | 1130 |
| 672 | Ga0500640_018152 | 3300053095 | Bacteria | 2996 |
| 673 | Ga0500650_0019758 | 3300053098 | Bacteria | 2946 |
| 674 | Ga0500553_016785 | 3300053101 | Bacteria | 3717 |
| 675 | Ga0500560_013422 | 3300053107 | Bacteria | 2153 |
| 676 | Ga0500562_003500 | 3300053108 | Bacteria | 3938 |
| 677 | Ga0500569_054976 | 3300053109 | Bacteria | 1213 |
| 678 | Ga0500572_001959 | 3300053111 | Bacteria | 5163 |
| 679 | Ga0500572_118274 | 3300053111 | Bacteria | 856 |
| 680 | Ga0500580_178402 | 3300053113 | Bacteria | 727 |
| 681 | Ga0500594_0006611 | 3300053118 | Bacteria | 2610 |
| 682 | Ga0500595_004573 | 3300053119 | Bacteria | 6173 |
| 683 | Ga0500608_048785 | 3300053122 | Bacteria | 2035 |
| 684 | Ga0500614_021406 | 3300053123 | Bacteria | 1500 |
| 685 | Ga0500652_152031 | 3300053131 | Bacteria | 960 |
| 686 | Ga0500559_0000427 | 3300053136 | Bacteria | 29923 |
| 687 | Ga0500564_185064 | 3300053138 | Bacteria | 866 |
| 688 | Ga0500568_0047011 | 3300053139 | Bacteria | 1711 |
| 689 | Ga0500573_0042003 | 3300053140 | Bacteria | 2641 |
| 690 | Ga0500586_224923 | 3300053145 | Bacteria | 602 |
| 691 | Ga0500616_0016185 | 3300053153 | Bacteria | 4250 |
| 692 | Ga0500616_0146432 | 3300053153 | Bacteria | 1098 |
| 693 | Ga0500622_0298318 | 3300053156 | Bacteria | 688 |
| 694 | Ga0500624_003453 | 3300053157 | Bacteria | 2074 |
| 695 | Ga0500638_235590 | 3300053162 | Bacteria | 748 |
| 696 | Ga0500636_0289670 | 3300053177 | Bacteria | 812 |
| 697 | Ga0500637_0212565 | 3300053178 | Bacteria | 1096 |
| 698 | Ga0500570_121204 | 3300053724 | Bacteria | 1026 |
| 699 | Ga0500656_035974 | 3300053732 | Bacteria | 677 |
| 700 | Ga0500552_060677 | 3300053733 | Bacteria | 661 |
| 701 | Ga0500596_003877 | 3300053735 | Bacteria | 2799 |
| 702 | Ga0500596_003879 | 3300053735 | Bacteria | 2798 |
| 703 | Ga0501084_0006845 | 3300054114 | Bacteria | 9384 |
| 704 | Ga0501082_0001888 | 3300060353 | Bacteria | 18435 |
| 705 | Ga0501082_0546710 | 3300060353 | Bacteria | 1013 |
| 706 | Ga0466962_0225772 | 3300061719 | Bacteria | 918 |
| 707 | Ga0530510_0005780 | 3300061734 | Bacteria | 8572 |
| 708 | Ga0530510_0673698 | 3300061734 | Bacteria | 788 |
| 709 | 8054166577 | 8054160619 | Bacteria | 7783213 |
| 710 | 2545675814 | 2545555834 | Bacteria | 8130841 |
| 711 | 2573036749 | 2571042588 | Bacteria | 5045676 |
| 712 | 2578335951 | 2576861424 | Bacteria | 5270569 |
| 713 | 2580931093 | 2579778775 | Bacteria | 5360914 |
| 714 | 2621274124 | 2619619294 | Bacteria | 5575484 |
| 715 | 2793980625 | 2791355406 | Bacteria | 11364898 |
| 716 | 2884701163 | 2884693830 | Bacteria | 11273186 |
| 717 | 2895442947 | 2895442618 | Bacteria | 11027144 |
| 718 | 2902793556 | 2902792274 | Bacteria | 7270173 |
| 719 | 2971514666 | 2971511577 | Bacteria | 5404012 |
| 720 | 2980180774 | 2980176882 | Bacteria | 5397533 |
| 721 | 8045867076 | 8045864390 | Bacteria | 5043873 |
| 722 | 8047901262 | 8047893842 | Bacteria | 11723082 |
| 723 | 8048135654 | 8048127548 | Bacteria | 11053136 |
| 724 | 8048357638 | 8048356638 | Bacteria | 11044339 |
| 725 | 8048378202 | 8048369669 | Bacteria | 11666822 |
| 726 | 8048387300 | 8048379754 | Bacteria | 11877923 |
| 727 | 8054476203 | 8054472261 | Bacteria | 7464355 |
| 728 | 8055173998 | 8055172936 | Bacteria | 9305943 |
| 729 | 2214800762 | |||
| 730 | ARcpr5oldR_c000446 | |||
| 731 | ARSoilYngRDRAFT_c00556 | |||
| 732 | ARcpr5yngRDRAFT_c000070 | |||
| 733 | ARSoilOldRDRAFT_c000067 | |||
| 734 | ARCol0yngRDRAFT_1000193 | |||
| 735 | Ga0065716_1003993 | |||
| 736 | Ga0065712_10076534 | |||
| 737 | Ga0065715_10616772 | |||
| 738 | Ga0070658_10108111 | |||
| 739 | Ga0070683_100008747 | |||
| 740 | Ga0070683_100209957 | |||
| 741 | Ga0070683_100796466 | |||
| 742 | Ga0070683_100813056 | |||
| 743 | Ga0070683_101098190 | |||
| 744 | Ga0070666_11129222 | |||
| 745 | Ga0070680_100229131 | |||
| 746 | Ga0070680_100453644 | |||
| 747 | Ga0070682_100007844 | |||
| 748 | Ga0068868_100005522 | |||
| 749 | Ga0068868_100729344 | |||
| 750 | Ga0070660_100083064 | |||
| 751 | Ga0070689_100237244 | |||
| 752 | Ga0070691_10022954 | |||
| 753 | Ga0070687_100389892 | |||
| 754 | Ga0070668_100059432 | |||
| 755 | Ga0070669_100026214 | |||
| 756 | Ga0070675_100024093 | |||
| 757 | Ga0070675_100215185 | |||
| 758 | Ga0070675_100413386 | |||
| 759 | Ga0070671_100002215 | |||
| 760 | Ga0070671_100714594 | |||
| 761 | Ga0070674_100477317 | |||
| 762 | Ga0070673_100061776 | |||
| 763 | Ga0070688_100053201 | |||
| 764 | Ga0070688_100173768 | |||
| 765 | Ga0070659_100047803 | |||
| 766 | Ga0070659_100092062 | |||
| 767 | Ga0070659_100541196 | |||
| 768 | Ga0070667_101659418 | |||
| 769 | Ga0070709_10316054 | |||
| 770 | Ga0070714_100001413 | |||
| 771 | Ga0070714_100192637 | |||
| 772 | Ga0070713_100006384 | |||
| 773 | Ga0070713_100405551 | |||
| 774 | Ga0070710_10015107 | |||
| 775 | Ga0070710_10125681 | |||
| 776 | Ga0070711_100057100 | |||
| 777 | Ga0070711_100442748 | |||
| 778 | Ga0070711_100444004 | |||
| 779 | Ga0070711_100490290 | |||
| 780 | Ga0070705_100642430 | |||
| 781 | Ga0070700_100001758 | |||
| 782 | Ga0070700_100332340 | |||
| 783 | Ga0070708_100645047 | |||
| 784 | Ga0070708_101429973 | |||
| 785 | Ga0070663_100007556 | |||
| 786 | Ga0070663_101040900 | |||
| 787 | Ga0070662_100068362 | |||
| 788 | Ga0070662_100136337 | |||
| 789 | Ga0070681_10243404 | |||
| 790 | Ga0070681_10270148 | |||
| 791 | Ga0070681_10379751 | |||
| 792 | Ga0070681_10473407 | |||
| 793 | Ga0068867_100488734 | |||
| 794 | Ga0070698_100001534 | |||
| 795 | Ga0070698_100016842 | |||
| 796 | Ga0070698_100069221 | |||
| 797 | Ga0070679_100085062 | |||
| 798 | Ga0070679_100086884 | |||
| 799 | Ga0070679_100773490 | |||
| 800 | Ga0070684_100030916 | |||
| 801 | Ga0068853_100343521 | |||
| 802 | Ga0070672_100390803 | |||
| 803 | Ga0070686_100714812 | |||
| 804 | Ga0070695_100122805 | |||
| 805 | Ga0070695_100725187 | |||
| 806 | Ga0070695_101309261 | |||
| 807 | Ga0070696_100020433 | |||
| 808 | Ga0070696_100121446 | |||
| 809 | Ga0070693_100049467 | |||
| 810 | Ga0070665_100001501 | |||
| 811 | Ga0070665_100544926 | |||
| 812 | Ga0070704_100018089 | |||
| 813 | Ga0070664_100541257 | |||
| 814 | Ga0070664_101051574 | |||
| 815 | Ga0070702_100029125 | |||
| 816 | Ga0070702_100320099 | |||
| 817 | Ga0070702_100453080 | |||
| 818 | Ga0068859_100106258 | |||
| 819 | Ga0068859_100670348 | |||
| 820 | Ga0068864_100077554 | |||
| 821 | Ga0068861_100718861 | |||
| 822 | Ga0068861_100968508 | |||
| 823 | Ga0068861_101145800 | |||
| 824 | Ga0068863_100085035 | |||
| 825 | Ga0068863_100331404 | |||
| 826 | Ga0068860_100002999 | |||
| 827 | Ga0068860_100003607 | |||
| 828 | Ga0068860_100388569 | |||
| 829 | Ga0068860_100445501 | |||
| 830 | Ga0068860_100867170 | |||
| 831 | Ga0068862_100192698 | |||
| 832 | Ga0081455_10227417 | |||
| 833 | Ga0081538_10000527 | |||
| 834 | Ga0081538_10016841 | |||
| 835 | Ga0081538_10105882 | |||
| 836 | Ga0081540_1028469 | |||
| 837 | Ga0081540_1080844 | |||
| 838 | Ga0070717_10054851 | |||
| 839 | Ga0070717_10101143 | |||
| 840 | Ga0075365_10186117 | |||
| 841 | Ga0075365_10296209 | |||
| 842 | Ga0075368_10004789 | |||
| 843 | Ga0075363_100113574 | |||
| 844 | Ga0075364_10404144 | |||
| 845 | Ga0075432_10033172 | |||
| 846 | Ga0070716_100298537 | |||
| 847 | Ga0070712_100002998 | |||
| 848 | Ga0070712_100019314 | |||
| 849 | Ga0070712_100085171 | |||
| 850 | Ga0070712_100214162 | |||
| 851 | Ga0070712_100691514 | |||
| 852 | Ga0075367_10005037 | |||
| 853 | Ga0097621_100990265 | |||
| 854 | Ga0068871_101792336 | |||
| 855 | Ga0075430_100298286 | |||
| 856 | Ga0075431_100126184 | |||
| 857 | Ga0075433_10196534 | |||
| 858 | Ga0075434_100064070 | |||
| 859 | Ga0075434_100071307 | |||
| 860 | Ga0075434_101735361 | |||
| 861 | Ga0068865_100230426 | |||
| 862 | Ga0068865_101195414 | |||
| 863 | Ga0075436_100085479 | |||
| 864 | Ga0097620_100106260 | |||
| 865 | Ga0097620_100670324 | |||
| 866 | Ga0075435_100004162 | |||
| 867 | Ga0075435_100470903 | |||
| 868 | Ga0075435_100614116 | |||
| 869 | Ga0075435_100933193 | |||
| 870 | Ga0099795_10000092 | |||
| 871 | Ga0105240_11284954 | |||
| 872 | Ga0111539_10020125 | |||
| 873 | Ga0111539_10190763 | |||
| 874 | Ga0111539_11219505 | |||
| 875 | Ga0105245_10153495 | |||
| 876 | Ga0105245_11346420 | |||
| 877 | Ga0105245_12062001 | |||
| 878 | Ga0105247_10005076 | |||
| 879 | Ga0105247_10133477 | |||
| 880 | Ga0114129_10013624 | |||
| 881 | Ga0114129_10689956 | |||
| 882 | Ga0105243_10062762 | |||
| 883 | Ga0105243_10215312 | |||
| 884 | Ga0105241_10077219 | |||
| 885 | Ga0105241_11154935 | |||
| 886 | Ga0105242_10109619 | |||
| 887 | Ga0105248_10025309 | |||
| 888 | Ga0105248_10242782 | |||
| 889 | Ga0105237_10235354 | |||
| 890 | Ga0105237_10623556 | |||
| 891 | Ga0105237_10962068 | |||
| 892 | Ga0105238_10399418 | |||
| 893 | Ga0105238_11414038 | |||
| 894 | Ga0105249_10015588 | |||
| 895 | Ga0105249_10064947 | |||
| 896 | Ga0105249_10453574 | |||
| 897 | Ga0099796_10003919 | |||
| 898 | Ga0105239_10009877 | |||
| 899 | Ga0105239_10109708 | |||
| 900 | Ga0105246_10163957 | |||
| 901 | Ga0105246_11263826 | |||
| 902 | Ga0157342_1050605 | |||
| 903 | Ga0157369_10606169 | |||
| 904 | Ga0157374_10009417 | |||
| 905 | Ga0157374_11075169 | |||
| 906 | Ga0157378_12320861 | |||
| 907 | Ga0163162_10170220 | |||
| 908 | Ga0163162_11188342 | |||
| 909 | Ga0163162_11227218 | |||
| 910 | Ga0157372_10029090 | |||
| 911 | Ga0157372_10418591 | |||
| 912 | Ga0163163_10009747 | |||
| 913 | Ga0163163_10097190 | |||
| 914 | Ga0163163_10827047 | |||
| 915 | Ga0182008_10247495 | |||
| 916 | Ga0157377_10001064 | |||
| 917 | Ga0157379_10005209 | |||
| 918 | Ga0157379_10538002 | |||
| 919 | Ga0157379_10555563 | |||
| 920 | Ga0157376_10042271 | |||
| 921 | Ga0163161_10444667 | |||
| 922 | Ga0213874_10070723 | |||
| 923 | Ga0213876_10047462 | |||
| 924 | Ga0213876_10242218 | |||
| 925 | Ga0213875_10000074 | |||
| 926 | Ga0213875_10083738 | |||
| 927 | Ga0213875_10218784 | |||
| 928 | Ga0207697_10016459 | |||
| 929 | Ga0207692_10010423 | |||
| 930 | Ga0207710_10329507 | |||
| 931 | Ga0207688_10015212 | |||
| 932 | Ga0207688_10070790 | |||
| 933 | Ga0207688_10569247 | |||
| 934 | Ga0207647_10178837 | |||
| 935 | Ga0207685_10109340 | |||
| 936 | Ga0207685_10116224 | |||
| 937 | Ga0207705_10087822 | |||
| 938 | Ga0207684_10014054 | |||
| 939 | Ga0207684_10175140 | |||
| 940 | Ga0207654_10568465 | |||
| 941 | Ga0207707_10066192 | |||
| 942 | Ga0207707_10228863 | |||
| 943 | Ga0207671_10174075 | |||
| 944 | Ga0207693_10004345 | |||
| 945 | Ga0207693_10011832 | |||
| 946 | Ga0207663_10014943 | |||
| 947 | Ga0207663_10280875 | |||
| 948 | Ga0207660_10352029 | |||
| 949 | Ga0207662_10287704 | |||
| 950 | Ga0207662_10424706 | |||
| 951 | Ga0207657_10025235 | |||
| 952 | Ga0207657_10046602 | |||
| 953 | Ga0207649_10137568 | |||
| 954 | Ga0207652_10110725 | |||
| 955 | Ga0207694_10984364 | |||
| 956 | Ga0207659_10072132 | |||
| 957 | Ga0207659_10336308 | |||
| 958 | Ga0207687_10062939 | |||
| 959 | Ga0207687_10167001 | |||
| 960 | Ga0207700_10053165 | |||
| 961 | Ga0207664_10000800 | |||
| 962 | Ga0207664_10134351 | |||
| 963 | Ga0207664_10396794 | |||
| 964 | Ga0207664_11289383 | |||
| 965 | Ga0207644_10003127 | |||
| 966 | Ga0207644_10790756 | |||
| 967 | Ga0207690_10010595 | |||
| 968 | Ga0207690_10219795 | |||
| 969 | Ga0207690_10365409 | |||
| 970 | Ga0207706_10067682 | |||
| 971 | Ga0207706_10068728 | |||
| 972 | Ga0207706_10159690 | |||
| 973 | Ga0207686_10310744 | |||
| 974 | Ga0207709_10081950 | |||
| 975 | Ga0207709_10187643 | |||
| 976 | Ga0207670_10367097 | |||
| 977 | Ga0207669_10476838 | |||
| 978 | Ga0207704_10365499 | |||
| 979 | Ga0207665_10249411 | |||
| 980 | Ga0207691_11359313 | |||
| 981 | Ga0207661_10028254 | |||
| 982 | Ga0207661_10212835 | |||
| 983 | Ga0207661_10405595 | |||
| 984 | Ga0207661_10729062 | |||
| 985 | Ga0207661_11249223 | |||
| 986 | Ga0207679_10465288 | |||
| 987 | Ga0207651_10051881 | |||
| 988 | Ga0207712_10058288 | |||
| 989 | Ga0207712_10324601 | |||
| 990 | Ga0207712_10491330 | |||
| 991 | Ga0207668_10080494 | |||
| 992 | Ga0207668_10527160 | |||
| 993 | Ga0207658_10533121 | |||
| 994 | Ga0207677_10367516 | |||
| 995 | Ga0207703_10018798 | |||
| 996 | Ga0207703_10093625 | |||
| 997 | Ga0207703_10671945 | |||
| 998 | Ga0207639_10177218 | |||
| 999 | Ga0207639_10386948 | |||
| 1000 | Ga0207678_10021491 | |||
| 1001 | Ga0207678_10835469 | |||
| 1002 | Ga0207708_10000722 | |||
| 1003 | Ga0207708_10090323 | |||
| 1004 | Ga0207641_10464408 | |||
| 1005 | Ga0207648_10421286 | |||
| 1006 | Ga0207676_10082679 | |||
| 1007 | Ga0207675_100303376 | |||
| 1008 | Ga0207675_100663148 | |||
| 1009 | Ga0207675_100986255 | |||
| 1010 | Ga0207675_101230805 | |||
| 1011 | Ga0207698_10869070 | |||
| 1012 | Ga0209984_1006808 | |||
| 1013 | Ga0209179_1002556 | |||
| 1014 | Ga0209998_10029173 | |||
| 1015 | Ga0209998_10045794 | |||
| 1016 | Ga0209974_10024913 | |||
| 1017 | Ga0207428_10005312 | |||
| 1018 | Ga0207428_10052112 | |||
| 1019 | Ga0268266_10325064 | |||
| 1020 | Ga0268266_10570942 | |||
| 1021 | Ga0268265_10048213 | |||
| 1022 | Ga0268265_10587506 | |||
| 1023 | Ga0268264_10000119 | |||
| 1024 | Ga0268264_10003330 | |||
| 1025 | Ga0268264_10174690 | |||
| 1026 | Ga0268264_10388597 | |||
| 1027 | Ga0307517_10014916 | |||
| 1028 | Ga0307517_10044999 | |||
| 1029 | Ga0307515_10000025 | |||
| 1030 | Ga0307515_10012166 | |||
| 1031 | Ga0307515_10024738 | |||
| 1032 | Ga0307515_10029689 | |||
| 1033 | Ga0307515_10072557 | |||
| 1034 | Ga0307515_10176271 | |||
| 1035 | Ga0307515_10281381 | |||
| 1036 | Ga0307511_10004686 | |||
| 1037 | Ga0307511_10110106 | |||
| 1038 | Ga0307511_10247809 | |||
| 1039 | Ga0307512_10002952 | |||
| 1040 | Ga0307512_10004206 | |||
| 1041 | Ga0307512_10012997 | |||
| 1042 | Ga0307512_10163618 | |||
| 1043 | Ga0307513_10008140 | |||
| 1044 | Ga0307513_10009327 | |||
| 1045 | Ga0307513_10359149 | |||
| 1046 | Ga0307509_10007842 | |||
| 1047 | Ga0307509_10012362 | |||
| 1048 | Ga0307509_10028165 | |||
| 1049 | Ga0307509_10038694 | |||
| 1050 | Ga0307509_10054861 | |||
| 1051 | Ga0307509_10435209 | |||
| 1052 | Ga0307408_100077930 | |||
| 1053 | Ga0307508_10000627 | |||
| 1054 | Ga0307508_10045944 | |||
| 1055 | Ga0307508_10059091 | |||
| 1056 | Ga0307508_10059877 | |||
| 1057 | Ga0307508_10075682 | |||
| 1058 | Ga0307508_10201051 | |||
| 1059 | Ga0307508_10328127 | |||
| 1060 | Ga0307514_10002480 | |||
| 1061 | Ga0307514_10123001 | |||
| 1062 | Ga0307514_10350973 | |||
| 1063 | Ga0307516_10001908 | |||
| 1064 | Ga0307516_10019620 | |||
| 1065 | Ga0307516_10030055 | |||
| 1066 | Ga0307516_10324135 | |||
| 1067 | Ga0307516_10537083 | |||
| 1068 | Ga0307410_10033280 | |||
| 1069 | Ga0307406_10265283 | |||
| 1070 | Ga0307416_100462691 | |||
| 1071 | Ga0307507_10024849 | |||
| 1072 | Ga0307507_10026989 | |||
| 1073 | Ga0307507_10116918 | |||
| 1074 | Ga0307507_10178558 | |||
| 1075 | Ga0307510_10004705 | |||
| 1076 | Ga0307510_10025114 | |||
| 1077 | Ga0307510_10034361 | |||
| 1078 | Ga0307510_10069533 | |||
| 1079 | Ga0307510_10078190 | |||
| 1080 | Ga0307510_10299809 | |||
| 1081 | Ga0373930_0001567 | |||
| 1082 | Ga0373958_0000580 | |||
| 1083 | Ga0373928_0000280 | |||
| 1084 | Ga0373940_0001444 | |||
| 1085 | Ga0373949_0002668 | |||
| 1086 | Ga0373951_0005177 | |||
| 1087 | Ga0373952_0003660 | |||
| 1088 | Ga0373932_0001203 | |||
| 1089 | Ga0373939_0001268 | |||
| 1090 | Ga0373941_0000810 | |||
| 1091 | Ga0373957_0131245 | |||
| 1092 | Ga0373960_0004662 | |||
| 1093 | Ga0373943_0103805 | |||
| 1094 | Ga0373942_0012849 | |||
| 1095 | Ga0373961_0004256 | |||
| 1096 | Ga0373962_0002764 | |||
| 1097 | Ga0373924_0068290 | |||
| 1098 | Ga0373931_0058043 | |||
| 1099 | Ga0373931_0192761 | |||
| 1100 | Ga0373931_0215008 | |||
| 1101 | Ga0373935_0141054 | |||
| 1102 | Ga0373935_0587877 | |||
| 1103 | Ga0373927_0039399 | |||
| 1104 | Ga0373933_0045841 | |||
| 1105 | Ga0373947_0105164 | |||
| 1106 | Ga0373937_0018204 | |||
| 1107 | Ga0373937_0541008 | |||
| 1108 | Ga0373925_0200509 | |||
| 1109 | Ga0373925_0613290 | |||
| 1110 | Ga0395899_0115731 | |||
| 1111 | Ga0395900_0232277 | |||
| 1112 | Ga0436364_0459773 | |||
| 1113 | Ga0436364_0737000 | |||
| 1114 | Ga0436364_1034674 | |||
| 1115 | Ga0436364_1494924 | |||
| 1116 | Ga0395901_0246435 | |||
| 1117 | Ga0395901_0551761 | |||
| 1118 | Ga0436365_0073382 | |||
| 1119 | Ga0436365_1794781 | |||
| 1120 | Ga0436365_1804874 | |||
| 1121 | Ga0436363_0715612 | |||
| 1122 | Ga0436362_0399580 | |||
| 1123 | Ga0436362_0406741 | |||
| 1124 | Ga0439461_0159308 | |||
| 1125 | Ga0451802_1201114 | |||
| 1126 | Ga0439452_068361 | |||
| 1127 | Ga0450902_026053 | |||
| 1128 | Ga0439446_0027614 | |||
| 1129 | Ga0439464_0047193 | |||
| 1130 | Ga0439460_0079371 | |||
| 1131 | Ga0451577_0062823 | |||
| 1132 | Ga0451577_0436270 | |||
| 1133 | Ga0466972_0000820 | |||
| 1134 | Ga0453683_0100189 | |||
| 1135 | Ga0466965_0002113 | |||
| 1136 | Ga0466963_0116972 | |||
| 1137 | Ga0466963_0506159 | |||
| 1138 | Ga0466970_0005554 | |||
| 1139 | Ga0466970_0120005 | |||
| 1140 | Ga0466960_0001965 | |||
| 1141 | Ga0466960_0011636 | |||
| 1142 | Ga0466959_0200948 | |||
| 1143 | Ga0451576_0146333 | |||
| 1144 | Ga0451576_0279148 | |||
| 1145 | Ga0466967_0885733 | |||
| 1146 | Ga0466967_1307818 | |||
| 1147 | Ga0495592_0003230 | |||
| 1148 | Ga0495592_0117172 | |||
| 1149 | Ga0495603_0006944 | |||
| 1150 | Ga0495603_0153903 | |||
| 1151 | Ga0495629_0008343 | |||
| 1152 | Ga0495629_0008698 | |||
| 1153 | Ga0495629_0010044 | |||
| 1154 | Ga0495629_0053023 | |||
| 1155 | Ga0495638_0332073 | |||
| 1156 | Ga0495651_0000641 | |||
| 1157 | Ga0495651_0005504 | |||
| 1158 | Ga0495651_0051986 | |||
| 1159 | Ga0495653_0000532 | |||
| 1160 | Ga0495580_0137480 | |||
| 1161 | Ga0495582_0011499 | |||
| 1162 | Ga0495582_0188928 | |||
| 1163 | Ga0495662_0000382 | |||
| 1164 | Ga0495664_0001758 | |||
| 1165 | Ga0495664_0343604 | |||
| 1166 | Ga0495584_0021930 | |||
| 1167 | Ga0495606_0030447 | |||
| 1168 | Ga0495606_0082485 | |||
| 1169 | Ga0495608_0004541 | |||
| 1170 | Ga0495618_0009578 | |||
| 1171 | Ga0495618_0036261 | |||
| 1172 | Ga0495618_0619805 | |||
| 1173 | Ga0495628_0027352 | |||
| 1174 | Ga0495628_0170838 | |||
| 1175 | Ga0495628_0500797 | |||
| 1176 | Ga0495630_0004892 | |||
| 1177 | Ga0495630_0103220 | |||
| 1178 | Ga0495630_0233407 | |||
| 1179 | Ga0495631_0215362 | |||
| 1180 | Ga0495648_0028394 | |||
| 1181 | Ga0495648_0121078 | |||
| 1182 | Ga0495652_0001336 | |||
| 1183 | Ga0495652_0009215 | |||
| 1184 | Ga0495652_0026992 | |||
| 1185 | Ga0495652_0111893 | |||
| 1186 | Ga0495665_0103788 | |||
| 1187 | Ga0495665_0473075 | |||
| 1188 | Ga0495640_0189746 | |||
| 1189 | Ga0495586_0132076 | |||
| 1190 | Ga0495587_0000512 | |||
| 1191 | Ga0495587_0062518 | |||
| 1192 | Ga0495645_0004214 | |||
| 1193 | Ga0495645_0074448 | |||
| 1194 | Ga0495667_0001063 | |||
| 1195 | Ga0495634_0001377 | |||
| 1196 | Ga0495634_0007540 | |||
| 1197 | Ga0495634_0074455 | |||
| 1198 | Ga0495611_0016735 | |||
| 1199 | Ga0495611_0135868 | |||
| 1200 | Ga0495625_0034416 | |||
| 1201 | Ga0495635_0000455 | |||
| 1202 | Ga0495635_0001032 | |||
| 1203 | Ga0495635_0008433 | |||
| 1204 | Ga0495635_0728454 | |||
| 1205 | Ga0495661_0160153 | |||
| 1206 | Ga0495588_0177286 | |||
| 1207 | Ga0495657_0000556 | |||
| 1208 | Ga0495657_0006059 | |||
| 1209 | Ga0495599_0000308 | |||
| 1210 | Ga0495599_0231636 | |||
| 1211 | Ga0495623_0000694 | |||
| 1212 | Ga0495623_0250247 | |||
| 1213 | Ga0495623_0294993 | |||
| 1214 | Ga0495646_0003088 | |||
| 1215 | Ga0495646_0061235 | |||
| 1216 | Ga0495646_0066491 | |||
| 1217 | Ga0495647_0334442 | |||
| 1218 | Ga0495658_0004671 | |||
| 1219 | Ga0495658_0074852 | |||
| 1220 | Ga0495658_0414639 | |||
| 1221 | Ga0495669_0000684 | |||
| 1222 | Ga0495613_0001129 | |||
| 1223 | Ga0495613_0003840 | |||
| 1224 | Ga0495613_0076432 | |||
| 1225 | Ga0495613_0243399 | |||
| 1226 | Ga0495624_0070725 | |||
| 1227 | Ga0495670_0042134 | |||
| 1228 | Ga0495671_0028098 | |||
| 1229 | Ga0495671_0089728 | |||
| 1230 | Ga0495589_0040052 | |||
| 1231 | Ga0495600_0002183 | |||
| 1232 | Ga0495581_0023636 | |||
| 1233 | Ga0495581_0316848 | |||
| 1234 | Ga0495604_0000213 | |||
| 1235 | Ga0495604_0002124 | |||
| 1236 | Ga0495636_0000883 | |||
| 1237 | Ga0495636_0096107 | |||
| 1238 | Ga0495674_0011928 | |||
| 1239 | Ga0495674_0137770 | |||
| 1240 | Ga0495672_0027939 | |||
| 1241 | Ga0495672_0116323 | |||
| 1242 | Ga0495676_0000413 | |||
| 1243 | Ga0495676_0012477 | |||
| 1244 | Ga0495676_0013907 | |||
| 1245 | Ga0495687_003190 | |||
| 1246 | Ga0495687_004123 | |||
| 1247 | Ga0495687_017067 | |||
| 1248 | Ga0495675_0001609 | |||
| 1249 | Ga0495677_0149711 | |||
| 1250 | Ga0495685_003174 | |||
| 1251 | Ga0495685_064440 | |||
| 1252 | Ga0495673_0001012 | |||
| 1253 | Ga0495681_0006963 | |||
| 1254 | Ga0495684_0000903 | |||
| 1255 | Ga0495686_0100409 | |||
| 1256 | Ga0495593_0001416 | |||
| 1257 | Ga0495593_0139624 | |||
| 1258 | Ga0495593_0462388 | |||
| 1259 | Ga0495602_0001348 | |||
| 1260 | Ga0495602_0028433 | |||
| 1261 | Ga0495614_0000735 | |||
| 1262 | Ga0495614_0116982 | |||
| 1263 | Ga0496100_0219890 | |||
| 1264 | Ga0496102_0025311 | |||
| 1265 | Ga0496102_0073457 | |||
| 1266 | Ga0496103_0186610 | |||
| 1267 | Ga0496104_0005007 | |||
| 1268 | Ga0496104_0110184 | |||
| 1269 | Ga0496104_0143428 | |||
| 1270 | Ga0496105_0028661 | |||
| 1271 | Ga0496105_0235737 | |||
| 1272 | Ga0496105_0323321 | |||
| 1273 | Ga0496106_0008827 | |||
| 1274 | Ga0496106_0042912 | |||
| 1275 | Ga0496106_0060164 | |||
| 1276 | Ga0496106_0278104 | |||
| 1277 | Ga0496107_0014180 | |||
| 1278 | Ga0496107_0021859 | |||
| 1279 | Ga0496107_0163846 | |||
| 1280 | Ga0496108_0001304 | |||
| 1281 | Ga0496108_0073389 | |||
| 1282 | Ga0496108_0092467 | |||
| 1283 | Ga0496108_0714523 | |||
| 1284 | Ga0496109_0003457 | |||
| 1285 | Ga0496109_0005799 | |||
| 1286 | Ga0496109_0013836 | |||
| 1287 | Ga0496110_0009849 | |||
| 1288 | Ga0496110_0056983 | |||
| 1289 | Ga0496112_0003458 | |||
| 1290 | Ga0496112_0036812 | |||
| 1291 | Ga0496113_0067309 | |||
| 1292 | Ga0496113_0081135 | |||
| 1293 | Ga0496114_0248171 | |||
| 1294 | Ga0496115_0030116 | |||
| 1295 | Ga0496115_0409242 | |||
| 1296 | Ga0496117_0046970 | |||
| 1297 | Ga0496118_0008644 | |||
| 1298 | Ga0496119_0124966 | |||
| 1299 | Ga0496121_0000668 | |||
| 1300 | Ga0496124_0000955 | |||
| 1301 | Ga0496124_0824984 | |||
| 1302 | Ga0496125_0015321 | |||
| 1303 | Ga0496125_0459411 | |||
| 1304 | Ga0496126_0007074 | |||
| 1305 | Ga0496126_0294409 | |||
| 1306 | Ga0496126_0463440 | |||
| 1307 | Ga0501033_0009826 | |||
| 1308 | Ga0501034_0038412 | |||
| 1309 | Ga0501036_0011904 | |||
| 1310 | Ga0501036_0526581 | |||
| 1311 | Ga0501037_0053217 | |||
| 1312 | Ga0501038_0003213 | |||
| 1313 | Ga0501038_0246682 | |||
| 1314 | Ga0501038_0347854 | |||
| 1315 | Ga0501039_0001002 | |||
| 1316 | Ga0501040_0000976 | |||
| 1317 | Ga0501040_0193357 | |||
| 1318 | Ga0501041_0000633 | |||
| 1319 | Ga0501041_0150905 | |||
| 1320 | Ga0501042_0000928 | |||
| 1321 | Ga0501043_0025356 | |||
| 1322 | Ga0501046_0002250 | |||
| 1323 | Ga0501046_0407735 | |||
| 1324 | Ga0501047_0003179 | |||
| 1325 | Ga0501047_0013145 | |||
| 1326 | Ga0501047_0233904 | |||
| 1327 | Ga0501048_0001788 | |||
| 1328 | Ga0501048_0198836 | |||
| 1329 | Ga0501067_0410490 | |||
| 1330 | Ga0501068_0009389 | |||
| 1331 | Ga0501069_0055980 | |||
| 1332 | Ga0501069_0318971 | |||
| 1333 | Ga0501070_0058039 | |||
| 1334 | Ga0501070_0742791 | |||
| 1335 | Ga0501071_0000518 | |||
| 1336 | Ga0501072_0004996 | |||
| 1337 | Ga0501073_0066103 | |||
| 1338 | Ga0501073_0617820 | |||
| 1339 | Ga0501074_0049015 | |||
| 1340 | Ga0501074_0392050 | |||
| 1341 | Ga0501075_0004425 | |||
| 1342 | Ga0501076_0021850 | |||
| 1343 | Ga0501077_0000169 | |||
| 1344 | Ga0501079_0001306 | |||
| 1345 | Ga0501079_0352451 | |||
| 1346 | Ga0501079_0462559 | |||
| 1347 | Ga0501080_0005909 | |||
| 1348 | Ga0501080_0449665 | |||
| 1349 | Ga0501081_0000045 | |||
| 1350 | Ga0501083_0019006 | |||
| 1351 | Ga0501035_0018417 | |||
| 1352 | Ga0501035_0330881 | |||
| 1353 | Ga0501035_0499727 | |||
| 1354 | Ga0501044_0019766 | |||
| 1355 | Ga0501044_0039232 | |||
| 1356 | Ga0501044_0104244 | |||
| 1357 | Ga0501044_0303115 | |||
| 1358 | Ga0501044_1104406 | |||
| 1359 | Ga0501045_0001264 | |||
| 1360 | Ga0501045_0095507 | |||
| 1361 | nmdc:mga03n38_823490_c1 | |||
| 1362 | nmdc:mga00v17_722887_c1 | |||
| 1363 | nmdc:mga0yw44_163548_c1 | |||
| 1364 | nmdc:mga0yw44_29605_c1 | |||
| 1365 | nmdc:mga06z11_7499_c1 | |||
| 1366 | nmdc:mga05p37_128369_c1 | |||
| 1367 | nmdc:mga05p37_20494_c1 | |||
| 1368 | nmdc:mga05p37_470153_c1 | |||
| 1369 | nmdc:mga0qj67_310234_c1 | |||
| 1370 | nmdc:mga06r32_1311537_c1 | |||
| 1371 | nmdc:mga08y16_13298_c1 | |||
| 1372 | nmdc:mga08y16_40442_c1 | |||
| 1373 | nmdc:mga0n895_102785_c1 | |||
| 1374 | nmdc:mga0n895_2166187_c1 | |||
| 1375 | nmdc:mga0n895_240225_c1 | |||
| 1376 | nmdc:mga0rr50_1032947_c1 | |||
| 1377 | nmdc:mga0rr50_1119532_c1 | |||
| 1378 | nmdc:mga0rr50_412937_c1 | |||
| 1379 | nmdc:mga0rr50_57431_c1 | |||
| 1380 | nmdc:mga08x19_76577_c1 | |||
| 1381 | nmdc:mga08x19_826620_c1 | |||
| 1382 | nmdc:mga08x19_87379_c1 | |||
| 1383 | nmdc:mga0a205_277738_c1 | |||
| 1384 | nmdc:mga0a205_95019_c1 | |||
| 1385 | Ga0495601_0015103 | |||
| 1386 | Ga0495601_0048787 | |||
| 1387 | Ga0495601_0065794 | |||
| 1388 | Ga0495612_0003965 | |||
| 1389 | Ga0495612_0011152 | |||
| 1390 | Ga0495612_0332280 | |||
| 1391 | Ga0495619_0082153 | |||
| 1392 | Ga0495619_0131409 | |||
| 1393 | Ga0500644_0014454 | |||
| 1394 | Ga0500644_0020409 | |||
| 1395 | Ga0500646_0047703 | |||
| 1396 | Ga0500651_0046293 | |||
| 1397 | Ga0500651_0081699 | |||
| 1398 | Ga0500566_0030101 | |||
| 1399 | Ga0500566_0169412 | |||
| 1400 | Ga0500640_018152 | |||
| 1401 | Ga0500650_0019758 | |||
| 1402 | Ga0500553_016785 | |||
| 1403 | Ga0500560_013422 | |||
| 1404 | Ga0500562_003500 | |||
| 1405 | Ga0500569_054976 | |||
| 1406 | Ga0500572_001959 | |||
| 1407 | Ga0500572_118274 | |||
| 1408 | Ga0500580_178402 | |||
| 1409 | Ga0500594_0006611 | |||
| 1410 | Ga0500595_004573 | |||
| 1411 | Ga0500608_048785 | |||
| 1412 | Ga0500614_021406 | |||
| 1413 | Ga0500652_152031 | |||
| 1414 | Ga0500559_0000427 | |||
| 1415 | Ga0500564_185064 | |||
| 1416 | Ga0500568_0047011 | |||
| 1417 | Ga0500573_0042003 | |||
| 1418 | Ga0500586_224923 | |||
| 1419 | Ga0500616_0016185 | |||
| 1420 | Ga0500616_0146432 | |||
| 1421 | Ga0500622_0298318 | |||
| 1422 | Ga0500624_003453 | |||
| 1423 | Ga0500638_235590 | |||
| 1424 | Ga0500636_0289670 | |||
| 1425 | Ga0500637_0212565 | |||
| 1426 | Ga0500570_121204 | |||
| 1427 | Ga0500656_035974 | |||
| 1428 | Ga0500552_060677 | |||
| 1429 | Ga0500596_003877 | |||
| 1430 | Ga0500596_003879 | |||
| 1431 | Ga0501084_0006845 | |||
| 1432 | Ga0501082_0001888 | |||
| 1433 | Ga0501082_0546710 | |||
| 1434 | Ga0466962_0225772 | |||
| 1435 | Ga0530510_0005780 | |||
| 1436 | Ga0530510_0673698 | |||
| 1437 | 8054166577 | |||
| 1438 | 2545675814 | |||
| 1439 | 2573036749 | |||
| 1440 | 2578335951 | |||
| 1441 | 2580931093 | |||
| 1442 | 2621274124 | |||
| 1443 | 2793980625 | |||
| 1444 | 2884701163 | |||
| 1445 | 2895442947 | |||
| 1446 | 2902793556 | |||
| 1447 | 2971514666 | |||
| 1448 | 2980180774 | |||
| 1449 | 8045867076 | |||
| 1450 | 8047901262 | |||
| 1451 | 8048135654 | |||
| 1452 | 8048357638 | |||
| 1453 | 8048378202 | |||
| 1454 | 8048387300 | |||
| 1455 | 8054476203 | |||
| 1456 | 8055173998 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9785 | 3 | 155 |
| 1t3q-assembly1.cif.gz_D | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.9726 | 2 | 158 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.97 | 5 | 157 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9668 | 5 | 158 |
| 5y6q-assembly1.cif.gz_A | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.9616 | 4 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.98 | 4 | 79 | 3.10.20.30 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.978 | 81 | 155 | 1.10.150.120 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9755 | 2 | 77 | 3.10.20.30 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9713 | 81 | 155 | 1.10.150.120 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9645 | 5 | 79 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538BUE3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9897 | 5 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A382DVF0-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9882 | 4 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2V7DLF2-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9881 | 5 | 158 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A0K3BKV8-F1-model_v4 | Carbon monoxide dehydrogenase small chain (EC 1.2.99.2) | 0.9869 | 5 | 153 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A537LNC3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9863 | 4 | 155 |
GO:0016491
GO:0046872 GO:0051537 |