F477834

General Info

Members Datasets Scaffolds Average Seq Length
728 416 1456 166

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054160619|8054166577
Length 206
Sequence PPSADAAPGAAPPTGCELQLMVLDVNGEQHEVITEPRRTLVDVLRHDLRLTGTHVGCEHGICGACTVLLDGRPVRSCLMFAAQAEGAALRTVESLAPDGAPTEGPEEGPEAGAQAPPAPGDRLSDLQQAFRAHHALQCGFCTPGFLMLAEGFLAERPDPDEAEIREVVAANLCRCTGYQPLVAAIAQCAAARRAARENRSAQRKEL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
219 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
366 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
367 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
368 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
369 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
370 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
371 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
372 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
376 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
382 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
386 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
389 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
390 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
391 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
392 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
397 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
398 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
399 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
400 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
401 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
402 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
403 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
404 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
405 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
406 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
407 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
408 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
409 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
410 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
411 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
412 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
413 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
414 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
415 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
416 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.73
Nodule 0.14
Rhizoplane 4.81
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800762 2209111006 Bacteria 10804
2 ARcpr5oldR_c000446 3300000041 Bacteria 5488
3 ARSoilYngRDRAFT_c00556 3300000042 Bacteria 4157
4 ARcpr5yngRDRAFT_c000070 3300000043 Bacteria 16857
5 ARSoilOldRDRAFT_c000067 3300000044 Bacteria 20226
6 ARCol0yngRDRAFT_1000193 3300000652 Bacteria 10259
7 Ga0065716_1003993 3300005277 Bacteria 1088
8 Ga0065712_10076534 3300005290 Bacteria 3637
9 Ga0065715_10616772 3300005293 Bacteria 696
10 Ga0070658_10108111 3300005327 Bacteria 2302
11 Ga0070683_100008747 3300005329 Bacteria 8607
12 Ga0070683_100209957 3300005329 Bacteria 1849
13 Ga0070683_100796466 3300005329 Bacteria 906
14 Ga0070683_100813056 3300005329 Bacteria 896
15 Ga0070683_101098190 3300005329 Bacteria 764
16 Ga0070666_11129222 3300005335 Bacteria 583
17 Ga0070680_100229131 3300005336 Bacteria 1569
18 Ga0070680_100453644 3300005336 Bacteria 1095
19 Ga0070682_100007844 3300005337 Bacteria 6008
20 Ga0068868_100005522 3300005338 Bacteria 8893
21 Ga0068868_100729344 3300005338 Bacteria 889
22 Ga0070660_100083064 3300005339 Bacteria 2516
23 Ga0070689_100237244 3300005340 Bacteria 1501
24 Ga0070691_10022954 3300005341 Bacteria 2896
25 Ga0070687_100389892 3300005343 Bacteria 910
26 Ga0070668_100059432 3300005347 Bacteria 2959
27 Ga0070669_100026214 3300005353 Bacteria 4193
28 Ga0070675_100024093 3300005354 Bacteria 4872
29 Ga0070675_100215185 3300005354 Bacteria 1672
30 Ga0070675_100413386 3300005354 Bacteria 1205
31 Ga0070671_100002215 3300005355 Bacteria 15011
32 Ga0070671_100714594 3300005355 Bacteria 870
33 Ga0070674_100477317 3300005356 Bacteria 1034
34 Ga0070673_100061776 3300005364 Bacteria 2974
35 Ga0070688_100053201 3300005365 Bacteria 2531
36 Ga0070688_100173768 3300005365 Bacteria 1489
37 Ga0070659_100047803 3300005366 Bacteria 3358
38 Ga0070659_100092062 3300005366 Bacteria 2431
39 Ga0070659_100541196 3300005366 Bacteria 996
40 Ga0070667_101659418 3300005367 Bacteria 601
41 Ga0070709_10316054 3300005434 Bacteria 1145
42 Ga0070714_100001413 3300005435 Bacteria 17421
43 Ga0070714_100192637 3300005435 Bacteria 1861
44 Ga0070713_100006384 3300005436 Bacteria 8170
45 Ga0070713_100405551 3300005436 Bacteria 1274
46 Ga0070710_10015107 3300005437 Bacteria 3900
47 Ga0070710_10125681 3300005437 Bacteria 1558
48 Ga0070711_100057100 3300005439 Bacteria 2702
49 Ga0070711_100442748 3300005439 Bacteria 1062
50 Ga0070711_100444004 3300005439 Bacteria 1061
51 Ga0070711_100490290 3300005439 Bacteria 1012
52 Ga0070705_100642430 3300005440 Bacteria 826
53 Ga0070700_100001758 3300005441 Bacteria 10896
54 Ga0070700_100332340 3300005441 Bacteria 1120
55 Ga0070708_100645047 3300005445 Bacteria 998
56 Ga0070708_101429973 3300005445 Bacteria 645
57 Ga0070663_100007556 3300005455 Bacteria 6625
58 Ga0070663_101040900 3300005455 Bacteria 713
59 Ga0070662_100068362 3300005457 Bacteria 2611
60 Ga0070662_100136337 3300005457 Bacteria 1898
61 Ga0070681_10243404 3300005458 Bacteria 1712
62 Ga0070681_10270148 3300005458 Bacteria 1612
63 Ga0070681_10379751 3300005458 Bacteria 1324
64 Ga0070681_10473407 3300005458 Bacteria 1165
65 Ga0068867_100488734 3300005459 Bacteria 1056
66 Ga0070698_100001534 3300005471 Bacteria 25641
67 Ga0070698_100016842 3300005471 Bacteria 7708
68 Ga0070698_100069221 3300005471 Bacteria 3544
69 Ga0070679_100085062 3300005530 Bacteria 3150
70 Ga0070679_100086884 3300005530 Bacteria 3114
71 Ga0070679_100773490 3300005530 Bacteria 903
72 Ga0070684_100030916 3300005535 Bacteria 4554
73 Ga0068853_100343521 3300005539 Bacteria 1387
74 Ga0070672_100390803 3300005543 Bacteria 1191
75 Ga0070686_100714812 3300005544 Bacteria 800
76 Ga0070695_100122805 3300005545 Bacteria 1779
77 Ga0070695_100725187 3300005545 Bacteria 791
78 Ga0070695_101309261 3300005545 Bacteria 599
79 Ga0070696_100020433 3300005546 Bacteria 4488
80 Ga0070696_100121446 3300005546 Bacteria 1891
81 Ga0070693_100049467 3300005547 Bacteria 2398
82 Ga0070665_100001501 3300005548 Bacteria 27159
83 Ga0070665_100544926 3300005548 Bacteria 1172
84 Ga0070704_100018089 3300005549 Bacteria 4497
85 Ga0070664_100541257 3300005564 Bacteria 1076
86 Ga0070664_101051574 3300005564 Bacteria 766
87 Ga0070702_100029125 3300005615 Bacteria 3000
88 Ga0070702_100320099 3300005615 Bacteria 1081
89 Ga0070702_100453080 3300005615 Bacteria 931
90 Ga0068859_100106258 3300005617 Bacteria 2866
91 Ga0068859_100670348 3300005617 Bacteria 1129
92 Ga0068864_100077554 3300005618 Bacteria 2906
93 Ga0068861_100718861 3300005719 Bacteria 930
94 Ga0068861_100968508 3300005719 Bacteria 810
95 Ga0068861_101145800 3300005719 Bacteria 749
96 Ga0068863_100085035 3300005841 Bacteria 2998
97 Ga0068863_100331404 3300005841 Bacteria 1480
98 Ga0068860_100002999 3300005843 Bacteria 17439
99 Ga0068860_100003607 3300005843 Bacteria 15907
100 Ga0068860_100388569 3300005843 Bacteria 1378
101 Ga0068860_100445501 3300005843 Bacteria 1287
102 Ga0068860_100867170 3300005843 Bacteria 918
103 Ga0068862_100192698 3300005844 Bacteria 1835
104 Ga0081455_10227417 3300005937 Bacteria 1379
105 Ga0081538_10000527 3300005981 Bacteria 42416
106 Ga0081538_10016841 3300005981 Bacteria 5579
107 Ga0081538_10105882 3300005981 Bacteria 1398
108 Ga0081540_1028469 3300005983 Bacteria 3137
109 Ga0081540_1080844 3300005983 Bacteria 1463
110 Ga0070717_10054851 3300006028 Bacteria 3288
111 Ga0070717_10101143 3300006028 Bacteria 2448
112 Ga0075365_10186117 3300006038 Bacteria 1452
113 Ga0075365_10296209 3300006038 Bacteria 1138
114 Ga0075368_10004789 3300006042 Bacteria 4610
115 Ga0075363_100113574 3300006048 Bacteria 1507
116 Ga0075364_10404144 3300006051 Bacteria 932
117 Ga0075432_10033172 3300006058 Bacteria 1790
118 Ga0070716_100298537 3300006173 Bacteria 1119
119 Ga0070712_100002998 3300006175 Bacteria 10452
120 Ga0070712_100019314 3300006175 Bacteria 4444
121 Ga0070712_100085171 3300006175 Bacteria 2300
122 Ga0070712_100214162 3300006175 Bacteria 1521
123 Ga0070712_100691514 3300006175 Bacteria 869
124 Ga0075367_10005037 3300006178 Bacteria 6513
125 Ga0097621_100990265 3300006237 Bacteria 786
126 Ga0068871_101792336 3300006358 Bacteria 583
127 Ga0075430_100298286 3300006846 Bacteria 1333
128 Ga0075431_100126184 3300006847 Bacteria 2640
129 Ga0075433_10196534 3300006852 Bacteria 1794
130 Ga0075434_100064070 3300006871 Bacteria 3659
131 Ga0075434_100071307 3300006871 Bacteria 3466
132 Ga0075434_101735361 3300006871 Bacteria 632
133 Ga0068865_100230426 3300006881 Bacteria 1453
134 Ga0068865_101195414 3300006881 Bacteria 673
135 Ga0075436_100085479 3300006914 Bacteria 2190
136 Ga0097620_100106260 3300006931 Bacteria 2866
137 Ga0097620_100670324 3300006931 Bacteria 1129
138 Ga0075435_100004162 3300007076 Bacteria 9921
139 Ga0075435_100470903 3300007076 Bacteria 1084
140 Ga0075435_100614116 3300007076 Bacteria 943
141 Ga0075435_100933193 3300007076 Bacteria 757
142 Ga0099795_10000092 3300007788 Bacteria 15117
143 Ga0105240_11284954 3300009093 Bacteria 772
144 Ga0111539_10020125 3300009094 Bacteria 8222
145 Ga0111539_10190763 3300009094 Bacteria 2391
146 Ga0111539_11219505 3300009094 Bacteria 874
147 Ga0105245_10153495 3300009098 Bacteria 2179
148 Ga0105245_11346420 3300009098 Bacteria 763
149 Ga0105245_12062001 3300009098 Bacteria 624
150 Ga0105247_10005076 3300009101 Bacteria 8342
151 Ga0105247_10133477 3300009101 Bacteria 1620
152 Ga0114129_10013624 3300009147 Bacteria 11586
153 Ga0114129_10689956 3300009147 Bacteria 1313
154 Ga0105243_10062762 3300009148 Bacteria 2975
155 Ga0105243_10215312 3300009148 Bacteria 1694
156 Ga0105241_10077219 3300009174 Bacteria 2599
157 Ga0105241_11154935 3300009174 Bacteria 731
158 Ga0105242_10109619 3300009176 Bacteria 2351
159 Ga0105248_10025309 3300009177 Bacteria 6598
160 Ga0105248_10242782 3300009177 Bacteria 2028
161 Ga0105237_10235354 3300009545 Bacteria 1833
162 Ga0105237_10623556 3300009545 Bacteria 1085
163 Ga0105237_10962068 3300009545 Bacteria 861
164 Ga0105238_10399418 3300009551 Bacteria 1367
165 Ga0105238_11414038 3300009551 Bacteria 723
166 Ga0105249_10015588 3300009553 Bacteria 6728
167 Ga0105249_10064947 3300009553 Bacteria 3356
168 Ga0105249_10453574 3300009553 Bacteria 1321
169 Ga0099796_10003919 3300010159 Bacteria 3527
170 Ga0105239_10009877 3300010375 Bacteria 10720
171 Ga0105239_10109708 3300010375 Bacteria 3058
172 Ga0105246_10163957 3300011119 Bacteria 1696
173 Ga0105246_11263826 3300011119 Bacteria 682
174 Ga0157342_1050605 3300012507 Bacteria 583
175 Ga0157369_10606169 3300013105 Bacteria 1130
176 Ga0157374_10009417 3300013296 Bacteria 8382
177 Ga0157374_11075169 3300013296 Bacteria 825
178 Ga0157378_12320861 3300013297 Bacteria 588
179 Ga0163162_10170220 3300013306 Bacteria 2303
180 Ga0163162_11188342 3300013306 Bacteria 865
181 Ga0163162_11227218 3300013306 Bacteria 851
182 Ga0157372_10029090 3300013307 Bacteria 6029
183 Ga0157372_10418591 3300013307 Bacteria 1561
184 Ga0163163_10009747 3300014325 Bacteria 8601
185 Ga0163163_10097190 3300014325 Bacteria 2965
186 Ga0163163_10827047 3300014325 Bacteria 990
187 Ga0182008_10247495 3300014497 Bacteria 919
188 Ga0157377_10001064 3300014745 Bacteria 11594
189 Ga0157379_10005209 3300014968 Bacteria 11167
190 Ga0157379_10538002 3300014968 Bacteria 1086
191 Ga0157379_10555563 3300014968 Bacteria 1068
192 Ga0157376_10042271 3300014969 Bacteria 3736
193 Ga0163161_10444667 3300017792 Bacteria 1047
194 Ga0213874_10070723 3300021377 Bacteria 1112
195 Ga0213876_10047462 3300021384 Bacteria 2270
196 Ga0213876_10242218 3300021384 Bacteria 958
197 Ga0213875_10000074 3300021388 Bacteria 118349
198 Ga0213875_10083738 3300021388 Bacteria 1488
199 Ga0213875_10218784 3300021388 Bacteria 897
200 Ga0207697_10016459 3300025315 Bacteria 3046
201 Ga0207692_10010423 3300025898 Bacteria 3916
202 Ga0207710_10329507 3300025900 Bacteria 775
203 Ga0207688_10015212 3300025901 Bacteria 4174
204 Ga0207688_10070790 3300025901 Bacteria 1979
205 Ga0207688_10569247 3300025901 Bacteria 713
206 Ga0207647_10178837 3300025904 Bacteria 1233
207 Ga0207685_10109340 3300025905 Bacteria 1195
208 Ga0207685_10116224 3300025905 Bacteria 1167
209 Ga0207705_10087822 3300025909 Bacteria 2274
210 Ga0207684_10014054 3300025910 Bacteria 6914
211 Ga0207684_10175140 3300025910 Bacteria 1850
212 Ga0207654_10568465 3300025911 Bacteria 807
213 Ga0207707_10066192 3300025912 Bacteria 3146
214 Ga0207707_10228863 3300025912 Bacteria 1618
215 Ga0207671_10174075 3300025914 Bacteria 1672
216 Ga0207693_10004345 3300025915 Bacteria 11993
217 Ga0207693_10011832 3300025915 Bacteria 7053
218 Ga0207663_10014943 3300025916 Bacteria 4268
219 Ga0207663_10280875 3300025916 Bacteria 1237
220 Ga0207660_10352029 3300025917 Bacteria 1180
221 Ga0207662_10287704 3300025918 Bacteria 1089
222 Ga0207662_10424706 3300025918 Bacteria 905
223 Ga0207657_10025235 3300025919 Bacteria 5485
224 Ga0207657_10046602 3300025919 Bacteria 3797
225 Ga0207649_10137568 3300025920 Bacteria 1667
226 Ga0207652_10110725 3300025921 Bacteria 2435
227 Ga0207694_10984364 3300025924 Bacteria 714
228 Ga0207659_10072132 3300025926 Bacteria 2523
229 Ga0207659_10336308 3300025926 Bacteria 1249
230 Ga0207687_10062939 3300025927 Bacteria 2625
231 Ga0207687_10167001 3300025927 Bacteria 1694
232 Ga0207700_10053165 3300025928 Bacteria 3033
233 Ga0207664_10000800 3300025929 Bacteria 21281
234 Ga0207664_10134351 3300025929 Bacteria 2086
235 Ga0207664_10396794 3300025929 Bacteria 1226
236 Ga0207664_11289383 3300025929 Bacteria 650
237 Ga0207644_10003127 3300025931 Bacteria 10658
238 Ga0207644_10790756 3300025931 Bacteria 793
239 Ga0207690_10010595 3300025932 Bacteria 5487
240 Ga0207690_10219795 3300025932 Bacteria 1453
241 Ga0207690_10365409 3300025932 Bacteria 1144
242 Ga0207706_10067682 3300025933 Bacteria 3142
243 Ga0207706_10068728 3300025933 Bacteria 3116
244 Ga0207706_10159690 3300025933 Bacteria 1982
245 Ga0207686_10310744 3300025934 Bacteria 1174
246 Ga0207709_10081950 3300025935 Bacteria 2082
247 Ga0207709_10187643 3300025935 Bacteria 1466
248 Ga0207670_10367097 3300025936 Bacteria 1143
249 Ga0207669_10476838 3300025937 Bacteria 994
250 Ga0207704_10365499 3300025938 Bacteria 1128
251 Ga0207665_10249411 3300025939 Bacteria 1311
252 Ga0207691_11359313 3300025940 Bacteria 585
253 Ga0207661_10028254 3300025944 Bacteria 4293
254 Ga0207661_10212835 3300025944 Bacteria 1704
255 Ga0207661_10405595 3300025944 Bacteria 1237
256 Ga0207661_10729062 3300025944 Bacteria 912
257 Ga0207661_11249223 3300025944 Unclassified 683
258 Ga0207679_10465288 3300025945 Bacteria 1123
259 Ga0207651_10051881 3300025960 Bacteria 2794
260 Ga0207712_10058288 3300025961 Bacteria 2728
261 Ga0207712_10324601 3300025961 Bacteria 1271
262 Ga0207712_10491330 3300025961 Bacteria 1048
263 Ga0207668_10080494 3300025972 Bacteria 2360
264 Ga0207668_10527160 3300025972 Bacteria 1020
265 Ga0207658_10533121 3300025986 Bacteria 1049
266 Ga0207677_10367516 3300026023 Bacteria 1210
267 Ga0207703_10018798 3300026035 Bacteria 5396
268 Ga0207703_10093625 3300026035 Bacteria 2531
269 Ga0207703_10671945 3300026035 Bacteria 984
270 Ga0207639_10177218 3300026041 Bacteria 1810
271 Ga0207639_10386948 3300026041 Bacteria 1257
272 Ga0207678_10021491 3300026067 Bacteria 5659
273 Ga0207678_10835469 3300026067 Bacteria 814
274 Ga0207708_10000722 3300026075 Bacteria 24877
275 Ga0207708_10090323 3300026075 Bacteria 2361
276 Ga0207641_10464408 3300026088 Bacteria 1225
277 Ga0207648_10421286 3300026089 Bacteria 1212
278 Ga0207676_10082679 3300026095 Bacteria 2613
279 Ga0207675_100303376 3300026118 Bacteria 1556
280 Ga0207675_100663148 3300026118 Bacteria 1050
281 Ga0207675_100986255 3300026118 Bacteria 861
282 Ga0207675_101230805 3300026118 Bacteria 769
283 Ga0207698_10869070 3300026142 Bacteria 908
284 Ga0209984_1006808 3300027424 Bacteria 1408
285 Ga0209179_1002556 3300027512 Bacteria 2478
286 Ga0209998_10029173 3300027717 Bacteria 1216
287 Ga0209998_10045794 3300027717 Bacteria 1003
288 Ga0209974_10024913 3300027876 Bacteria 1980
289 Ga0207428_10005312 3300027907 Bacteria 12017
290 Ga0207428_10052112 3300027907 Bacteria 3269
291 Ga0268266_10325064 3300028379 Bacteria 1440
292 Ga0268266_10570942 3300028379 Bacteria 1085
293 Ga0268265_10048213 3300028380 Bacteria 3197
294 Ga0268265_10587506 3300028380 Bacteria 1062
295 Ga0268264_10000119 3300028381 Bacteria 192507
296 Ga0268264_10003330 3300028381 Bacteria 13888
297 Ga0268264_10174690 3300028381 Bacteria 1946
298 Ga0268264_10388597 3300028381 Bacteria 1338
299 Ga0307517_10014916 3300028786 Bacteria 10379
300 Ga0307517_10044999 3300028786 Bacteria 4650
301 Ga0307515_10000025 3300028794 Bacteria 390205
302 Ga0307515_10012166 3300028794 Bacteria 16224
303 Ga0307515_10024738 3300028794 Bacteria 10438
304 Ga0307515_10029689 3300028794 Bacteria 9226
305 Ga0307515_10072557 3300028794 Bacteria 4642
306 Ga0307515_10176271 3300028794 Bacteria 2107
307 Ga0307515_10281381 3300028794 Bacteria 1370
308 Ga0307511_10004686 3300030521 Bacteria 13981
309 Ga0307511_10110106 3300030521 Bacteria 1757
310 Ga0307511_10247809 3300030521 Bacteria 860
311 Ga0307512_10002952 3300030522 Bacteria 20535
312 Ga0307512_10004206 3300030522 Bacteria 15910
313 Ga0307512_10012997 3300030522 Bacteria 7825
314 Ga0307512_10163618 3300030522 Bacteria 1295
315 Ga0307513_10008140 3300031456 Bacteria 13460
316 Ga0307513_10009327 3300031456 Bacteria 12425
317 Ga0307513_10359149 3300031456 Bacteria 1202
318 Ga0307509_10007842 3300031507 Bacteria 13806
319 Ga0307509_10012362 3300031507 Bacteria 10220
320 Ga0307509_10028165 3300031507 Bacteria 6248
321 Ga0307509_10038694 3300031507 Bacteria 5202
322 Ga0307509_10054861 3300031507 Bacteria 4240
323 Ga0307509_10435209 3300031507 Bacteria 1009
324 Ga0307408_100077930 3300031548 Bacteria 2469
325 Ga0307508_10000627 3300031616 Bacteria 42456
326 Ga0307508_10045944 3300031616 Bacteria 3900
327 Ga0307508_10059091 3300031616 Bacteria 3392
328 Ga0307508_10059877 3300031616 Bacteria 3368
329 Ga0307508_10075682 3300031616 Bacteria 2943
330 Ga0307508_10201051 3300031616 Bacteria 1593
331 Ga0307508_10328127 3300031616 Bacteria 1122
332 Ga0307514_10002480 3300031649 Bacteria 19123
333 Ga0307514_10123001 3300031649 Bacteria 1804
334 Ga0307514_10350973 3300031649 Bacteria 786
335 Ga0307516_10001908 3300031730 Bacteria 28553
336 Ga0307516_10019620 3300031730 Bacteria 6999
337 Ga0307516_10030055 3300031730 Bacteria 5486
338 Ga0307516_10324135 3300031730 Bacteria 1211
339 Ga0307516_10537083 3300031730 Bacteria 823
340 Ga0307410_10033280 3300031852 Bacteria 3327
341 Ga0307406_10265283 3300031901 Bacteria 1301
342 Ga0307416_100462691 3300032002 Bacteria 1324
343 Ga0307507_10024849 3300033179 Bacteria 6514
344 Ga0307507_10026989 3300033179 Bacteria 6172
345 Ga0307507_10116918 3300033179 Bacteria 2152
346 Ga0307507_10178558 3300033179 Bacteria 1523
347 Ga0307510_10004705 3300033180 Bacteria 16125
348 Ga0307510_10025114 3300033180 Bacteria 6876
349 Ga0307510_10034361 3300033180 Bacteria 5680
350 Ga0307510_10069533 3300033180 Bacteria 3525
351 Ga0307510_10078190 3300033180 Bacteria 3238
352 Ga0307510_10299809 3300033180 Bacteria 1070
353 Ga0373930_0001567 3300034816 Bacteria 3431
354 Ga0373958_0000580 3300034819 Bacteria 4539
355 Ga0373928_0000280 3300035084 Bacteria 10071
356 Ga0373940_0001444 3300035088 Bacteria 4300
357 Ga0373949_0002668 3300035090 Bacteria 4485
358 Ga0373951_0005177 3300035091 Bacteria 3046
359 Ga0373952_0003660 3300035092 Bacteria 2772
360 Ga0373932_0001203 3300035112 Bacteria 7373
361 Ga0373939_0001268 3300035114 Bacteria 6172
362 Ga0373941_0000810 3300035115 Bacteria 6412
363 Ga0373957_0131245 3300035120 Bacteria 1020
364 Ga0373960_0004662 3300035121 Bacteria 3149
365 Ga0373943_0103805 3300035170 Bacteria 1490
366 Ga0373942_0012849 3300035207 Bacteria 2005
367 Ga0373961_0004256 3300035241 Bacteria 3470
368 Ga0373962_0002764 3300035242 Bacteria 4184
369 Ga0373924_0068290 3300035410 Bacteria 1496
370 Ga0373931_0058043 3300035691 Bacteria 2077
371 Ga0373931_0192761 3300035691 Bacteria 1213
372 Ga0373931_0215008 3300035691 Bacteria 1155
373 Ga0373935_0141054 3300035692 Bacteria 1628
374 Ga0373935_0587877 3300035692 Bacteria 813
375 Ga0373927_0039399 3300035695 Bacteria 3067
376 Ga0373933_0045841 3300035724 Bacteria 2594
377 Ga0373947_0105164 3300035725 Bacteria 1778
378 Ga0373937_0018204 3300036401 Bacteria 6269
379 Ga0373937_0541008 3300036401 Bacteria 1106
380 Ga0373925_0200509 3300037068 Bacteria 1587
381 Ga0373925_0613290 3300037068 Bacteria 896
382 Ga0395899_0115731 3300037312 Bacteria 1924
383 Ga0395900_0232277 3300037418 Bacteria 1854
384 Ga0436364_0459773 3300037853 Bacteria 2353
385 Ga0436364_0737000 3300037853 Bacteria 4393
386 Ga0436364_1034674 3300037853 Bacteria 2829
387 Ga0436364_1494924 3300037853 Bacteria 1111
388 Ga0395901_0246435 3300038443 Bacteria 1862
389 Ga0395901_0551761 3300038443 Bacteria 1168
390 Ga0436365_0073382 3300039437 Bacteria 4911
391 Ga0436365_1794781 3300039437 Bacteria 817
392 Ga0436365_1804874 3300039437 Bacteria 4035
393 Ga0436363_0715612 3300039450 Bacteria 666
394 Ga0436362_0399580 3300039453 Bacteria 1155
395 Ga0436362_0406741 3300039453 Bacteria 774
396 Ga0439461_0159308 3300041410 Bacteria 587
397 Ga0451802_1201114 3300041460 Bacteria 844
398 Ga0439452_068361 3300042010 Bacteria 786
399 Ga0450902_026053 3300042137 Bacteria 977
400 Ga0439446_0027614 3300042156 Bacteria 1630
401 Ga0439464_0047193 3300042439 Bacteria 1239
402 Ga0439460_0079371 3300042461 Bacteria 1028
403 Ga0451577_0062823 3300042876 Bacteria 3312
404 Ga0451577_0436270 3300042876 Bacteria 1189
405 Ga0466972_0000820 3300044658 Bacteria 14864
406 Ga0453683_0100189 3300044673 Unclassified 1818
407 Ga0466965_0002113 3300044683 Bacteria 8341
408 Ga0466963_0116972 3300044694 Bacteria 1832
409 Ga0466963_0506159 3300044694 Bacteria 853
410 Ga0466970_0005554 3300044765 Bacteria 6267
411 Ga0466970_0120005 3300044765 Bacteria 1440
412 Ga0466960_0001965 3300044901 Bacteria 7609
413 Ga0466960_0011636 3300044901 Bacteria 3690
414 Ga0466959_0200948 3300045049 Bacteria 1388
415 Ga0451576_0146333 3300045051 Bacteria 2463
416 Ga0451576_0279148 3300045051 Bacteria 1747
417 Ga0466967_0885733 3300045976 Bacteria 887
418 Ga0466967_1307818 3300045976 Bacteria 722
419 Ga0495592_0003230 3300046454 Bacteria 11685
420 Ga0495592_0117172 3300046454 Bacteria 1878
421 Ga0495603_0006944 3300046455 Bacteria 6791
422 Ga0495603_0153903 3300046455 Bacteria 1335
423 Ga0495629_0008343 3300046459 Bacteria 7618
424 Ga0495629_0008698 3300046459 Bacteria 7470
425 Ga0495629_0010044 3300046459 Bacteria 6907
426 Ga0495629_0053023 3300046459 Bacteria 2838
427 Ga0495638_0332073 3300046460 Bacteria 808
428 Ga0495651_0000641 3300046462 Bacteria 27005
429 Ga0495651_0005504 3300046462 Bacteria 9662
430 Ga0495651_0051986 3300046462 Bacteria 3157
431 Ga0495653_0000532 3300046463 Bacteria 29172
432 Ga0495580_0137480 3300046472 Bacteria 1694
433 Ga0495582_0011499 3300046473 Bacteria 4877
434 Ga0495582_0188928 3300046473 Bacteria 1175
435 Ga0495662_0000382 3300046476 Bacteria 19658
436 Ga0495664_0001758 3300046477 Bacteria 11511
437 Ga0495664_0343604 3300046477 Bacteria 899
438 Ga0495584_0021930 3300046491 Bacteria 3243
439 Ga0495606_0030447 3300046507 Bacteria 3771
440 Ga0495606_0082485 3300046507 Bacteria 1996
441 Ga0495608_0004541 3300046511 Bacteria 9920
442 Ga0495618_0009578 3300046514 Bacteria 5848
443 Ga0495618_0036261 3300046514 Bacteria 3094
444 Ga0495618_0619805 3300046514 Bacteria 642
445 Ga0495628_0027352 3300046516 Bacteria 4642
446 Ga0495628_0170838 3300046516 Bacteria 1648
447 Ga0495628_0500797 3300046516 Bacteria 877
448 Ga0495630_0004892 3300046517 Bacteria 9410
449 Ga0495630_0103220 3300046517 Bacteria 2157
450 Ga0495630_0233407 3300046517 Bacteria 1406
451 Ga0495631_0215362 3300046518 Bacteria 820
452 Ga0495648_0028394 3300046524 Bacteria 3727
453 Ga0495648_0121078 3300046524 Bacteria 1406
454 Ga0495652_0001336 3300046529 Bacteria 27452
455 Ga0495652_0009215 3300046529 Bacteria 8974
456 Ga0495652_0026992 3300046529 Bacteria 5065
457 Ga0495652_0111893 3300046529 Bacteria 2194
458 Ga0495665_0103788 3300046531 Bacteria 1491
459 Ga0495665_0473075 3300046531 Bacteria 632
460 Ga0495640_0189746 3300046533 Bacteria 1307
461 Ga0495586_0132076 3300046535 Bacteria 1398
462 Ga0495587_0000512 3300046536 Bacteria 26945
463 Ga0495587_0062518 3300046536 Bacteria 2179
464 Ga0495645_0004214 3300046543 Bacteria 9838
465 Ga0495645_0074448 3300046543 Bacteria 2445
466 Ga0495667_0001063 3300046559 Bacteria 17859
467 Ga0495634_0001377 3300046642 Bacteria 21944
468 Ga0495634_0007540 3300046642 Bacteria 8159
469 Ga0495634_0074455 3300046642 Bacteria 2231
470 Ga0495611_0016735 3300046648 Bacteria 3134
471 Ga0495611_0135868 3300046648 Bacteria 1148
472 Ga0495625_0034416 3300046660 Bacteria 3739
473 Ga0495635_0000455 3300046663 Bacteria 25907
474 Ga0495635_0001032 3300046663 Bacteria 18442
475 Ga0495635_0008433 3300046663 Bacteria 7196
476 Ga0495635_0728454 3300046663 Bacteria 642
477 Ga0495661_0160153 3300046665 Bacteria 1209
478 Ga0495588_0177286 3300046674 Bacteria 1126
479 Ga0495657_0000556 3300046675 Bacteria 34468
480 Ga0495657_0006059 3300046675 Bacteria 9494
481 Ga0495599_0000308 3300046678 Bacteria 29564
482 Ga0495599_0231636 3300046678 Bacteria 1128
483 Ga0495623_0000694 3300046679 Bacteria 22387
484 Ga0495623_0250247 3300046679 Bacteria 997
485 Ga0495623_0294993 3300046679 Bacteria 898
486 Ga0495646_0003088 3300046680 Bacteria 10333
487 Ga0495646_0061235 3300046680 Bacteria 2242
488 Ga0495646_0066491 3300046680 Bacteria 2132
489 Ga0495647_0334442 3300046681 Bacteria 687
490 Ga0495658_0004671 3300046683 Bacteria 6737
491 Ga0495658_0074852 3300046683 Bacteria 1974
492 Ga0495658_0414639 3300046683 Bacteria 859
493 Ga0495669_0000684 3300046684 Bacteria 14764
494 Ga0495613_0001129 3300046689 Bacteria 20328
495 Ga0495613_0003840 3300046689 Bacteria 11245
496 Ga0495613_0076432 3300046689 Bacteria 2437
497 Ga0495613_0243399 3300046689 Bacteria 1257
498 Ga0495624_0070725 3300046690 Bacteria 2172
499 Ga0495670_0042134 3300046691 Bacteria 2278
500 Ga0495671_0028098 3300046692 Bacteria 2900
501 Ga0495671_0089728 3300046692 Bacteria 1505
502 Ga0495589_0040052 3300046794 Bacteria 2340
503 Ga0495600_0002183 3300046809 Bacteria 11112
504 Ga0495581_0023636 3300047315 Bacteria 3561
505 Ga0495581_0316848 3300047315 Bacteria 911
506 Ga0495604_0000213 3300047317 Bacteria 53409
507 Ga0495604_0002124 3300047317 Bacteria 15957
508 Ga0495636_0000883 3300047318 Bacteria 11091
509 Ga0495636_0096107 3300047318 Bacteria 1291
510 Ga0495674_0011928 3300047319 Bacteria 8194
511 Ga0495674_0137770 3300047319 Bacteria 2052
512 Ga0495672_0027939 3300047320 Bacteria 3577
513 Ga0495672_0116323 3300047320 Bacteria 1428
514 Ga0495676_0000413 3300047321 Bacteria 34737
515 Ga0495676_0012477 3300047321 Bacteria 7651
516 Ga0495676_0013907 3300047321 Bacteria 7214
517 Ga0495687_003190 3300047443 Bacteria 12170
518 Ga0495687_004123 3300047443 Bacteria 10027
519 Ga0495687_017067 3300047443 Bacteria 3634
520 Ga0495675_0001609 3300047444 Bacteria 13573
521 Ga0495677_0149711 3300047445 Bacteria 898
522 Ga0495685_003174 3300047447 Bacteria 5218
523 Ga0495685_064440 3300047447 Bacteria 1232
524 Ga0495673_0001012 3300047469 Bacteria 24787
525 Ga0495681_0006963 3300047470 Bacteria 7324
526 Ga0495684_0000903 3300047471 Bacteria 24073
527 Ga0495686_0100409 3300047472 Bacteria 1746
528 Ga0495593_0001416 3300047673 Bacteria 14059
529 Ga0495593_0139624 3300047673 Bacteria 1228
530 Ga0495593_0462388 3300047673 Bacteria 635
531 Ga0495602_0001348 3300048088 Bacteria 24232
532 Ga0495602_0028433 3300048088 Bacteria 5350
533 Ga0495614_0000735 3300048089 Bacteria 13871
534 Ga0495614_0116982 3300048089 Bacteria 1173
535 Ga0496100_0219890 3300048903 Bacteria 1393
536 Ga0496102_0025311 3300048905 Bacteria 5282
537 Ga0496102_0073457 3300048905 Bacteria 3143
538 Ga0496103_0186610 3300048906 Bacteria 1333
539 Ga0496104_0005007 3300048907 Bacteria 11555
540 Ga0496104_0110184 3300048907 Bacteria 2639
541 Ga0496104_0143428 3300048907 Bacteria 2294
542 Ga0496105_0028661 3300048908 Bacteria 4554
543 Ga0496105_0235737 3300048908 Bacteria 1486
544 Ga0496105_0323321 3300048908 Archaea 1236
545 Ga0496106_0008827 3300048909 Bacteria 7449
546 Ga0496106_0042912 3300048909 Bacteria 3392
547 Ga0496106_0060164 3300048909 Bacteria 2879
548 Ga0496106_0278104 3300048909 Bacteria 1341
549 Ga0496107_0014180 3300048910 Bacteria 5581
550 Ga0496107_0021859 3300048910 Bacteria 4521
551 Ga0496107_0163846 3300048910 Bacteria 1648
552 Ga0496108_0001304 3300048911 Bacteria 19616
553 Ga0496108_0073389 3300048911 Bacteria 2889
554 Ga0496108_0092467 3300048911 Bacteria 2572
555 Ga0496108_0714523 3300048911 Bacteria 868
556 Ga0496109_0003457 3300048912 Bacteria 13191
557 Ga0496109_0005799 3300048912 Bacteria 10340
558 Ga0496109_0013836 3300048912 Bacteria 7011
559 Ga0496110_0009849 3300048913 Bacteria 7745
560 Ga0496110_0056983 3300048913 Bacteria 3439
561 Ga0496112_0003458 3300048915 Bacteria 13050
562 Ga0496112_0036812 3300048915 Bacteria 4774
563 Ga0496113_0067309 3300048916 Bacteria 2715
564 Ga0496113_0081135 3300048916 Bacteria 2485
565 Ga0496114_0248171 3300048917 Bacteria 1566
566 Ga0496115_0030116 3300048918 Bacteria 4267
567 Ga0496115_0409242 3300048918 Bacteria 1100
568 Ga0496117_0046970 3300048920 Bacteria 3101
569 Ga0496118_0008644 3300048921 Bacteria 10479
570 Ga0496119_0124966 3300048922 Bacteria 1409
571 Ga0496121_0000668 3300048924 Bacteria 64093
572 Ga0496124_0000955 3300048927 Bacteria 46091
573 Ga0496124_0824984 3300048927 Bacteria 571
574 Ga0496125_0015321 3300048928 Bacteria 7420
575 Ga0496125_0459411 3300048928 Bacteria 727
576 Ga0496126_0007074 3300048929 Bacteria 12359
577 Ga0496126_0294409 3300048929 Bacteria 1341
578 Ga0496126_0463440 3300048929 Bacteria 1018
579 Ga0501033_0009826 3300049570 Bacteria 7344
580 Ga0501034_0038412 3300049571 Bacteria 4848
581 Ga0501036_0011904 3300049572 Bacteria 7211
582 Ga0501036_0526581 3300049572 Bacteria 983
583 Ga0501037_0053217 3300049573 Bacteria 2961
584 Ga0501038_0003213 3300049574 Bacteria 15250
585 Ga0501038_0246682 3300049574 Bacteria 1416
586 Ga0501038_0347854 3300049574 Bacteria 1155
587 Ga0501039_0001002 3300049575 Bacteria 20580
588 Ga0501040_0000976 3300049576 Bacteria 18083
589 Ga0501040_0193357 3300049576 Bacteria 1444
590 Ga0501041_0000633 3300049577 Bacteria 18386
591 Ga0501041_0150905 3300049577 Bacteria 1451
592 Ga0501042_0000928 3300049578 Bacteria 16503
593 Ga0501043_0025356 3300049579 Bacteria 4652
594 Ga0501046_0002250 3300049580 Bacteria 18209
595 Ga0501046_0407735 3300049580 Bacteria 981
596 Ga0501047_0003179 3300049581 Bacteria 15567
597 Ga0501047_0013145 3300049581 Bacteria 7840
598 Ga0501047_0233904 3300049581 Bacteria 1690
599 Ga0501048_0001788 3300049582 Bacteria 16340
600 Ga0501048_0198836 3300049582 Bacteria 1421
601 Ga0501067_0410490 3300049583 Bacteria 755
602 Ga0501068_0009389 3300049584 Bacteria 5471
603 Ga0501069_0055980 3300049585 Bacteria 2197
604 Ga0501069_0318971 3300049585 Bacteria 913
605 Ga0501070_0058039 3300049586 Bacteria 3209
606 Ga0501070_0742791 3300049586 Bacteria 774
607 Ga0501071_0000518 3300049587 Bacteria 19663
608 Ga0501072_0004996 3300049588 Bacteria 10091
609 Ga0501073_0066103 3300049589 Bacteria 2521
610 Ga0501073_0617820 3300049589 Bacteria 748
611 Ga0501074_0049015 3300049590 Bacteria 3050
612 Ga0501074_0392050 3300049590 Bacteria 985
613 Ga0501075_0004425 3300049591 Bacteria 9506
614 Ga0501076_0021850 3300049592 Bacteria 4912
615 Ga0501077_0000169 3300049593 Bacteria 37313
616 Ga0501079_0001306 3300049741 Bacteria 17540
617 Ga0501079_0352451 3300049741 Bacteria 1153
618 Ga0501079_0462559 3300049741 Bacteria 996
619 Ga0501080_0005909 3300049742 Bacteria 10962
620 Ga0501080_0449665 3300049742 Bacteria 1155
621 Ga0501081_0000045 3300049743 Bacteria 47062
622 Ga0501083_0019006 3300049744 Bacteria 4783
623 Ga0501035_0018417 3300049822 Bacteria 6435
624 Ga0501035_0330881 3300049822 Bacteria 1278
625 Ga0501035_0499727 3300049822 Bacteria 1001
626 Ga0501044_0019766 3300049823 Bacteria 7196
627 Ga0501044_0039232 3300049823 Bacteria 4941
628 Ga0501044_0104244 3300049823 Bacteria 2850
629 Ga0501044_0303115 3300049823 Bacteria 1526
630 Ga0501044_1104406 3300049823 Bacteria 662
631 Ga0501045_0001264 3300049824 Bacteria 16786
632 Ga0501045_0095507 3300049824 Bacteria 2199
633 nmdc:mga03n38_823490_c1 3300050490 Bacteria 542
634 nmdc:mga00v17_722887_c1 3300050491 Bacteria 637
635 nmdc:mga0yw44_163548_c1 3300050492 Unclassified 1458
636 nmdc:mga0yw44_29605_c1 3300050492 Bacteria 3162
637 nmdc:mga06z11_7499_c1 3300050494 Bacteria 4492
638 nmdc:mga05p37_128369_c1 3300050507 Bacteria 3112
639 nmdc:mga05p37_20494_c1 3300050507 Bacteria 7998
640 nmdc:mga05p37_470153_c1 3300050507 Bacteria 1149
641 nmdc:mga0qj67_310234_c1 3300050509 Bacteria 1277
642 nmdc:mga06r32_1311537_c1 3300050510 Bacteria 668
643 nmdc:mga08y16_13298_c1 3300050511 Bacteria 8656
644 nmdc:mga08y16_40442_c1 3300050511 Bacteria 4888
645 nmdc:mga0n895_102785_c1 3300050512 Bacteria 2869
646 nmdc:mga0n895_2166187_c1 3300050512 Bacteria 512
647 nmdc:mga0n895_240225_c1 3300050512 Bacteria 1838
648 nmdc:mga0rr50_1032947_c1 3300050513 Bacteria 700
649 nmdc:mga0rr50_1119532_c1 3300050513 Bacteria 670
650 nmdc:mga0rr50_412937_c1 3300050513 Bacteria 1141
651 nmdc:mga0rr50_57431_c1 3300050513 Bacteria 2911
652 nmdc:mga08x19_76577_c1 3300050514 Bacteria 2189
653 nmdc:mga08x19_826620_c1 3300050514 Bacteria 658
654 nmdc:mga08x19_87379_c1 3300050514 Bacteria 2054
655 nmdc:mga0a205_277738_c1 3300050515 Bacteria 1551
656 nmdc:mga0a205_95019_c1 3300050515 Bacteria 2880
657 Ga0495601_0015103 3300053077 Bacteria 4664
658 Ga0495601_0048787 3300053077 Bacteria 2667
659 Ga0495601_0065794 3300053077 Bacteria 2307
660 Ga0495612_0003965 3300053078 Bacteria 6146
661 Ga0495612_0011152 3300053078 Bacteria 3628
662 Ga0495612_0332280 3300053078 Bacteria 685
663 Ga0495619_0082153 3300053085 Bacteria 2171
664 Ga0495619_0131409 3300053085 Bacteria 1721
665 Ga0500644_0014454 3300053088 Bacteria 2230
666 Ga0500644_0020409 3300053088 Bacteria 1969
667 Ga0500646_0047703 3300053090 Bacteria 1226
668 Ga0500651_0046293 3300053093 Bacteria 2736
669 Ga0500651_0081699 3300053093 Bacteria 2001
670 Ga0500566_0030101 3300053094 Bacteria 3167
671 Ga0500566_0169412 3300053094 Bacteria 1130
672 Ga0500640_018152 3300053095 Bacteria 2996
673 Ga0500650_0019758 3300053098 Bacteria 2946
674 Ga0500553_016785 3300053101 Bacteria 3717
675 Ga0500560_013422 3300053107 Bacteria 2153
676 Ga0500562_003500 3300053108 Bacteria 3938
677 Ga0500569_054976 3300053109 Bacteria 1213
678 Ga0500572_001959 3300053111 Bacteria 5163
679 Ga0500572_118274 3300053111 Bacteria 856
680 Ga0500580_178402 3300053113 Bacteria 727
681 Ga0500594_0006611 3300053118 Bacteria 2610
682 Ga0500595_004573 3300053119 Bacteria 6173
683 Ga0500608_048785 3300053122 Bacteria 2035
684 Ga0500614_021406 3300053123 Bacteria 1500
685 Ga0500652_152031 3300053131 Bacteria 960
686 Ga0500559_0000427 3300053136 Bacteria 29923
687 Ga0500564_185064 3300053138 Bacteria 866
688 Ga0500568_0047011 3300053139 Bacteria 1711
689 Ga0500573_0042003 3300053140 Bacteria 2641
690 Ga0500586_224923 3300053145 Bacteria 602
691 Ga0500616_0016185 3300053153 Bacteria 4250
692 Ga0500616_0146432 3300053153 Bacteria 1098
693 Ga0500622_0298318 3300053156 Bacteria 688
694 Ga0500624_003453 3300053157 Bacteria 2074
695 Ga0500638_235590 3300053162 Bacteria 748
696 Ga0500636_0289670 3300053177 Bacteria 812
697 Ga0500637_0212565 3300053178 Bacteria 1096
698 Ga0500570_121204 3300053724 Bacteria 1026
699 Ga0500656_035974 3300053732 Bacteria 677
700 Ga0500552_060677 3300053733 Bacteria 661
701 Ga0500596_003877 3300053735 Bacteria 2799
702 Ga0500596_003879 3300053735 Bacteria 2798
703 Ga0501084_0006845 3300054114 Bacteria 9384
704 Ga0501082_0001888 3300060353 Bacteria 18435
705 Ga0501082_0546710 3300060353 Bacteria 1013
706 Ga0466962_0225772 3300061719 Bacteria 918
707 Ga0530510_0005780 3300061734 Bacteria 8572
708 Ga0530510_0673698 3300061734 Bacteria 788
709 8054166577 8054160619 Bacteria 7783213
710 2545675814 2545555834 Bacteria 8130841
711 2573036749 2571042588 Bacteria 5045676
712 2578335951 2576861424 Bacteria 5270569
713 2580931093 2579778775 Bacteria 5360914
714 2621274124 2619619294 Bacteria 5575484
715 2793980625 2791355406 Bacteria 11364898
716 2884701163 2884693830 Bacteria 11273186
717 2895442947 2895442618 Bacteria 11027144
718 2902793556 2902792274 Bacteria 7270173
719 2971514666 2971511577 Bacteria 5404012
720 2980180774 2980176882 Bacteria 5397533
721 8045867076 8045864390 Bacteria 5043873
722 8047901262 8047893842 Bacteria 11723082
723 8048135654 8048127548 Bacteria 11053136
724 8048357638 8048356638 Bacteria 11044339
725 8048378202 8048369669 Bacteria 11666822
726 8048387300 8048379754 Bacteria 11877923
727 8054476203 8054472261 Bacteria 7464355
728 8055173998 8055172936 Bacteria 9305943
729 2214800762
730 ARcpr5oldR_c000446
731 ARSoilYngRDRAFT_c00556
732 ARcpr5yngRDRAFT_c000070
733 ARSoilOldRDRAFT_c000067
734 ARCol0yngRDRAFT_1000193
735 Ga0065716_1003993
736 Ga0065712_10076534
737 Ga0065715_10616772
738 Ga0070658_10108111
739 Ga0070683_100008747
740 Ga0070683_100209957
741 Ga0070683_100796466
742 Ga0070683_100813056
743 Ga0070683_101098190
744 Ga0070666_11129222
745 Ga0070680_100229131
746 Ga0070680_100453644
747 Ga0070682_100007844
748 Ga0068868_100005522
749 Ga0068868_100729344
750 Ga0070660_100083064
751 Ga0070689_100237244
752 Ga0070691_10022954
753 Ga0070687_100389892
754 Ga0070668_100059432
755 Ga0070669_100026214
756 Ga0070675_100024093
757 Ga0070675_100215185
758 Ga0070675_100413386
759 Ga0070671_100002215
760 Ga0070671_100714594
761 Ga0070674_100477317
762 Ga0070673_100061776
763 Ga0070688_100053201
764 Ga0070688_100173768
765 Ga0070659_100047803
766 Ga0070659_100092062
767 Ga0070659_100541196
768 Ga0070667_101659418
769 Ga0070709_10316054
770 Ga0070714_100001413
771 Ga0070714_100192637
772 Ga0070713_100006384
773 Ga0070713_100405551
774 Ga0070710_10015107
775 Ga0070710_10125681
776 Ga0070711_100057100
777 Ga0070711_100442748
778 Ga0070711_100444004
779 Ga0070711_100490290
780 Ga0070705_100642430
781 Ga0070700_100001758
782 Ga0070700_100332340
783 Ga0070708_100645047
784 Ga0070708_101429973
785 Ga0070663_100007556
786 Ga0070663_101040900
787 Ga0070662_100068362
788 Ga0070662_100136337
789 Ga0070681_10243404
790 Ga0070681_10270148
791 Ga0070681_10379751
792 Ga0070681_10473407
793 Ga0068867_100488734
794 Ga0070698_100001534
795 Ga0070698_100016842
796 Ga0070698_100069221
797 Ga0070679_100085062
798 Ga0070679_100086884
799 Ga0070679_100773490
800 Ga0070684_100030916
801 Ga0068853_100343521
802 Ga0070672_100390803
803 Ga0070686_100714812
804 Ga0070695_100122805
805 Ga0070695_100725187
806 Ga0070695_101309261
807 Ga0070696_100020433
808 Ga0070696_100121446
809 Ga0070693_100049467
810 Ga0070665_100001501
811 Ga0070665_100544926
812 Ga0070704_100018089
813 Ga0070664_100541257
814 Ga0070664_101051574
815 Ga0070702_100029125
816 Ga0070702_100320099
817 Ga0070702_100453080
818 Ga0068859_100106258
819 Ga0068859_100670348
820 Ga0068864_100077554
821 Ga0068861_100718861
822 Ga0068861_100968508
823 Ga0068861_101145800
824 Ga0068863_100085035
825 Ga0068863_100331404
826 Ga0068860_100002999
827 Ga0068860_100003607
828 Ga0068860_100388569
829 Ga0068860_100445501
830 Ga0068860_100867170
831 Ga0068862_100192698
832 Ga0081455_10227417
833 Ga0081538_10000527
834 Ga0081538_10016841
835 Ga0081538_10105882
836 Ga0081540_1028469
837 Ga0081540_1080844
838 Ga0070717_10054851
839 Ga0070717_10101143
840 Ga0075365_10186117
841 Ga0075365_10296209
842 Ga0075368_10004789
843 Ga0075363_100113574
844 Ga0075364_10404144
845 Ga0075432_10033172
846 Ga0070716_100298537
847 Ga0070712_100002998
848 Ga0070712_100019314
849 Ga0070712_100085171
850 Ga0070712_100214162
851 Ga0070712_100691514
852 Ga0075367_10005037
853 Ga0097621_100990265
854 Ga0068871_101792336
855 Ga0075430_100298286
856 Ga0075431_100126184
857 Ga0075433_10196534
858 Ga0075434_100064070
859 Ga0075434_100071307
860 Ga0075434_101735361
861 Ga0068865_100230426
862 Ga0068865_101195414
863 Ga0075436_100085479
864 Ga0097620_100106260
865 Ga0097620_100670324
866 Ga0075435_100004162
867 Ga0075435_100470903
868 Ga0075435_100614116
869 Ga0075435_100933193
870 Ga0099795_10000092
871 Ga0105240_11284954
872 Ga0111539_10020125
873 Ga0111539_10190763
874 Ga0111539_11219505
875 Ga0105245_10153495
876 Ga0105245_11346420
877 Ga0105245_12062001
878 Ga0105247_10005076
879 Ga0105247_10133477
880 Ga0114129_10013624
881 Ga0114129_10689956
882 Ga0105243_10062762
883 Ga0105243_10215312
884 Ga0105241_10077219
885 Ga0105241_11154935
886 Ga0105242_10109619
887 Ga0105248_10025309
888 Ga0105248_10242782
889 Ga0105237_10235354
890 Ga0105237_10623556
891 Ga0105237_10962068
892 Ga0105238_10399418
893 Ga0105238_11414038
894 Ga0105249_10015588
895 Ga0105249_10064947
896 Ga0105249_10453574
897 Ga0099796_10003919
898 Ga0105239_10009877
899 Ga0105239_10109708
900 Ga0105246_10163957
901 Ga0105246_11263826
902 Ga0157342_1050605
903 Ga0157369_10606169
904 Ga0157374_10009417
905 Ga0157374_11075169
906 Ga0157378_12320861
907 Ga0163162_10170220
908 Ga0163162_11188342
909 Ga0163162_11227218
910 Ga0157372_10029090
911 Ga0157372_10418591
912 Ga0163163_10009747
913 Ga0163163_10097190
914 Ga0163163_10827047
915 Ga0182008_10247495
916 Ga0157377_10001064
917 Ga0157379_10005209
918 Ga0157379_10538002
919 Ga0157379_10555563
920 Ga0157376_10042271
921 Ga0163161_10444667
922 Ga0213874_10070723
923 Ga0213876_10047462
924 Ga0213876_10242218
925 Ga0213875_10000074
926 Ga0213875_10083738
927 Ga0213875_10218784
928 Ga0207697_10016459
929 Ga0207692_10010423
930 Ga0207710_10329507
931 Ga0207688_10015212
932 Ga0207688_10070790
933 Ga0207688_10569247
934 Ga0207647_10178837
935 Ga0207685_10109340
936 Ga0207685_10116224
937 Ga0207705_10087822
938 Ga0207684_10014054
939 Ga0207684_10175140
940 Ga0207654_10568465
941 Ga0207707_10066192
942 Ga0207707_10228863
943 Ga0207671_10174075
944 Ga0207693_10004345
945 Ga0207693_10011832
946 Ga0207663_10014943
947 Ga0207663_10280875
948 Ga0207660_10352029
949 Ga0207662_10287704
950 Ga0207662_10424706
951 Ga0207657_10025235
952 Ga0207657_10046602
953 Ga0207649_10137568
954 Ga0207652_10110725
955 Ga0207694_10984364
956 Ga0207659_10072132
957 Ga0207659_10336308
958 Ga0207687_10062939
959 Ga0207687_10167001
960 Ga0207700_10053165
961 Ga0207664_10000800
962 Ga0207664_10134351
963 Ga0207664_10396794
964 Ga0207664_11289383
965 Ga0207644_10003127
966 Ga0207644_10790756
967 Ga0207690_10010595
968 Ga0207690_10219795
969 Ga0207690_10365409
970 Ga0207706_10067682
971 Ga0207706_10068728
972 Ga0207706_10159690
973 Ga0207686_10310744
974 Ga0207709_10081950
975 Ga0207709_10187643
976 Ga0207670_10367097
977 Ga0207669_10476838
978 Ga0207704_10365499
979 Ga0207665_10249411
980 Ga0207691_11359313
981 Ga0207661_10028254
982 Ga0207661_10212835
983 Ga0207661_10405595
984 Ga0207661_10729062
985 Ga0207661_11249223
986 Ga0207679_10465288
987 Ga0207651_10051881
988 Ga0207712_10058288
989 Ga0207712_10324601
990 Ga0207712_10491330
991 Ga0207668_10080494
992 Ga0207668_10527160
993 Ga0207658_10533121
994 Ga0207677_10367516
995 Ga0207703_10018798
996 Ga0207703_10093625
997 Ga0207703_10671945
998 Ga0207639_10177218
999 Ga0207639_10386948
1000 Ga0207678_10021491
1001 Ga0207678_10835469
1002 Ga0207708_10000722
1003 Ga0207708_10090323
1004 Ga0207641_10464408
1005 Ga0207648_10421286
1006 Ga0207676_10082679
1007 Ga0207675_100303376
1008 Ga0207675_100663148
1009 Ga0207675_100986255
1010 Ga0207675_101230805
1011 Ga0207698_10869070
1012 Ga0209984_1006808
1013 Ga0209179_1002556
1014 Ga0209998_10029173
1015 Ga0209998_10045794
1016 Ga0209974_10024913
1017 Ga0207428_10005312
1018 Ga0207428_10052112
1019 Ga0268266_10325064
1020 Ga0268266_10570942
1021 Ga0268265_10048213
1022 Ga0268265_10587506
1023 Ga0268264_10000119
1024 Ga0268264_10003330
1025 Ga0268264_10174690
1026 Ga0268264_10388597
1027 Ga0307517_10014916
1028 Ga0307517_10044999
1029 Ga0307515_10000025
1030 Ga0307515_10012166
1031 Ga0307515_10024738
1032 Ga0307515_10029689
1033 Ga0307515_10072557
1034 Ga0307515_10176271
1035 Ga0307515_10281381
1036 Ga0307511_10004686
1037 Ga0307511_10110106
1038 Ga0307511_10247809
1039 Ga0307512_10002952
1040 Ga0307512_10004206
1041 Ga0307512_10012997
1042 Ga0307512_10163618
1043 Ga0307513_10008140
1044 Ga0307513_10009327
1045 Ga0307513_10359149
1046 Ga0307509_10007842
1047 Ga0307509_10012362
1048 Ga0307509_10028165
1049 Ga0307509_10038694
1050 Ga0307509_10054861
1051 Ga0307509_10435209
1052 Ga0307408_100077930
1053 Ga0307508_10000627
1054 Ga0307508_10045944
1055 Ga0307508_10059091
1056 Ga0307508_10059877
1057 Ga0307508_10075682
1058 Ga0307508_10201051
1059 Ga0307508_10328127
1060 Ga0307514_10002480
1061 Ga0307514_10123001
1062 Ga0307514_10350973
1063 Ga0307516_10001908
1064 Ga0307516_10019620
1065 Ga0307516_10030055
1066 Ga0307516_10324135
1067 Ga0307516_10537083
1068 Ga0307410_10033280
1069 Ga0307406_10265283
1070 Ga0307416_100462691
1071 Ga0307507_10024849
1072 Ga0307507_10026989
1073 Ga0307507_10116918
1074 Ga0307507_10178558
1075 Ga0307510_10004705
1076 Ga0307510_10025114
1077 Ga0307510_10034361
1078 Ga0307510_10069533
1079 Ga0307510_10078190
1080 Ga0307510_10299809
1081 Ga0373930_0001567
1082 Ga0373958_0000580
1083 Ga0373928_0000280
1084 Ga0373940_0001444
1085 Ga0373949_0002668
1086 Ga0373951_0005177
1087 Ga0373952_0003660
1088 Ga0373932_0001203
1089 Ga0373939_0001268
1090 Ga0373941_0000810
1091 Ga0373957_0131245
1092 Ga0373960_0004662
1093 Ga0373943_0103805
1094 Ga0373942_0012849
1095 Ga0373961_0004256
1096 Ga0373962_0002764
1097 Ga0373924_0068290
1098 Ga0373931_0058043
1099 Ga0373931_0192761
1100 Ga0373931_0215008
1101 Ga0373935_0141054
1102 Ga0373935_0587877
1103 Ga0373927_0039399
1104 Ga0373933_0045841
1105 Ga0373947_0105164
1106 Ga0373937_0018204
1107 Ga0373937_0541008
1108 Ga0373925_0200509
1109 Ga0373925_0613290
1110 Ga0395899_0115731
1111 Ga0395900_0232277
1112 Ga0436364_0459773
1113 Ga0436364_0737000
1114 Ga0436364_1034674
1115 Ga0436364_1494924
1116 Ga0395901_0246435
1117 Ga0395901_0551761
1118 Ga0436365_0073382
1119 Ga0436365_1794781
1120 Ga0436365_1804874
1121 Ga0436363_0715612
1122 Ga0436362_0399580
1123 Ga0436362_0406741
1124 Ga0439461_0159308
1125 Ga0451802_1201114
1126 Ga0439452_068361
1127 Ga0450902_026053
1128 Ga0439446_0027614
1129 Ga0439464_0047193
1130 Ga0439460_0079371
1131 Ga0451577_0062823
1132 Ga0451577_0436270
1133 Ga0466972_0000820
1134 Ga0453683_0100189
1135 Ga0466965_0002113
1136 Ga0466963_0116972
1137 Ga0466963_0506159
1138 Ga0466970_0005554
1139 Ga0466970_0120005
1140 Ga0466960_0001965
1141 Ga0466960_0011636
1142 Ga0466959_0200948
1143 Ga0451576_0146333
1144 Ga0451576_0279148
1145 Ga0466967_0885733
1146 Ga0466967_1307818
1147 Ga0495592_0003230
1148 Ga0495592_0117172
1149 Ga0495603_0006944
1150 Ga0495603_0153903
1151 Ga0495629_0008343
1152 Ga0495629_0008698
1153 Ga0495629_0010044
1154 Ga0495629_0053023
1155 Ga0495638_0332073
1156 Ga0495651_0000641
1157 Ga0495651_0005504
1158 Ga0495651_0051986
1159 Ga0495653_0000532
1160 Ga0495580_0137480
1161 Ga0495582_0011499
1162 Ga0495582_0188928
1163 Ga0495662_0000382
1164 Ga0495664_0001758
1165 Ga0495664_0343604
1166 Ga0495584_0021930
1167 Ga0495606_0030447
1168 Ga0495606_0082485
1169 Ga0495608_0004541
1170 Ga0495618_0009578
1171 Ga0495618_0036261
1172 Ga0495618_0619805
1173 Ga0495628_0027352
1174 Ga0495628_0170838
1175 Ga0495628_0500797
1176 Ga0495630_0004892
1177 Ga0495630_0103220
1178 Ga0495630_0233407
1179 Ga0495631_0215362
1180 Ga0495648_0028394
1181 Ga0495648_0121078
1182 Ga0495652_0001336
1183 Ga0495652_0009215
1184 Ga0495652_0026992
1185 Ga0495652_0111893
1186 Ga0495665_0103788
1187 Ga0495665_0473075
1188 Ga0495640_0189746
1189 Ga0495586_0132076
1190 Ga0495587_0000512
1191 Ga0495587_0062518
1192 Ga0495645_0004214
1193 Ga0495645_0074448
1194 Ga0495667_0001063
1195 Ga0495634_0001377
1196 Ga0495634_0007540
1197 Ga0495634_0074455
1198 Ga0495611_0016735
1199 Ga0495611_0135868
1200 Ga0495625_0034416
1201 Ga0495635_0000455
1202 Ga0495635_0001032
1203 Ga0495635_0008433
1204 Ga0495635_0728454
1205 Ga0495661_0160153
1206 Ga0495588_0177286
1207 Ga0495657_0000556
1208 Ga0495657_0006059
1209 Ga0495599_0000308
1210 Ga0495599_0231636
1211 Ga0495623_0000694
1212 Ga0495623_0250247
1213 Ga0495623_0294993
1214 Ga0495646_0003088
1215 Ga0495646_0061235
1216 Ga0495646_0066491
1217 Ga0495647_0334442
1218 Ga0495658_0004671
1219 Ga0495658_0074852
1220 Ga0495658_0414639
1221 Ga0495669_0000684
1222 Ga0495613_0001129
1223 Ga0495613_0003840
1224 Ga0495613_0076432
1225 Ga0495613_0243399
1226 Ga0495624_0070725
1227 Ga0495670_0042134
1228 Ga0495671_0028098
1229 Ga0495671_0089728
1230 Ga0495589_0040052
1231 Ga0495600_0002183
1232 Ga0495581_0023636
1233 Ga0495581_0316848
1234 Ga0495604_0000213
1235 Ga0495604_0002124
1236 Ga0495636_0000883
1237 Ga0495636_0096107
1238 Ga0495674_0011928
1239 Ga0495674_0137770
1240 Ga0495672_0027939
1241 Ga0495672_0116323
1242 Ga0495676_0000413
1243 Ga0495676_0012477
1244 Ga0495676_0013907
1245 Ga0495687_003190
1246 Ga0495687_004123
1247 Ga0495687_017067
1248 Ga0495675_0001609
1249 Ga0495677_0149711
1250 Ga0495685_003174
1251 Ga0495685_064440
1252 Ga0495673_0001012
1253 Ga0495681_0006963
1254 Ga0495684_0000903
1255 Ga0495686_0100409
1256 Ga0495593_0001416
1257 Ga0495593_0139624
1258 Ga0495593_0462388
1259 Ga0495602_0001348
1260 Ga0495602_0028433
1261 Ga0495614_0000735
1262 Ga0495614_0116982
1263 Ga0496100_0219890
1264 Ga0496102_0025311
1265 Ga0496102_0073457
1266 Ga0496103_0186610
1267 Ga0496104_0005007
1268 Ga0496104_0110184
1269 Ga0496104_0143428
1270 Ga0496105_0028661
1271 Ga0496105_0235737
1272 Ga0496105_0323321
1273 Ga0496106_0008827
1274 Ga0496106_0042912
1275 Ga0496106_0060164
1276 Ga0496106_0278104
1277 Ga0496107_0014180
1278 Ga0496107_0021859
1279 Ga0496107_0163846
1280 Ga0496108_0001304
1281 Ga0496108_0073389
1282 Ga0496108_0092467
1283 Ga0496108_0714523
1284 Ga0496109_0003457
1285 Ga0496109_0005799
1286 Ga0496109_0013836
1287 Ga0496110_0009849
1288 Ga0496110_0056983
1289 Ga0496112_0003458
1290 Ga0496112_0036812
1291 Ga0496113_0067309
1292 Ga0496113_0081135
1293 Ga0496114_0248171
1294 Ga0496115_0030116
1295 Ga0496115_0409242
1296 Ga0496117_0046970
1297 Ga0496118_0008644
1298 Ga0496119_0124966
1299 Ga0496121_0000668
1300 Ga0496124_0000955
1301 Ga0496124_0824984
1302 Ga0496125_0015321
1303 Ga0496125_0459411
1304 Ga0496126_0007074
1305 Ga0496126_0294409
1306 Ga0496126_0463440
1307 Ga0501033_0009826
1308 Ga0501034_0038412
1309 Ga0501036_0011904
1310 Ga0501036_0526581
1311 Ga0501037_0053217
1312 Ga0501038_0003213
1313 Ga0501038_0246682
1314 Ga0501038_0347854
1315 Ga0501039_0001002
1316 Ga0501040_0000976
1317 Ga0501040_0193357
1318 Ga0501041_0000633
1319 Ga0501041_0150905
1320 Ga0501042_0000928
1321 Ga0501043_0025356
1322 Ga0501046_0002250
1323 Ga0501046_0407735
1324 Ga0501047_0003179
1325 Ga0501047_0013145
1326 Ga0501047_0233904
1327 Ga0501048_0001788
1328 Ga0501048_0198836
1329 Ga0501067_0410490
1330 Ga0501068_0009389
1331 Ga0501069_0055980
1332 Ga0501069_0318971
1333 Ga0501070_0058039
1334 Ga0501070_0742791
1335 Ga0501071_0000518
1336 Ga0501072_0004996
1337 Ga0501073_0066103
1338 Ga0501073_0617820
1339 Ga0501074_0049015
1340 Ga0501074_0392050
1341 Ga0501075_0004425
1342 Ga0501076_0021850
1343 Ga0501077_0000169
1344 Ga0501079_0001306
1345 Ga0501079_0352451
1346 Ga0501079_0462559
1347 Ga0501080_0005909
1348 Ga0501080_0449665
1349 Ga0501081_0000045
1350 Ga0501083_0019006
1351 Ga0501035_0018417
1352 Ga0501035_0330881
1353 Ga0501035_0499727
1354 Ga0501044_0019766
1355 Ga0501044_0039232
1356 Ga0501044_0104244
1357 Ga0501044_0303115
1358 Ga0501044_1104406
1359 Ga0501045_0001264
1360 Ga0501045_0095507
1361 nmdc:mga03n38_823490_c1
1362 nmdc:mga00v17_722887_c1
1363 nmdc:mga0yw44_163548_c1
1364 nmdc:mga0yw44_29605_c1
1365 nmdc:mga06z11_7499_c1
1366 nmdc:mga05p37_128369_c1
1367 nmdc:mga05p37_20494_c1
1368 nmdc:mga05p37_470153_c1
1369 nmdc:mga0qj67_310234_c1
1370 nmdc:mga06r32_1311537_c1
1371 nmdc:mga08y16_13298_c1
1372 nmdc:mga08y16_40442_c1
1373 nmdc:mga0n895_102785_c1
1374 nmdc:mga0n895_2166187_c1
1375 nmdc:mga0n895_240225_c1
1376 nmdc:mga0rr50_1032947_c1
1377 nmdc:mga0rr50_1119532_c1
1378 nmdc:mga0rr50_412937_c1
1379 nmdc:mga0rr50_57431_c1
1380 nmdc:mga08x19_76577_c1
1381 nmdc:mga08x19_826620_c1
1382 nmdc:mga08x19_87379_c1
1383 nmdc:mga0a205_277738_c1
1384 nmdc:mga0a205_95019_c1
1385 Ga0495601_0015103
1386 Ga0495601_0048787
1387 Ga0495601_0065794
1388 Ga0495612_0003965
1389 Ga0495612_0011152
1390 Ga0495612_0332280
1391 Ga0495619_0082153
1392 Ga0495619_0131409
1393 Ga0500644_0014454
1394 Ga0500644_0020409
1395 Ga0500646_0047703
1396 Ga0500651_0046293
1397 Ga0500651_0081699
1398 Ga0500566_0030101
1399 Ga0500566_0169412
1400 Ga0500640_018152
1401 Ga0500650_0019758
1402 Ga0500553_016785
1403 Ga0500560_013422
1404 Ga0500562_003500
1405 Ga0500569_054976
1406 Ga0500572_001959
1407 Ga0500572_118274
1408 Ga0500580_178402
1409 Ga0500594_0006611
1410 Ga0500595_004573
1411 Ga0500608_048785
1412 Ga0500614_021406
1413 Ga0500652_152031
1414 Ga0500559_0000427
1415 Ga0500564_185064
1416 Ga0500568_0047011
1417 Ga0500573_0042003
1418 Ga0500586_224923
1419 Ga0500616_0016185
1420 Ga0500616_0146432
1421 Ga0500622_0298318
1422 Ga0500624_003453
1423 Ga0500638_235590
1424 Ga0500636_0289670
1425 Ga0500637_0212565
1426 Ga0500570_121204
1427 Ga0500656_035974
1428 Ga0500552_060677
1429 Ga0500596_003877
1430 Ga0500596_003879
1431 Ga0501084_0006845
1432 Ga0501082_0001888
1433 Ga0501082_0546710
1434 Ga0466962_0225772
1435 Ga0530510_0005780
1436 Ga0530510_0673698
1437 8054166577
1438 2545675814
1439 2573036749
1440 2578335951
1441 2580931093
1442 2621274124
1443 2793980625
1444 2884701163
1445 2895442947
1446 2902793556
1447 2971514666
1448 2980180774
1449 8045867076
1450 8047901262
1451 8048135654
1452 8048357638
1453 8048378202
1454 8048387300
1455 8054476203
1456 8055173998

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

111

186

0.92

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

23

96

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9785 3 155
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9726 2 158
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.97 5 157
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9668 5 158
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9616 4 157
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.98 4 79 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.978 81 155 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9755 2 77 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9713 81 155 1.10.150.120
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9645 5 79 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A538BUE3-F1-model_v4 (2Fe-2S)-binding protein 0.9897 5 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A382DVF0-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9882 4 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V7DLF2-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9881 5 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A0K3BKV8-F1-model_v4 Carbon monoxide dehydrogenase small chain (EC 1.2.99.2) 0.9869 5 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A537LNC3-F1-model_v4 (2Fe-2S)-binding protein 0.9863 4 155 GO:0016491
GO:0046872
GO:0051537

Map