F477810

General Info

Members Datasets Scaffolds Average Seq Length
728 348 1456 112

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100168265|Ga0307409_1001682651
Length 130
Sequence MTQQDDSLRFPSTETLAMNQTTLLVTTTPGFEGRRIVAYKGLVGGDAILGANMFRDFFAGIRDILGGRSGSYEKVLRTAKNEAVNDMLEQARELGANAVVGVDLDYETIQIQDGGSMLMVSASGTAVVIE

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
99 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
100 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
101 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
102 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
103 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
104 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
105 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
106 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
217 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
218 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
219 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
222 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
223 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
253 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
254 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
255 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
256 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
257 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
258 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
261 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
262 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
263 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
264 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
325 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
326 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
327 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 3.71
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 14.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100168265 3300031995 Bacteria 1926
2 MRS1b_contig_5891132 2162886011 Bacteria 1163
3 rootL2_10064053 3300003322 Bacteria 3264
4 rootL2_10064441 3300003322 Bacteria 4266
5 rootL2_10230110 3300003322 Bacteria 1543
6 JGI26145J50221_1005218 3300003371 Bacteria 1065
7 JGI25405J52794_10165020 3300003911 Unclassified 507
8 Ga0065712_10093411 3300005290 Bacteria 2293
9 Ga0065712_10274287 3300005290 Unclassified 909
10 Ga0065712_10359182 3300005290 Unclassified 777
11 Ga0065715_10413905 3300005293 Bacteria 866
12 Ga0065715_10971370 3300005293 Unclassified 553
13 Ga0065707_10009664 3300005295 Bacteria 2293
14 Ga0070676_10246130 3300005328 Bacteria 1191
15 Ga0070676_10434938 3300005328 Bacteria 919
16 Ga0070690_100000516 3300005330 Bacteria 19334
17 Ga0070690_100628549 3300005330 Bacteria 818
18 Ga0070670_100111976 3300005331 Bacteria 2352
19 Ga0070670_100536599 3300005331 Bacteria 1043
20 Ga0070670_100823029 3300005331 Bacteria 839
21 Ga0070677_10360058 3300005333 Bacteria 756
22 Ga0068869_101824235 3300005334 Bacteria 544
23 Ga0068869_101847774 3300005334 Bacteria 541
24 Ga0070666_10001681 3300005335 Bacteria 13496
25 Ga0070666_10105949 3300005335 Bacteria 1942
26 Ga0070666_10185709 3300005335 Bacteria 1459
27 Ga0070680_100049152 3300005336 Bacteria 3438
28 Ga0070680_101193371 3300005336 Bacteria 658
29 Ga0068868_100003580 3300005338 Bacteria 10824
30 Ga0068868_100029610 3300005338 Bacteria 4193
31 Ga0068868_100180696 3300005338 Bacteria 1750
32 Ga0068868_100829647 3300005338 Bacteria 836
33 Ga0068868_101447318 3300005338 Unclassified 642
34 Ga0070660_101641818 3300005339 Bacteria 547
35 Ga0070689_100046005 3300005340 Bacteria 3362
36 Ga0070689_100220341 3300005340 Bacteria 1556
37 Ga0070689_100597173 3300005340 Unclassified 956
38 Ga0070689_101033997 3300005340 Unclassified 732
39 Ga0070691_11102036 3300005341 Bacteria 500
40 Ga0070687_100200219 3300005343 Bacteria 1209
41 Ga0070687_100290054 3300005343 Bacteria 1034
42 Ga0070687_100748079 3300005343 Bacteria 687
43 Ga0070661_100281967 3300005344 Bacteria 1289
44 Ga0070668_102224461 3300005347 Unclassified 507
45 Ga0070669_100259003 3300005353 Bacteria 1387
46 Ga0070669_101509705 3300005353 Bacteria 584
47 Ga0070669_101878234 3300005353 Unclassified 523
48 Ga0070675_100055666 3300005354 Bacteria 3256
49 Ga0070675_100111127 3300005354 Bacteria 2319
50 Ga0070675_100347844 3300005354 Bacteria 1314
51 Ga0070671_100006931 3300005355 Bacteria 9076
52 Ga0070671_100009274 3300005355 Bacteria 7905
53 Ga0070671_100301837 3300005355 Bacteria 1363
54 Ga0070671_100635723 3300005355 Bacteria 923
55 Ga0070671_101454649 3300005355 Unclassified 606
56 Ga0070671_101832908 3300005355 Unclassified 539
57 Ga0070674_100149245 3300005356 Bacteria 1762
58 Ga0070673_100013948 3300005364 Bacteria 5580
59 Ga0070673_100014509 3300005364 Bacteria 5492
60 Ga0070673_100936681 3300005364 Bacteria 804
61 Ga0070688_100000819 3300005365 Bacteria 15366
62 Ga0070688_100372586 3300005365 Unclassified 1051
63 Ga0070659_100231485 3300005366 Bacteria 1527
64 Ga0070659_100293618 3300005366 Bacteria 1354
65 Ga0070667_100007431 3300005367 Bacteria 9102
66 Ga0070667_100066362 3300005367 Bacteria 3066
67 Ga0070667_100246302 3300005367 Bacteria 1597
68 Ga0070667_100783177 3300005367 Bacteria 885
69 Ga0070667_101029839 3300005367 Unclassified 768
70 Ga0070709_10043077 3300005434 Bacteria 2790
71 Ga0070709_10566341 3300005434 Bacteria 871
72 Ga0070714_100127254 3300005435 Bacteria 2273
73 Ga0070714_100827967 3300005435 Bacteria 897
74 Ga0070713_100006824 3300005436 Bacteria 7955
75 Ga0070701_10011118 3300005438 Bacteria 4009
76 Ga0070711_100005887 3300005439 Bacteria 7359
77 Ga0070708_100011856 3300005445 Bacteria 7095
78 Ga0070663_100742954 3300005455 Bacteria 837
79 Ga0070678_100009236 3300005456 Bacteria 5959
80 Ga0070678_100057544 3300005456 Bacteria 2849
81 Ga0070662_101277123 3300005457 Bacteria 632
82 Ga0070662_101826510 3300005457 Unclassified 525
83 Ga0070681_10004606 3300005458 Bacteria 13167
84 Ga0070681_12030661 3300005458 Bacteria 503
85 Ga0068867_100075919 3300005459 Bacteria 2522
86 Ga0068867_100117888 3300005459 Bacteria 2047
87 Ga0070685_10002365 3300005466 Bacteria 9706
88 Ga0070685_11252917 3300005466 Unclassified 565
89 Ga0070698_101831005 3300005471 Bacteria 560
90 Ga0070698_102074673 3300005471 Bacteria 522
91 Ga0070699_100059310 3300005518 Bacteria 3315
92 Ga0070679_100031838 3300005530 Bacteria 5215
93 Ga0070684_100031758 3300005535 Bacteria 4498
94 Ga0070697_100019047 3300005536 Bacteria 5416
95 Ga0068853_100408266 3300005539 Bacteria 1272
96 Ga0070672_100060976 3300005543 Bacteria 2972
97 Ga0070686_100027591 3300005544 Bacteria 3437
98 Ga0070686_100205185 3300005544 Bacteria 1415
99 Ga0070696_101439768 3300005546 Unclassified 588
100 Ga0070665_100005472 3300005548 Bacteria 13090
101 Ga0070665_100015179 3300005548 Bacteria 7734
102 Ga0070665_100074248 3300005548 Bacteria 3406
103 Ga0070665_102399432 3300005548 Bacteria 530
104 Ga0070704_100368040 3300005549 Bacteria 1218
105 Ga0068855_100026941 3300005563 Bacteria 6878
106 Ga0068855_100379210 3300005563 Bacteria 1553
107 Ga0068855_100993759 3300005563 Bacteria 882
108 Ga0070664_100248893 3300005564 Bacteria 1597
109 Ga0070664_100612371 3300005564 Unclassified 1010
110 Ga0070664_102391434 3300005564 Unclassified 501
111 Ga0068857_100750115 3300005577 Bacteria 930
112 Ga0068857_101438079 3300005577 Bacteria 671
113 Ga0068857_102268049 3300005577 Bacteria 533
114 Ga0068854_100710898 3300005578 Bacteria 868
115 Ga0068854_102110602 3300005578 Unclassified 520
116 Ga0068856_100002370 3300005614 Bacteria 19385
117 Ga0068856_100023886 3300005614 Bacteria 5946
118 Ga0068856_100305770 3300005614 Bacteria 1608
119 Ga0068859_100005806 3300005617 Bacteria 12533
120 Ga0068859_100732075 3300005617 Bacteria 1079
121 Ga0068859_100817256 3300005617 Bacteria 1019
122 Ga0068859_100895947 3300005617 Unclassified 972
123 Ga0068864_100075511 3300005618 Bacteria 2943
124 Ga0068864_100084525 3300005618 Bacteria 2788
125 Ga0068864_100219451 3300005618 Bacteria 1754
126 Ga0068866_10083423 3300005718 Bacteria 1722
127 Ga0068866_10141487 3300005718 Bacteria 1381
128 Ga0068866_10689961 3300005718 Unclassified 699
129 Ga0068861_100899174 3300005719 Bacteria 838
130 Ga0068861_101217083 3300005719 Bacteria 729
131 Ga0068861_101241787 3300005719 Bacteria 722
132 Ga0068861_101625451 3300005719 Bacteria 637
133 Ga0068851_10315068 3300005834 Viruses 902
134 Ga0068863_100001296 3300005841 Bacteria 24957
135 Ga0068863_100523374 3300005841 Bacteria 1169
136 Ga0068863_101570421 3300005841 Bacteria 667
137 Ga0068858_100008408 3300005842 Bacteria 9927
138 Ga0068858_100010553 3300005842 Bacteria 8748
139 Ga0068858_100089745 3300005842 Bacteria 2860
140 Ga0068858_100257286 3300005842 Unclassified 1659
141 Ga0068858_100686554 3300005842 Unclassified 996
142 Ga0068858_102287806 3300005842 Bacteria 534
143 Ga0068860_100000390 3300005843 Bacteria 57357
144 Ga0068860_100018934 3300005843 Bacteria 6689
145 Ga0068860_100242081 3300005843 Bacteria 1755
146 Ga0068860_100783814 3300005843 Bacteria 966
147 Ga0068860_101650551 3300005843 Unclassified 663
148 Ga0068860_101973249 3300005843 Unclassified 605
149 Ga0068862_100891965 3300005844 Bacteria 874
150 Ga0081455_10002344 3300005937 Bacteria 22600
151 Ga0081538_10006794 3300005981 Bacteria 9990
152 Ga0070715_10001133 3300006163 Bacteria 7603
153 Ga0070716_101587548 3300006173 Unclassified 537
154 Ga0070712_100014503 3300006175 Bacteria 5057
155 Ga0097621_100040474 3300006237 Bacteria 3747
156 Ga0097621_100075023 3300006237 Bacteria 2802
157 Ga0097621_100114299 3300006237 Bacteria 2283
158 Ga0097621_100162726 3300006237 Bacteria 1919
159 Ga0075370_10781556 3300006353 Bacteria 582
160 Ga0075370_10960425 3300006353 Bacteria 523
161 Ga0068871_100014293 3300006358 Bacteria 5914
162 Ga0068871_100015488 3300006358 Bacteria 5709
163 Ga0068871_100061798 3300006358 Bacteria 3060
164 Ga0068871_100078403 3300006358 Bacteria 2732
165 Ga0068871_100175835 3300006358 Bacteria 1838
166 Ga0075430_100177904 3300006846 Bacteria 1770
167 Ga0075430_101237783 3300006846 Unclassified 614
168 Ga0075433_10164974 3300006852 Bacteria 1972
169 Ga0075434_100058324 3300006871 Bacteria 3837
170 Ga0075434_100080813 3300006871 Bacteria 3248
171 Ga0075434_100190555 3300006871 Bacteria 2071
172 Ga0075434_100274748 3300006871 Bacteria 1704
173 Ga0075434_100520995 3300006871 Unclassified 1209
174 Ga0075434_100880047 3300006871 Bacteria 911
175 Ga0075429_100272305 3300006880 Bacteria 1483
176 Ga0075429_100911488 3300006880 Bacteria 769
177 Ga0068865_100033606 3300006881 Bacteria 3435
178 Ga0075436_100112634 3300006914 Unclassified 1900
179 Ga0097620_100005807 3300006931 Bacteria 12533
180 Ga0097620_100732022 3300006931 Bacteria 1079
181 Ga0097620_100817365 3300006931 Bacteria 1019
182 Ga0097620_100895866 3300006931 Unclassified 972
183 Ga0075435_100315030 3300007076 Bacteria 1339
184 Ga0075435_100617896 3300007076 Unclassified 940
185 Ga0075435_100925251 3300007076 Bacteria 761
186 Ga0105240_10078990 3300009093 Unclassified 4051
187 Ga0105240_11763950 3300009093 Bacteria 645
188 Ga0111539_10005315 3300009094 Bacteria 16664
189 Ga0111539_10407566 3300009094 Bacteria 1583
190 Ga0111539_10695993 3300009094 Bacteria 1183
191 Ga0105245_10016068 3300009098 Bacteria 6521
192 Ga0105245_10253204 3300009098 Bacteria 1711
193 Ga0105245_10556488 3300009098 Unclassified 1169
194 Ga0105245_11520275 3300009098 Unclassified 720
195 Ga0105247_10020979 3300009101 Bacteria 3931
196 Ga0105247_10082401 3300009101 Bacteria 2030
197 Ga0114129_10119677 3300009147 Bacteria 3627
198 Ga0114129_10633755 3300009147 Bacteria 1381
199 Ga0114129_11386929 3300009147 Bacteria 868
200 Ga0114129_12952591 3300009147 Bacteria 561
201 Ga0105241_10207093 3300009174 Bacteria 1642
202 Ga0105241_10379978 3300009174 Bacteria 1234
203 Ga0105241_11832338 3300009174 Unclassified 593
204 Ga0105242_10002472 3300009176 Bacteria 14501
205 Ga0105242_11032023 3300009176 Unclassified 832
206 Ga0105242_11854032 3300009176 Bacteria 642
207 Ga0105248_10072646 3300009177 Bacteria 3866
208 Ga0105248_10986184 3300009177 Bacteria 952
209 Ga0105248_11540498 3300009177 Unclassified 753
210 Ga0105248_12444653 3300009177 Unclassified 595
211 Ga0105237_10015533 3300009545 Bacteria 7921
212 Ga0105237_10340849 3300009545 Bacteria 1503
213 Ga0105237_10485947 3300009545 Bacteria 1241
214 Ga0105238_10122070 3300009551 Bacteria 2585
215 Ga0105249_12104915 3300009553 Bacteria 637
216 Ga0105148_115829 3300009978 Bacteria 594
217 Ga0105239_10180959 3300010375 Bacteria 2359
218 Ga0105239_12785614 3300010375 Bacteria 571
219 Ga0105246_10096369 3300011119 Viruses 2144
220 Ga0157318_1002190 3300012482 Bacteria 1044
221 Ga0157325_1014651 3300012485 Unclassified 632
222 Ga0157321_1007980 3300012487 Bacteria 757
223 Ga0157314_1057619 3300012500 Bacteria 513
224 Ga0157313_1044166 3300012503 Bacteria 558
225 Ga0157342_1037372 3300012507 Bacteria 637
226 Ga0157315_1019449 3300012508 Bacteria 704
227 Ga0157316_1001016 3300012510 Bacteria 1639
228 Ga0157327_1004493 3300012512 Bacteria 1083
229 Ga0157326_1031776 3300012513 Bacteria 702
230 Ga0157373_10288093 3300013100 Bacteria 1165
231 Ga0157373_10399488 3300013100 Bacteria 985
232 Ga0157373_10574185 3300013100 Bacteria 819
233 Ga0157371_10320391 3300013102 Bacteria 1125
234 Ga0157370_10134194 3300013104 Bacteria 2308
235 Ga0157370_10948774 3300013104 Bacteria 780
236 Ga0157369_10236246 3300013105 Bacteria 1910
237 Ga0157374_10012012 3300013296 Bacteria 7520
238 Ga0157374_11100681 3300013296 Bacteria 815
239 Ga0157374_11310013 3300013296 Bacteria 746
240 Ga0157378_10004796 3300013297 Bacteria 11852
241 Ga0157378_10005883 3300013297 Bacteria 10744
242 Ga0157378_10247494 3300013297 Bacteria 1705
243 Ga0163162_10001742 3300013306 Bacteria 20414
244 Ga0163162_10387747 3300013306 Bacteria 1530
245 Ga0163162_10899541 3300013306 Bacteria 998
246 Ga0163162_12482702 3300013306 Bacteria 596
247 Ga0157372_10364305 3300013307 Bacteria 1684
248 Ga0157372_10506486 3300013307 Bacteria 1408
249 Ga0157372_11388288 3300013307 Bacteria 810
250 Ga0157372_11413084 3300013307 Bacteria 802
251 Ga0157375_10007022 3300013308 Bacteria 9835
252 Ga0157375_10050611 3300013308 Bacteria 4075
253 Ga0157375_10949391 3300013308 Bacteria 1002
254 Ga0157375_11347595 3300013308 Unclassified 840
255 Ga0157375_11816583 3300013308 Bacteria 723
256 Ga0163163_10002094 3300014325 Bacteria 16852
257 Ga0163163_10103889 3300014325 Bacteria 2866
258 Ga0163163_12799252 3300014325 Bacteria 544
259 Ga0157380_10169590 3300014326 Bacteria 1905
260 Ga0157380_11239836 3300014326 Bacteria 791
261 Ga0157377_10948706 3300014745 Unclassified 647
262 Ga0157379_10010776 3300014968 Bacteria 7968
263 Ga0157379_10020339 3300014968 Bacteria 5868
264 Ga0157376_10002651 3300014969 Bacteria 12174
265 Ga0157376_10784520 3300014969 Bacteria 964
266 Ga0163161_10715200 3300017792 Bacteria 835
267 Ga0163161_10730839 3300017792 Bacteria 826
268 Ga0207697_10027261 3300025315 Bacteria 2336
269 Ga0207656_10173391 3300025321 Bacteria 1032
270 Ga0207682_10044417 3300025893 Bacteria 1822
271 Ga0207682_10213547 3300025893 Bacteria 891
272 Ga0207692_10076339 3300025898 Unclassified 1780
273 Ga0207642_10124716 3300025899 Bacteria 1334
274 Ga0207642_10461478 3300025899 Bacteria 771
275 Ga0207710_10065975 3300025900 Bacteria 1651
276 Ga0207710_10212835 3300025900 Bacteria 957
277 Ga0207710_10312128 3300025900 Bacteria 796
278 Ga0207688_10442135 3300025901 Bacteria 810
279 Ga0207680_10010109 3300025903 Bacteria 4709
280 Ga0207680_10090989 3300025903 Unclassified 1941
281 Ga0207680_10102475 3300025903 Bacteria 1841
282 Ga0207680_10127141 3300025903 Unclassified 1675
283 Ga0207680_10157855 3300025903 Bacteria 1518
284 Ga0207699_10026728 3300025906 Bacteria 3186
285 Ga0207699_10365963 3300025906 Bacteria 1021
286 Ga0207645_10068918 3300025907 Bacteria 2262
287 Ga0207645_10217747 3300025907 Bacteria 1258
288 Ga0207643_10014677 3300025908 Bacteria 4259
289 Ga0207654_10234466 3300025911 Bacteria 1224
290 Ga0207654_10275643 3300025911 Bacteria 1136
291 Ga0207707_10004319 3300025912 Bacteria 12584
292 Ga0207707_10513056 3300025912 Bacteria 1021
293 Ga0207707_11436179 3300025912 Bacteria 549
294 Ga0207695_11067866 3300025913 Unclassified 687
295 Ga0207671_10283701 3300025914 Bacteria 1306
296 Ga0207693_10002141 3300025915 Bacteria 17224
297 Ga0207663_10020869 3300025916 Bacteria 3718
298 Ga0207662_10136554 3300025918 Unclassified 1550
299 Ga0207662_10206088 3300025918 Bacteria 1275
300 Ga0207662_10995133 3300025918 Bacteria 595
301 Ga0207657_10228332 3300025919 Bacteria 1489
302 Ga0207649_10029299 3300025920 Bacteria 3251
303 Ga0207652_10077355 3300025921 Bacteria 2903
304 Ga0207681_10042366 3300025923 Bacteria 3041
305 Ga0207681_10225720 3300025923 Unclassified 1451
306 Ga0207650_10067908 3300025925 Bacteria 2676
307 Ga0207650_10098250 3300025925 Bacteria 2249
308 Ga0207650_11603551 3300025925 Bacteria 552
309 Ga0207659_10064166 3300025926 Bacteria 2657
310 Ga0207659_10072571 3300025926 Unclassified 2517
311 Ga0207659_10161427 3300025926 Bacteria 1760
312 Ga0207687_10000151 3300025927 Bacteria 46396
313 Ga0207687_10037594 3300025927 Bacteria 3304
314 Ga0207687_10165003 3300025927 Bacteria 1703
315 Ga0207664_10076261 3300025929 Bacteria 2713
316 Ga0207644_10011998 3300025931 Bacteria 5745
317 Ga0207644_10052763 3300025931 Bacteria 2923
318 Ga0207644_10202961 3300025931 Bacteria 1564
319 Ga0207644_10459504 3300025931 Bacteria 1047
320 Ga0207644_10578125 3300025931 Bacteria 931
321 Ga0207644_11137706 3300025931 Bacteria 656
322 Ga0207644_11415014 3300025931 Unclassified 584
323 Ga0207690_10423384 3300025932 Bacteria 1066
324 Ga0207690_10501599 3300025932 Bacteria 982
325 Ga0207690_10825106 3300025932 Bacteria 767
326 Ga0207686_10188364 3300025934 Bacteria 1469
327 Ga0207670_10088288 3300025936 Bacteria 2186
328 Ga0207669_11297158 3300025937 Bacteria 618
329 Ga0207704_10025368 3300025938 Bacteria 3233
330 Ga0207704_10279643 3300025938 Bacteria 1268
331 Ga0207704_10761108 3300025938 Bacteria 806
332 Ga0207665_10108600 3300025939 Bacteria 1947
333 Ga0207691_10017956 3300025940 Bacteria 6702
334 Ga0207691_10083713 3300025940 Bacteria 2864
335 Ga0207691_10246109 3300025940 Bacteria 1545
336 Ga0207691_10375096 3300025940 Bacteria 1215
337 Ga0207691_11237675 3300025940 Unclassified 618
338 Ga0207711_10000206 3300025941 Bacteria 62928
339 Ga0207711_10459117 3300025941 Unclassified 1186
340 Ga0207711_10474343 3300025941 Bacteria 1165
341 Ga0207711_10973749 3300025941 Bacteria 787
342 Ga0207711_11292212 3300025941 Unclassified 672
343 Ga0207689_10077825 3300025942 Bacteria 2726
344 Ga0207689_10086647 3300025942 Bacteria 2574
345 Ga0207689_11565689 3300025942 Bacteria 549
346 Ga0207679_10047362 3300025945 Bacteria 3123
347 Ga0207679_10266107 3300025945 Unclassified 1464
348 Ga0207679_10308942 3300025945 Bacteria 1365
349 Ga0207667_10133835 3300025949 Bacteria 2553
350 Ga0207667_10524829 3300025949 Bacteria 1199
351 Ga0207667_10865259 3300025949 Bacteria 897
352 Ga0207667_12075362 3300025949 Unclassified 527
353 Ga0207651_10046729 3300025960 Unclassified 2914
354 Ga0207651_10064664 3300025960 Bacteria 2561
355 Ga0207651_10119793 3300025960 Bacteria 1994
356 Ga0207651_10622499 3300025960 Bacteria 945
357 Ga0207712_10571435 3300025961 Bacteria 975
358 Ga0207712_10768897 3300025961 Bacteria 845
359 Ga0207668_12023676 3300025972 Unclassified 519
360 Ga0207658_10004930 3300025986 Bacteria 9208
361 Ga0207658_10095734 3300025986 Unclassified 2314
362 Ga0207658_10236631 3300025986 Bacteria 1544
363 Ga0207658_10291118 3300025986 Bacteria 1403
364 Ga0207677_10000593 3300026023 Bacteria 22456
365 Ga0207677_10666869 3300026023 Bacteria 920
366 Ga0207677_10932736 3300026023 Unclassified 784
367 Ga0207677_11670419 3300026023 Bacteria 590
368 Ga0207703_10002219 3300026035 Bacteria 17046
369 Ga0207703_10874030 3300026035 Bacteria 860
370 Ga0207703_11413623 3300026035 Unclassified 669
371 Ga0207703_11869131 3300026035 Bacteria 577
372 Ga0207639_11338432 3300026041 Bacteria 672
373 Ga0207708_10116433 3300026075 Unclassified 2079
374 Ga0207708_11118649 3300026075 Unclassified 687
375 Ga0207702_10007617 3300026078 Bacteria 9216
376 Ga0207702_10025226 3300026078 Bacteria 4933
377 Ga0207702_10780088 3300026078 Bacteria 944
378 Ga0207641_10009189 3300026088 Bacteria 8157
379 Ga0207641_10042833 3300026088 Bacteria 3799
380 Ga0207641_10125567 3300026088 Bacteria 2297
381 Ga0207641_10208914 3300026088 Unclassified 1804
382 Ga0207648_10005103 3300026089 Bacteria 13302
383 Ga0207648_10073239 3300026089 Bacteria 2986
384 Ga0207648_10129857 3300026089 Bacteria 2218
385 Ga0207648_10151268 3300026089 Unclassified 2048
386 Ga0207648_10360408 3300026089 Unclassified 1312
387 Ga0207648_11780153 3300026089 Unclassified 578
388 Ga0207676_10007085 3300026095 Bacteria 7949
389 Ga0207676_10025626 3300026095 Bacteria 4377
390 Ga0207676_10050671 3300026095 Bacteria 3238
391 Ga0207676_10068049 3300026095 Bacteria 2847
392 Ga0207676_10198982 3300026095 Bacteria 1769
393 Ga0207676_10328742 3300026095 Bacteria 1406
394 Ga0207676_11774824 3300026095 Unclassified 615
395 Ga0207674_10491329 3300026116 Bacteria 1186
396 Ga0207674_11338152 3300026116 Bacteria 686
397 Ga0207675_100312084 3300026118 Bacteria 1534
398 Ga0207675_100348448 3300026118 Unclassified 1451
399 Ga0207675_100781973 3300026118 Bacteria 967
400 Ga0207675_100895787 3300026118 Bacteria 903
401 Ga0207675_102152678 3300026118 Bacteria 573
402 Ga0207675_102622943 3300026118 Bacteria 513
403 Ga0207683_10009256 3300026121 Bacteria 8392
404 Ga0207683_10010111 3300026121 Bacteria 8052
405 Ga0207683_10237833 3300026121 Bacteria 1661
406 Ga0207698_10277650 3300026142 Unclassified 1548
407 Ga0207698_10968302 3300026142 Bacteria 860
408 Ga0209969_1043390 3300027360 Unclassified 700
409 Ga0209981_1029372 3300027378 Unclassified 804
410 Ga0209982_1003785 3300027552 Bacteria 2159
411 Ga0209970_1021544 3300027614 Bacteria 1092
412 Ga0209970_1022801 3300027614 Bacteria 1064
413 Ga0209983_1000696 3300027665 Bacteria 7252
414 Ga0209983_1022897 3300027665 Bacteria 1311
415 Ga0209983_1052981 3300027665 Bacteria 889
416 Ga0209971_1014899 3300027682 Bacteria 1842
417 Ga0209971_1060280 3300027682 Bacteria 919
418 Ga0209966_1065740 3300027695 Bacteria 789
419 Ga0209974_10008521 3300027876 Bacteria 3503
420 Ga0209974_10016458 3300027876 Bacteria 2456
421 Ga0209974_10056227 3300027876 Bacteria 1328
422 Ga0207428_10009273 3300027907 Bacteria 8833
423 Ga0268266_10015750 3300028379 Bacteria 6475
424 Ga0268266_10073341 3300028379 Bacteria 2970
425 Ga0268266_10267300 3300028379 Unclassified 1587
426 Ga0268266_11669096 3300028379 Bacteria 612
427 Ga0268266_12135807 3300028379 Bacteria 532
428 Ga0268266_12203303 3300028379 Unclassified 523
429 Ga0268265_10222288 3300028380 Bacteria 1653
430 Ga0268265_10277965 3300028380 Bacteria 1497
431 Ga0268265_10294885 3300028380 Unclassified 1457
432 Ga0268265_10479547 3300028380 Bacteria 1168
433 Ga0268265_11534667 3300028380 Bacteria 670
434 Ga0268265_11683107 3300028380 Bacteria 640
435 Ga0268264_10000800 3300028381 Bacteria 33994
436 Ga0268264_10001344 3300028381 Bacteria 23085
437 Ga0268264_10233025 3300028381 Unclassified 1701
438 Ga0268264_10271521 3300028381 Bacteria 1584
439 Ga0265330_10000842 3300031235 Bacteria 19227
440 Ga0265332_10000088 3300031238 Bacteria 79927
441 Ga0265328_10003461 3300031239 Bacteria 6974
442 Ga0265325_10004358 3300031241 Bacteria 8959
443 Ga0265325_10018099 3300031241 Bacteria 3908
444 Ga0265329_10000265 3300031242 Bacteria 27486
445 Ga0265340_10184860 3300031247 Bacteria 941
446 Ga0265339_10065811 3300031249 Bacteria 1942
447 Ga0265331_10000540 3300031250 Bacteria 34613
448 Ga0265327_10002597 3300031251 Bacteria 18696
449 Ga0265316_10015397 3300031344 Bacteria 6687
450 Ga0265316_10242906 3300031344 Bacteria 1324
451 Ga0307408_100020090 3300031548 Bacteria 4502
452 Ga0307408_100760292 3300031548 Bacteria 876
453 Ga0316575_10007110 3300031665 Bacteria 4049
454 Ga0316575_10083564 3300031665 Unclassified 1289
455 Ga0265314_10009645 3300031711 Bacteria 8130
456 Ga0265342_10003320 3300031712 Bacteria 13284
457 Ga0316576_10058339 3300031727 Bacteria 2823
458 Ga0316576_11095217 3300031727 Unclassified 565
459 Ga0316578_10028503 3300031728 Bacteria 3162
460 Ga0316578_10508640 3300031728 Bacteria 709
461 Ga0307405_10026217 3300031731 Bacteria 3360
462 Ga0307405_10194688 3300031731 Bacteria 1467
463 Ga0307405_10324273 3300031731 Bacteria 1178
464 Ga0316577_10000916 3300031733 Bacteria 13061
465 Ga0316577_10156640 3300031733 Bacteria 1284
466 Ga0307413_10002787 3300031824 Bacteria 7200
467 Ga0307413_10010339 3300031824 Bacteria 4520
468 Ga0307413_10459603 3300031824 Bacteria 1012
469 Ga0307413_10708780 3300031824 Unclassified 837
470 Ga0307413_10826585 3300031824 Bacteria 781
471 Ga0307410_10036960 3300031852 Bacteria 3185
472 Ga0307410_10065109 3300031852 Bacteria 2507
473 Ga0307410_10201214 3300031852 Bacteria 1520
474 Ga0307410_10742520 3300031852 Bacteria 830
475 Ga0307410_10975953 3300031852 Bacteria 729
476 Ga0307406_10003101 3300031901 Bacteria 9034
477 Ga0307406_10004969 3300031901 Bacteria 7243
478 Ga0307406_10079646 3300031901 Bacteria 2173
479 Ga0307407_10000961 3300031903 Bacteria 9818
480 Ga0307407_10010193 3300031903 Bacteria 4419
481 Ga0307407_10013003 3300031903 Bacteria 4025
482 Ga0307407_10824894 3300031903 Unclassified 707
483 Ga0307407_10956824 3300031903 Bacteria 660
484 Ga0307412_10001626 3300031911 Bacteria 12384
485 Ga0307412_10108402 3300031911 Bacteria 1978
486 Ga0307412_10155126 3300031911 Bacteria 1694
487 Ga0307412_10370707 3300031911 Bacteria 1156
488 Ga0307409_100003141 3300031995 Bacteria 8876
489 Ga0307409_100030155 3300031995 Bacteria 3892
490 Ga0307409_100183452 3300031995 Bacteria 1855
491 Ga0307409_100645780 3300031995 Bacteria 1051
492 Ga0307409_100733692 3300031995 Unclassified 990
493 Ga0307409_101789882 3300031995 Bacteria 643
494 Ga0307416_100001853 3300032002 Bacteria 11799
495 Ga0307416_100238432 3300032002 Bacteria 1760
496 Ga0307416_100325506 3300032002 Unclassified 1542
497 Ga0307416_100844630 3300032002 Bacteria 1013
498 Ga0307416_103376166 3300032002 Bacteria 534
499 Ga0307414_10016576 3300032004 Bacteria 4482
500 Ga0307414_10017956 3300032004 Bacteria 4339
501 Ga0307414_10043499 3300032004 Bacteria 3060
502 Ga0307414_10052310 3300032004 Bacteria 2841
503 Ga0307414_10732401 3300032004 Bacteria 897
504 Ga0307414_10814134 3300032004 Bacteria 852
505 Ga0307414_11190299 3300032004 Bacteria 705
506 Ga0307414_11705652 3300032004 Bacteria 587
507 Ga0307411_10002891 3300032005 Bacteria 7769
508 Ga0307411_10005640 3300032005 Bacteria 6173
509 Ga0307411_10013367 3300032005 Bacteria 4528
510 Ga0307411_10081316 3300032005 Bacteria 2231
511 Ga0307411_10106029 3300032005 Bacteria 1999
512 Ga0307411_10430100 3300032005 Bacteria 1099
513 Ga0307411_10573218 3300032005 Bacteria 966
514 Ga0307411_11723487 3300032005 Bacteria 580
515 Ga0307415_100113238 3300032126 Bacteria 2017
516 Ga0307415_100757214 3300032126 Bacteria 882
517 Ga0307415_100894951 3300032126 Bacteria 818
518 Ga0316583_10033442 3300032133 Bacteria 1826
519 Ga0316585_10002589 3300032137 Bacteria 4895
520 Ga0316580_10001132 3300032139 Bacteria 6739
521 Ga0316593_10140095 3300032168 Bacteria 876
522 Ga0307507_10532842 3300033179 Unclassified 624
523 Ga0373958_0137887 3300034819 Bacteria 602
524 Ga0373959_0118981 3300034820 Unclassified 644
525 Ga0373928_0256173 3300035084 Bacteria 523
526 Ga0373934_0349837 3300035086 Unclassified 615
527 Ga0373923_0002412 3300035111 Bacteria 5747
528 Ga0373923_0468114 3300035111 Unclassified 612
529 Ga0373939_0101603 3300035114 Bacteria 988
530 Ga0373945_0083943 3300035116 Bacteria 1224
531 Ga0373953_0125138 3300035117 Bacteria 1093
532 Ga0373954_0052544 3300035118 Viruses 1914
533 Ga0373954_0282627 3300035118 Bacteria 818
534 Ga0373956_0150443 3300035119 Bacteria 1095
535 Ga0373956_0377771 3300035119 Unclassified 676
536 Ga0373957_0522623 3300035120 Unclassified 518
537 Ga0373943_0047177 3300035170 Unclassified 2105
538 Ga0373946_0025559 3300035171 Viruses 2323
539 Ga0373946_0319413 3300035171 Unclassified 771
540 Ga0373955_0106482 3300035172 Viruses 1616
541 Ga0316574_0032794 3300035398 Bacteria 3158
542 Ga0316574_0162987 3300035398 Bacteria 1436
543 Ga0316574_0328171 3300035398 Bacteria 970
544 Ga0373924_0114523 3300035410 Bacteria 1167
545 Ga0373931_0059045 3300035691 Bacteria 2062
546 Ga0373935_0320044 3300035692 Bacteria 1100
547 Ga0373935_1503479 3300035692 Bacteria 504
548 Ga0373927_0103378 3300035695 Viruses 1854
549 Ga0373933_0005726 3300035724 Bacteria 6758
550 Ga0373933_0206886 3300035724 Bacteria 1257
551 Ga0373933_0434901 3300035724 Unclassified 857
552 Ga0373947_0146772 3300035725 Unclassified 1517
553 Ga0373947_0168330 3300035725 Bacteria 1421
554 Ga0373937_0040496 3300036401 Bacteria 4247
555 Ga0373937_0082990 3300036401 Bacteria 2965
556 Ga0373937_0453015 3300036401 Bacteria 1218
557 Ga0316582_0004398 3300036647 Bacteria 7113
558 Ga0316582_0008248 3300036647 Bacteria 5587
559 Ga0316584_0000929 3300036712 Bacteria 16669
560 Ga0316584_0015883 3300036712 Bacteria 5393
561 Ga0373925_0092505 3300037068 Bacteria 2313
562 Ga0395899_0019444 3300037312 Bacteria 5159
563 Ga0395900_0018823 3300037418 Bacteria 7043
564 Ga0395898_0081576 3300037466 Bacteria 3118
565 Ga0395898_0259688 3300037466 Bacteria 1657
566 Ga0395905_0004974 3300037471 Bacteria 13689
567 Ga0395905_0117959 3300037471 Bacteria 2494
568 Ga0395905_0187153 3300037471 Bacteria 1943
569 Ga0395905_0296459 3300037471 Bacteria 1504
570 Ga0395905_0317728 3300037471 Bacteria 1447
571 Ga0395905_0392122 3300037471 Bacteria 1283
572 Ga0395905_0536585 3300037471 Bacteria 1071
573 Ga0436364_0467815 3300037853 Unclassified 576
574 Ga0395901_0036036 3300038443 Bacteria 5112
575 Ga0395901_0604955 3300038443 Bacteria 1105
576 Ga0400484_14457 3300038725 Bacteria 3683
577 Ga0400490_47817 3300038726 Unclassified 3233
578 Ga0400485_00302 3300038735 Bacteria 7510
579 Ga0400485_20750 3300038735 Bacteria 4494
580 Ga0400488_14303 3300038741 Bacteria 2004
581 Ga0400488_20652 3300038741 Bacteria 12796
582 Ga0400488_31409 3300038741 Bacteria 1281
583 Ga0400488_57505 3300038741 Unclassified 1154
584 Ga0400486_03767 3300038742 Bacteria 25589
585 Ga0400483_020095 3300039062 Bacteria 4283
586 Ga0400483_137089 3300039062 Bacteria 41294
587 Ga0400487_17869 3300039110 Bacteria 1149
588 Ga0436365_0142818 3300039437 Bacteria 857
589 Ga0439450_200272 3300042008 Unclassified 534
590 Ga0450914_006338 3300042118 Bacteria 1034
591 Ga0450890_011274 3300042127 Bacteria 1153
592 Ga0450889_013432 3300042144 Bacteria 866
593 Ga0450893_0104005 3300042532 Unclassified 581
594 Ga0451577_0073652 3300042876 Bacteria 3047
595 Ga0439440_0004455 3300042993 Bacteria 2750
596 Ga0453683_0185529 3300044673 Bacteria 1319
597 Ga0453683_1137700 3300044673 Bacteria 521
598 Ga0466963_0870732 3300044694 Bacteria 635
599 Ga0466963_1049148 3300044694 Bacteria 574
600 Ga0453684_1057089 3300044712 Unclassified 860
601 Ga0466957_0588310 3300044842 Bacteria 778
602 Ga0451576_0032750 3300045051 Bacteria 5528
603 Ga0451576_1004808 3300045051 Bacteria 874
604 Ga0466967_0055365 3300045976 Unclassified 3494
605 Ga0466967_0304649 3300045976 Bacteria 1534
606 Ga0466967_0308144 3300045976 Bacteria 1525
607 Ga0466967_1733288 3300045976 Bacteria 622
608 Ga0495629_0683939 3300046459 Unclassified 682
609 Ga0495651_0335590 3300046462 Unclassified 1003
610 Ga0495662_0338751 3300046476 Bacteria 739
611 Ga0495664_0281604 3300046477 Viruses 1005
612 Ga0495628_0264025 3300046516 Unclassified 1282
613 Ga0495663_0041262 3300046525 Bacteria 1403
614 Ga0495663_0041546 3300046525 Bacteria 1399
615 Ga0495652_0417148 3300046529 Bacteria 947
616 Ga0495598_0077773 3300046537 Bacteria 1058
617 Ga0495621_0000246 3300046539 Bacteria 12893
618 Ga0495621_0159770 3300046539 Bacteria 891
619 Ga0495621_0409342 3300046539 Bacteria 576
620 Ga0495645_0359751 3300046543 Viruses 936
621 Ga0495645_0501432 3300046543 Bacteria 759
622 Ga0495667_0185811 3300046559 Bacteria 1333
623 Ga0495656_0000713 3300046615 Bacteria 10722
624 Ga0495656_0024120 3300046615 Bacteria 2399
625 Ga0495668_0032153 3300046616 Bacteria 2954
626 Ga0495635_0327725 3300046663 Bacteria 1024
627 Ga0495659_0008444 3300046664 Bacteria 3278
628 Ga0495599_0026868 3300046678 Bacteria 3608
629 Ga0495599_0268196 3300046678 Unclassified 1036
630 Ga0495669_0402235 3300046684 Bacteria 664
631 Ga0495636_0010028 3300047318 Bacteria 3735
632 Ga0495636_0085098 3300047318 Bacteria 1366
633 Ga0495674_0176163 3300047319 Bacteria 1782
634 Ga0495674_0399297 3300047319 Bacteria 1110
635 Ga0495680_0283878 3300047322 Bacteria 1166
636 Ga0495685_224869 3300047447 Unclassified 598
637 Ga0495684_0543088 3300047471 Unclassified 793
638 Ga0495684_0598186 3300047471 Bacteria 744
639 Ga0495686_0689681 3300047472 Bacteria 522
640 Ga0496100_0426115 3300048903 Bacteria 1014
641 Ga0496100_0497697 3300048903 Bacteria 939
642 Ga0496101_0365623 3300048904 Bacteria 1134
643 Ga0496101_0420098 3300048904 Bacteria 1054
644 Ga0496101_0663725 3300048904 Unclassified 824
645 Ga0496102_0275865 3300048905 Bacteria 1585
646 Ga0496104_0027357 3300048907 Bacteria 5277
647 Ga0496104_0891905 3300048907 Bacteria 794
648 Ga0496105_0032601 3300048908 Bacteria 4277
649 Ga0496105_0238392 3300048908 Bacteria 1477
650 Ga0496106_0161790 3300048909 Bacteria 1771
651 Ga0496106_0401126 3300048909 Bacteria 1102
652 Ga0496107_1080762 3300048910 Bacteria 580
653 Ga0496108_0029478 3300048911 Bacteria 4545
654 Ga0496108_0049808 3300048911 Bacteria 3504
655 Ga0496108_1807665 3300048911 Bacteria 500
656 Ga0496109_0253480 3300048912 Bacteria 1657
657 Ga0496109_0827853 3300048912 Bacteria 863
658 Ga0496109_1379060 3300048912 Bacteria 640
659 Ga0496110_0204032 3300048913 Bacteria 1796
660 Ga0496110_0914806 3300048913 Bacteria 783
661 Ga0496111_1126260 3300048914 Bacteria 558
662 Ga0496112_0032730 3300048915 Bacteria 5048
663 Ga0496112_0560813 3300048915 Unclassified 1076
664 Ga0496113_1137436 3300048916 Bacteria 611
665 Ga0496114_0470289 3300048917 Bacteria 1112
666 Ga0496115_0195880 3300048918 Bacteria 1669
667 Ga0501034_0014133 3300049571 Bacteria 8227
668 Ga0501034_1111884 3300049571 Bacteria 671
669 Ga0501036_1498236 3300049572 Bacteria 546
670 Ga0501039_1344149 3300049575 Bacteria 551
671 Ga0501067_0023254 3300049583 Bacteria 3434
672 Ga0501068_0305666 3300049584 Bacteria 1018
673 Ga0501069_0102077 3300049585 Bacteria 1629
674 Ga0501069_0197023 3300049585 Bacteria 1167
675 Ga0501070_0002912 3300049586 Bacteria 14892
676 Ga0501070_0245288 3300049586 Bacteria 1466
677 Ga0501072_0035179 3300049588 Bacteria 3926
678 Ga0501072_0836832 3300049588 Bacteria 720
679 Ga0501072_1064915 3300049588 Bacteria 630
680 Ga0501073_0005162 3300049589 Bacteria 9797
681 Ga0501074_0154733 3300049590 Bacteria 1638
682 Ga0501075_0885186 3300049591 Bacteria 679
683 Ga0501202_156040 3300049652 Bacteria 601
684 Ga0501223_146041 3300049663 Bacteria 511
685 Ga0501224_053757 3300049664 Bacteria 621
686 Ga0501249_154817 3300049679 Bacteria 579
687 Ga0501249_183261 3300049679 Bacteria 542
688 Ga0501252_085536 3300049682 Bacteria 528
689 Ga0501245_136302 3300049708 Bacteria 531
690 Ga0501079_0893334 3300049741 Bacteria 700
691 Ga0501080_0071488 3300049742 Bacteria 3227
692 Ga0501080_0237015 3300049742 Bacteria 1666
693 Ga0501080_1350868 3300049742 Bacteria 609
694 Ga0501083_0022168 3300049744 Bacteria 4408
695 Ga0501083_0122515 3300049744 Bacteria 1705
696 Ga0501266_020253 3300049763 Bacteria 904
697 Ga0501035_0064382 3300049822 Bacteria 3259
698 nmdc:mga07m45_685444_c1 3300050496 Bacteria 590
699 nmdc:mga05p37_1042903_c1 3300050507 Bacteria 863
700 nmdc:mga05p37_89586_c1 3300050507 Bacteria 3791
701 nmdc:mga0qj67_812871_c1 3300050509 Bacteria 739
702 nmdc:mga06r32_1051288_c1 3300050510 Bacteria 765
703 nmdc:mga08y16_8570_c1 3300050511 Bacteria 10715
704 nmdc:mga08y16_872999_c1 3300050511 Bacteria 887
705 nmdc:mga0n895_100625_c1 3300050512 Bacteria 2899
706 nmdc:mga0n895_1063532_c1 3300050512 Bacteria 788
707 nmdc:mga0n895_1118331_c1 3300050512 Viruses 764
708 nmdc:mga0n895_492819_c1 3300050512 Unclassified 1235
709 nmdc:mga0n895_94776_c1 3300050512 Bacteria 2989
710 nmdc:mga0rr50_381050_c1 3300050513 Bacteria 1189
711 nmdc:mga0rr50_386829_c1 3300050513 Bacteria 1180
712 nmdc:mga0rr50_908736_c1 3300050513 Unclassified 751
713 nmdc:mga08x19_111547_c1 3300050514 Bacteria 1825
714 nmdc:mga0a205_1026528_c1 3300050515 Bacteria 672
715 nmdc:mga0a205_811209_c1 3300050515 Unclassified 783
716 Ga0495601_0146742 3300053077 Bacteria 1540
717 Ga0495595_0159944 3300053084 Unclassified 1111
718 Ga0495595_0244573 3300053084 Bacteria 898
719 Ga0495595_0335364 3300053084 Bacteria 762
720 Ga0495619_0121770 3300053085 Bacteria 1789
721 Ga0495619_0142241 3300053085 Bacteria 1653
722 Ga0501084_0304139 3300054114 Bacteria 1347
723 Ga0590071_043557 3300059421 Bacteria 1081
724 Ga0590075_021653 3300059424 Bacteria 1606
725 Ga0501082_0154760 3300060353 Bacteria 1992
726 Ga0501082_0507771 3300060353 Bacteria 1054
727 Ga0501082_1502117 3300060353 Bacteria 588
728 Ga0501082_1835369 3300060353 Bacteria 529
729 Ga0307409_100168265
730 MRS1b_contig_5891132
731 rootL2_10064053
732 rootL2_10064441
733 rootL2_10230110
734 JGI26145J50221_1005218
735 JGI25405J52794_10165020
736 Ga0065712_10093411
737 Ga0065712_10274287
738 Ga0065712_10359182
739 Ga0065715_10413905
740 Ga0065715_10971370
741 Ga0065707_10009664
742 Ga0070676_10246130
743 Ga0070676_10434938
744 Ga0070690_100000516
745 Ga0070690_100628549
746 Ga0070670_100111976
747 Ga0070670_100536599
748 Ga0070670_100823029
749 Ga0070677_10360058
750 Ga0068869_101824235
751 Ga0068869_101847774
752 Ga0070666_10001681
753 Ga0070666_10105949
754 Ga0070666_10185709
755 Ga0070680_100049152
756 Ga0070680_101193371
757 Ga0068868_100003580
758 Ga0068868_100029610
759 Ga0068868_100180696
760 Ga0068868_100829647
761 Ga0068868_101447318
762 Ga0070660_101641818
763 Ga0070689_100046005
764 Ga0070689_100220341
765 Ga0070689_100597173
766 Ga0070689_101033997
767 Ga0070691_11102036
768 Ga0070687_100200219
769 Ga0070687_100290054
770 Ga0070687_100748079
771 Ga0070661_100281967
772 Ga0070668_102224461
773 Ga0070669_100259003
774 Ga0070669_101509705
775 Ga0070669_101878234
776 Ga0070675_100055666
777 Ga0070675_100111127
778 Ga0070675_100347844
779 Ga0070671_100006931
780 Ga0070671_100009274
781 Ga0070671_100301837
782 Ga0070671_100635723
783 Ga0070671_101454649
784 Ga0070671_101832908
785 Ga0070674_100149245
786 Ga0070673_100013948
787 Ga0070673_100014509
788 Ga0070673_100936681
789 Ga0070688_100000819
790 Ga0070688_100372586
791 Ga0070659_100231485
792 Ga0070659_100293618
793 Ga0070667_100007431
794 Ga0070667_100066362
795 Ga0070667_100246302
796 Ga0070667_100783177
797 Ga0070667_101029839
798 Ga0070709_10043077
799 Ga0070709_10566341
800 Ga0070714_100127254
801 Ga0070714_100827967
802 Ga0070713_100006824
803 Ga0070701_10011118
804 Ga0070711_100005887
805 Ga0070708_100011856
806 Ga0070663_100742954
807 Ga0070678_100009236
808 Ga0070678_100057544
809 Ga0070662_101277123
810 Ga0070662_101826510
811 Ga0070681_10004606
812 Ga0070681_12030661
813 Ga0068867_100075919
814 Ga0068867_100117888
815 Ga0070685_10002365
816 Ga0070685_11252917
817 Ga0070698_101831005
818 Ga0070698_102074673
819 Ga0070699_100059310
820 Ga0070679_100031838
821 Ga0070684_100031758
822 Ga0070697_100019047
823 Ga0068853_100408266
824 Ga0070672_100060976
825 Ga0070686_100027591
826 Ga0070686_100205185
827 Ga0070696_101439768
828 Ga0070665_100005472
829 Ga0070665_100015179
830 Ga0070665_100074248
831 Ga0070665_102399432
832 Ga0070704_100368040
833 Ga0068855_100026941
834 Ga0068855_100379210
835 Ga0068855_100993759
836 Ga0070664_100248893
837 Ga0070664_100612371
838 Ga0070664_102391434
839 Ga0068857_100750115
840 Ga0068857_101438079
841 Ga0068857_102268049
842 Ga0068854_100710898
843 Ga0068854_102110602
844 Ga0068856_100002370
845 Ga0068856_100023886
846 Ga0068856_100305770
847 Ga0068859_100005806
848 Ga0068859_100732075
849 Ga0068859_100817256
850 Ga0068859_100895947
851 Ga0068864_100075511
852 Ga0068864_100084525
853 Ga0068864_100219451
854 Ga0068866_10083423
855 Ga0068866_10141487
856 Ga0068866_10689961
857 Ga0068861_100899174
858 Ga0068861_101217083
859 Ga0068861_101241787
860 Ga0068861_101625451
861 Ga0068851_10315068
862 Ga0068863_100001296
863 Ga0068863_100523374
864 Ga0068863_101570421
865 Ga0068858_100008408
866 Ga0068858_100010553
867 Ga0068858_100089745
868 Ga0068858_100257286
869 Ga0068858_100686554
870 Ga0068858_102287806
871 Ga0068860_100000390
872 Ga0068860_100018934
873 Ga0068860_100242081
874 Ga0068860_100783814
875 Ga0068860_101650551
876 Ga0068860_101973249
877 Ga0068862_100891965
878 Ga0081455_10002344
879 Ga0081538_10006794
880 Ga0070715_10001133
881 Ga0070716_101587548
882 Ga0070712_100014503
883 Ga0097621_100040474
884 Ga0097621_100075023
885 Ga0097621_100114299
886 Ga0097621_100162726
887 Ga0075370_10781556
888 Ga0075370_10960425
889 Ga0068871_100014293
890 Ga0068871_100015488
891 Ga0068871_100061798
892 Ga0068871_100078403
893 Ga0068871_100175835
894 Ga0075430_100177904
895 Ga0075430_101237783
896 Ga0075433_10164974
897 Ga0075434_100058324
898 Ga0075434_100080813
899 Ga0075434_100190555
900 Ga0075434_100274748
901 Ga0075434_100520995
902 Ga0075434_100880047
903 Ga0075429_100272305
904 Ga0075429_100911488
905 Ga0068865_100033606
906 Ga0075436_100112634
907 Ga0097620_100005807
908 Ga0097620_100732022
909 Ga0097620_100817365
910 Ga0097620_100895866
911 Ga0075435_100315030
912 Ga0075435_100617896
913 Ga0075435_100925251
914 Ga0105240_10078990
915 Ga0105240_11763950
916 Ga0111539_10005315
917 Ga0111539_10407566
918 Ga0111539_10695993
919 Ga0105245_10016068
920 Ga0105245_10253204
921 Ga0105245_10556488
922 Ga0105245_11520275
923 Ga0105247_10020979
924 Ga0105247_10082401
925 Ga0114129_10119677
926 Ga0114129_10633755
927 Ga0114129_11386929
928 Ga0114129_12952591
929 Ga0105241_10207093
930 Ga0105241_10379978
931 Ga0105241_11832338
932 Ga0105242_10002472
933 Ga0105242_11032023
934 Ga0105242_11854032
935 Ga0105248_10072646
936 Ga0105248_10986184
937 Ga0105248_11540498
938 Ga0105248_12444653
939 Ga0105237_10015533
940 Ga0105237_10340849
941 Ga0105237_10485947
942 Ga0105238_10122070
943 Ga0105249_12104915
944 Ga0105148_115829
945 Ga0105239_10180959
946 Ga0105239_12785614
947 Ga0105246_10096369
948 Ga0157318_1002190
949 Ga0157325_1014651
950 Ga0157321_1007980
951 Ga0157314_1057619
952 Ga0157313_1044166
953 Ga0157342_1037372
954 Ga0157315_1019449
955 Ga0157316_1001016
956 Ga0157327_1004493
957 Ga0157326_1031776
958 Ga0157373_10288093
959 Ga0157373_10399488
960 Ga0157373_10574185
961 Ga0157371_10320391
962 Ga0157370_10134194
963 Ga0157370_10948774
964 Ga0157369_10236246
965 Ga0157374_10012012
966 Ga0157374_11100681
967 Ga0157374_11310013
968 Ga0157378_10004796
969 Ga0157378_10005883
970 Ga0157378_10247494
971 Ga0163162_10001742
972 Ga0163162_10387747
973 Ga0163162_10899541
974 Ga0163162_12482702
975 Ga0157372_10364305
976 Ga0157372_10506486
977 Ga0157372_11388288
978 Ga0157372_11413084
979 Ga0157375_10007022
980 Ga0157375_10050611
981 Ga0157375_10949391
982 Ga0157375_11347595
983 Ga0157375_11816583
984 Ga0163163_10002094
985 Ga0163163_10103889
986 Ga0163163_12799252
987 Ga0157380_10169590
988 Ga0157380_11239836
989 Ga0157377_10948706
990 Ga0157379_10010776
991 Ga0157379_10020339
992 Ga0157376_10002651
993 Ga0157376_10784520
994 Ga0163161_10715200
995 Ga0163161_10730839
996 Ga0207697_10027261
997 Ga0207656_10173391
998 Ga0207682_10044417
999 Ga0207682_10213547
1000 Ga0207692_10076339
1001 Ga0207642_10124716
1002 Ga0207642_10461478
1003 Ga0207710_10065975
1004 Ga0207710_10212835
1005 Ga0207710_10312128
1006 Ga0207688_10442135
1007 Ga0207680_10010109
1008 Ga0207680_10090989
1009 Ga0207680_10102475
1010 Ga0207680_10127141
1011 Ga0207680_10157855
1012 Ga0207699_10026728
1013 Ga0207699_10365963
1014 Ga0207645_10068918
1015 Ga0207645_10217747
1016 Ga0207643_10014677
1017 Ga0207654_10234466
1018 Ga0207654_10275643
1019 Ga0207707_10004319
1020 Ga0207707_10513056
1021 Ga0207707_11436179
1022 Ga0207695_11067866
1023 Ga0207671_10283701
1024 Ga0207693_10002141
1025 Ga0207663_10020869
1026 Ga0207662_10136554
1027 Ga0207662_10206088
1028 Ga0207662_10995133
1029 Ga0207657_10228332
1030 Ga0207649_10029299
1031 Ga0207652_10077355
1032 Ga0207681_10042366
1033 Ga0207681_10225720
1034 Ga0207650_10067908
1035 Ga0207650_10098250
1036 Ga0207650_11603551
1037 Ga0207659_10064166
1038 Ga0207659_10072571
1039 Ga0207659_10161427
1040 Ga0207687_10000151
1041 Ga0207687_10037594
1042 Ga0207687_10165003
1043 Ga0207664_10076261
1044 Ga0207644_10011998
1045 Ga0207644_10052763
1046 Ga0207644_10202961
1047 Ga0207644_10459504
1048 Ga0207644_10578125
1049 Ga0207644_11137706
1050 Ga0207644_11415014
1051 Ga0207690_10423384
1052 Ga0207690_10501599
1053 Ga0207690_10825106
1054 Ga0207686_10188364
1055 Ga0207670_10088288
1056 Ga0207669_11297158
1057 Ga0207704_10025368
1058 Ga0207704_10279643
1059 Ga0207704_10761108
1060 Ga0207665_10108600
1061 Ga0207691_10017956
1062 Ga0207691_10083713
1063 Ga0207691_10246109
1064 Ga0207691_10375096
1065 Ga0207691_11237675
1066 Ga0207711_10000206
1067 Ga0207711_10459117
1068 Ga0207711_10474343
1069 Ga0207711_10973749
1070 Ga0207711_11292212
1071 Ga0207689_10077825
1072 Ga0207689_10086647
1073 Ga0207689_11565689
1074 Ga0207679_10047362
1075 Ga0207679_10266107
1076 Ga0207679_10308942
1077 Ga0207667_10133835
1078 Ga0207667_10524829
1079 Ga0207667_10865259
1080 Ga0207667_12075362
1081 Ga0207651_10046729
1082 Ga0207651_10064664
1083 Ga0207651_10119793
1084 Ga0207651_10622499
1085 Ga0207712_10571435
1086 Ga0207712_10768897
1087 Ga0207668_12023676
1088 Ga0207658_10004930
1089 Ga0207658_10095734
1090 Ga0207658_10236631
1091 Ga0207658_10291118
1092 Ga0207677_10000593
1093 Ga0207677_10666869
1094 Ga0207677_10932736
1095 Ga0207677_11670419
1096 Ga0207703_10002219
1097 Ga0207703_10874030
1098 Ga0207703_11413623
1099 Ga0207703_11869131
1100 Ga0207639_11338432
1101 Ga0207708_10116433
1102 Ga0207708_11118649
1103 Ga0207702_10007617
1104 Ga0207702_10025226
1105 Ga0207702_10780088
1106 Ga0207641_10009189
1107 Ga0207641_10042833
1108 Ga0207641_10125567
1109 Ga0207641_10208914
1110 Ga0207648_10005103
1111 Ga0207648_10073239
1112 Ga0207648_10129857
1113 Ga0207648_10151268
1114 Ga0207648_10360408
1115 Ga0207648_11780153
1116 Ga0207676_10007085
1117 Ga0207676_10025626
1118 Ga0207676_10050671
1119 Ga0207676_10068049
1120 Ga0207676_10198982
1121 Ga0207676_10328742
1122 Ga0207676_11774824
1123 Ga0207674_10491329
1124 Ga0207674_11338152
1125 Ga0207675_100312084
1126 Ga0207675_100348448
1127 Ga0207675_100781973
1128 Ga0207675_100895787
1129 Ga0207675_102152678
1130 Ga0207675_102622943
1131 Ga0207683_10009256
1132 Ga0207683_10010111
1133 Ga0207683_10237833
1134 Ga0207698_10277650
1135 Ga0207698_10968302
1136 Ga0209969_1043390
1137 Ga0209981_1029372
1138 Ga0209982_1003785
1139 Ga0209970_1021544
1140 Ga0209970_1022801
1141 Ga0209983_1000696
1142 Ga0209983_1022897
1143 Ga0209983_1052981
1144 Ga0209971_1014899
1145 Ga0209971_1060280
1146 Ga0209966_1065740
1147 Ga0209974_10008521
1148 Ga0209974_10016458
1149 Ga0209974_10056227
1150 Ga0207428_10009273
1151 Ga0268266_10015750
1152 Ga0268266_10073341
1153 Ga0268266_10267300
1154 Ga0268266_11669096
1155 Ga0268266_12135807
1156 Ga0268266_12203303
1157 Ga0268265_10222288
1158 Ga0268265_10277965
1159 Ga0268265_10294885
1160 Ga0268265_10479547
1161 Ga0268265_11534667
1162 Ga0268265_11683107
1163 Ga0268264_10000800
1164 Ga0268264_10001344
1165 Ga0268264_10233025
1166 Ga0268264_10271521
1167 Ga0265330_10000842
1168 Ga0265332_10000088
1169 Ga0265328_10003461
1170 Ga0265325_10004358
1171 Ga0265325_10018099
1172 Ga0265329_10000265
1173 Ga0265340_10184860
1174 Ga0265339_10065811
1175 Ga0265331_10000540
1176 Ga0265327_10002597
1177 Ga0265316_10015397
1178 Ga0265316_10242906
1179 Ga0307408_100020090
1180 Ga0307408_100760292
1181 Ga0316575_10007110
1182 Ga0316575_10083564
1183 Ga0265314_10009645
1184 Ga0265342_10003320
1185 Ga0316576_10058339
1186 Ga0316576_11095217
1187 Ga0316578_10028503
1188 Ga0316578_10508640
1189 Ga0307405_10026217
1190 Ga0307405_10194688
1191 Ga0307405_10324273
1192 Ga0316577_10000916
1193 Ga0316577_10156640
1194 Ga0307413_10002787
1195 Ga0307413_10010339
1196 Ga0307413_10459603
1197 Ga0307413_10708780
1198 Ga0307413_10826585
1199 Ga0307410_10036960
1200 Ga0307410_10065109
1201 Ga0307410_10201214
1202 Ga0307410_10742520
1203 Ga0307410_10975953
1204 Ga0307406_10003101
1205 Ga0307406_10004969
1206 Ga0307406_10079646
1207 Ga0307407_10000961
1208 Ga0307407_10010193
1209 Ga0307407_10013003
1210 Ga0307407_10824894
1211 Ga0307407_10956824
1212 Ga0307412_10001626
1213 Ga0307412_10108402
1214 Ga0307412_10155126
1215 Ga0307412_10370707
1216 Ga0307409_100003141
1217 Ga0307409_100030155
1218 Ga0307409_100183452
1219 Ga0307409_100645780
1220 Ga0307409_100733692
1221 Ga0307409_101789882
1222 Ga0307416_100001853
1223 Ga0307416_100238432
1224 Ga0307416_100325506
1225 Ga0307416_100844630
1226 Ga0307416_103376166
1227 Ga0307414_10016576
1228 Ga0307414_10017956
1229 Ga0307414_10043499
1230 Ga0307414_10052310
1231 Ga0307414_10732401
1232 Ga0307414_10814134
1233 Ga0307414_11190299
1234 Ga0307414_11705652
1235 Ga0307411_10002891
1236 Ga0307411_10005640
1237 Ga0307411_10013367
1238 Ga0307411_10081316
1239 Ga0307411_10106029
1240 Ga0307411_10430100
1241 Ga0307411_10573218
1242 Ga0307411_11723487
1243 Ga0307415_100113238
1244 Ga0307415_100757214
1245 Ga0307415_100894951
1246 Ga0316583_10033442
1247 Ga0316585_10002589
1248 Ga0316580_10001132
1249 Ga0316593_10140095
1250 Ga0307507_10532842
1251 Ga0373958_0137887
1252 Ga0373959_0118981
1253 Ga0373928_0256173
1254 Ga0373934_0349837
1255 Ga0373923_0002412
1256 Ga0373923_0468114
1257 Ga0373939_0101603
1258 Ga0373945_0083943
1259 Ga0373953_0125138
1260 Ga0373954_0052544
1261 Ga0373954_0282627
1262 Ga0373956_0150443
1263 Ga0373956_0377771
1264 Ga0373957_0522623
1265 Ga0373943_0047177
1266 Ga0373946_0025559
1267 Ga0373946_0319413
1268 Ga0373955_0106482
1269 Ga0316574_0032794
1270 Ga0316574_0162987
1271 Ga0316574_0328171
1272 Ga0373924_0114523
1273 Ga0373931_0059045
1274 Ga0373935_0320044
1275 Ga0373935_1503479
1276 Ga0373927_0103378
1277 Ga0373933_0005726
1278 Ga0373933_0206886
1279 Ga0373933_0434901
1280 Ga0373947_0146772
1281 Ga0373947_0168330
1282 Ga0373937_0040496
1283 Ga0373937_0082990
1284 Ga0373937_0453015
1285 Ga0316582_0004398
1286 Ga0316582_0008248
1287 Ga0316584_0000929
1288 Ga0316584_0015883
1289 Ga0373925_0092505
1290 Ga0395899_0019444
1291 Ga0395900_0018823
1292 Ga0395898_0081576
1293 Ga0395898_0259688
1294 Ga0395905_0004974
1295 Ga0395905_0117959
1296 Ga0395905_0187153
1297 Ga0395905_0296459
1298 Ga0395905_0317728
1299 Ga0395905_0392122
1300 Ga0395905_0536585
1301 Ga0436364_0467815
1302 Ga0395901_0036036
1303 Ga0395901_0604955
1304 Ga0400484_14457
1305 Ga0400490_47817
1306 Ga0400485_00302
1307 Ga0400485_20750
1308 Ga0400488_14303
1309 Ga0400488_20652
1310 Ga0400488_31409
1311 Ga0400488_57505
1312 Ga0400486_03767
1313 Ga0400483_020095
1314 Ga0400483_137089
1315 Ga0400487_17869
1316 Ga0436365_0142818
1317 Ga0439450_200272
1318 Ga0450914_006338
1319 Ga0450890_011274
1320 Ga0450889_013432
1321 Ga0450893_0104005
1322 Ga0451577_0073652
1323 Ga0439440_0004455
1324 Ga0453683_0185529
1325 Ga0453683_1137700
1326 Ga0466963_0870732
1327 Ga0466963_1049148
1328 Ga0453684_1057089
1329 Ga0466957_0588310
1330 Ga0451576_0032750
1331 Ga0451576_1004808
1332 Ga0466967_0055365
1333 Ga0466967_0304649
1334 Ga0466967_0308144
1335 Ga0466967_1733288
1336 Ga0495629_0683939
1337 Ga0495651_0335590
1338 Ga0495662_0338751
1339 Ga0495664_0281604
1340 Ga0495628_0264025
1341 Ga0495663_0041262
1342 Ga0495663_0041546
1343 Ga0495652_0417148
1344 Ga0495598_0077773
1345 Ga0495621_0000246
1346 Ga0495621_0159770
1347 Ga0495621_0409342
1348 Ga0495645_0359751
1349 Ga0495645_0501432
1350 Ga0495667_0185811
1351 Ga0495656_0000713
1352 Ga0495656_0024120
1353 Ga0495668_0032153
1354 Ga0495635_0327725
1355 Ga0495659_0008444
1356 Ga0495599_0026868
1357 Ga0495599_0268196
1358 Ga0495669_0402235
1359 Ga0495636_0010028
1360 Ga0495636_0085098
1361 Ga0495674_0176163
1362 Ga0495674_0399297
1363 Ga0495680_0283878
1364 Ga0495685_224869
1365 Ga0495684_0543088
1366 Ga0495684_0598186
1367 Ga0495686_0689681
1368 Ga0496100_0426115
1369 Ga0496100_0497697
1370 Ga0496101_0365623
1371 Ga0496101_0420098
1372 Ga0496101_0663725
1373 Ga0496102_0275865
1374 Ga0496104_0027357
1375 Ga0496104_0891905
1376 Ga0496105_0032601
1377 Ga0496105_0238392
1378 Ga0496106_0161790
1379 Ga0496106_0401126
1380 Ga0496107_1080762
1381 Ga0496108_0029478
1382 Ga0496108_0049808
1383 Ga0496108_1807665
1384 Ga0496109_0253480
1385 Ga0496109_0827853
1386 Ga0496109_1379060
1387 Ga0496110_0204032
1388 Ga0496110_0914806
1389 Ga0496111_1126260
1390 Ga0496112_0032730
1391 Ga0496112_0560813
1392 Ga0496113_1137436
1393 Ga0496114_0470289
1394 Ga0496115_0195880
1395 Ga0501034_0014133
1396 Ga0501034_1111884
1397 Ga0501036_1498236
1398 Ga0501039_1344149
1399 Ga0501067_0023254
1400 Ga0501068_0305666
1401 Ga0501069_0102077
1402 Ga0501069_0197023
1403 Ga0501070_0002912
1404 Ga0501070_0245288
1405 Ga0501072_0035179
1406 Ga0501072_0836832
1407 Ga0501072_1064915
1408 Ga0501073_0005162
1409 Ga0501074_0154733
1410 Ga0501075_0885186
1411 Ga0501202_156040
1412 Ga0501223_146041
1413 Ga0501224_053757
1414 Ga0501249_154817
1415 Ga0501249_183261
1416 Ga0501252_085536
1417 Ga0501245_136302
1418 Ga0501079_0893334
1419 Ga0501080_0071488
1420 Ga0501080_0237015
1421 Ga0501080_1350868
1422 Ga0501083_0022168
1423 Ga0501083_0122515
1424 Ga0501266_020253
1425 Ga0501035_0064382
1426 nmdc:mga07m45_685444_c1
1427 nmdc:mga05p37_1042903_c1
1428 nmdc:mga05p37_89586_c1
1429 nmdc:mga0qj67_812871_c1
1430 nmdc:mga06r32_1051288_c1
1431 nmdc:mga08y16_8570_c1
1432 nmdc:mga08y16_872999_c1
1433 nmdc:mga0n895_100625_c1
1434 nmdc:mga0n895_1063532_c1
1435 nmdc:mga0n895_1118331_c1
1436 nmdc:mga0n895_492819_c1
1437 nmdc:mga0n895_94776_c1
1438 nmdc:mga0rr50_381050_c1
1439 nmdc:mga0rr50_386829_c1
1440 nmdc:mga0rr50_908736_c1
1441 nmdc:mga08x19_111547_c1
1442 nmdc:mga0a205_1026528_c1
1443 nmdc:mga0a205_811209_c1
1444 Ga0495601_0146742
1445 Ga0495595_0159944
1446 Ga0495595_0244573
1447 Ga0495595_0335364
1448 Ga0495619_0121770
1449 Ga0495619_0142241
1450 Ga0501084_0304139
1451 Ga0590071_043557
1452 Ga0590075_021653
1453 Ga0501082_0154760
1454 Ga0501082_0507771
1455 Ga0501082_1502117
1456 Ga0501082_1835369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01906

YbjQ_1

Putative heavy-metal-binding

23

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.9559 5 105
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.9223 5 105
1vr4-assembly1.cif.gz_E crystal structure of mcsg target apc22750 from bacillus cereus 0.8586 6 105
1y2i-assembly1.cif.gz_C crystal structure of mcsg target apc27401 from shigella flexneri 0.8547 6 110
2gtc-assembly1.cif.gz_E crystal structure of the hypthetical protein from bacillus cereus (atcc 14579). northeast structural genomics target bcr11 0.8442 5 105
ID Description Score Start End Superfamily
af_Q58808_5_102_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8566 6 109 3.30.110.70
af_Q58808_5_102_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8405 6 109 3.30.110.70
1ybbE00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8264 5 105 3.30.110.70
af_O96168_140_247_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8259 5 109 1.20.1740.10
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8247 6 110 3.30.110.70
ID Description Score Start End GO Terms
AF-A0A536ZXY8-F1-model_v4 UPF0145 protein E6H48_13080 0.9672 2 110
AF-A0A1G7MQ16-F1-model_v4 UPF0145 protein SAMN05444167_2875 0.9661 1 110
AF-A0A3M1WKC4-F1-model_v4 UPF0145 protein D6723_07670 0.965 3 109
AF-A0A0H2XU42-F1-model_v4 UPF0145 protein Bcen_3300 0.964 1 110
AF-A0A3N7ZMV8-F1-model_v4 UPF0145 protein DIE23_20390 0.964 1 110

Map