F477760

General Info

Members Datasets Scaffolds Average Seq Length
727 373 714 279

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0001923|Ga0495663_0001923_5315_6226
Length 303
Sequence MALPAPVAAALRGTLQFQESCCMCPSKVADGGERGWIVPIGGAENKEDNPRILKRFLDLCGGRDAEIVVIPTASQLADTGTRYEGIFGDLGASRVDVLDFDTRRDCHEQNRLDRIENASGIFFTGGNQLRLSTILGGTPAAKLIRERNAAGITVGGTSAGASILSEHMIGFGKEGASPQADSVRLAPGLGLTNRFIIDQHFRQRDRLGRLVAALAYNPFAIGIGLDEDTAAFIGPDNTLEVEGSGAVTVVDADGLTFSSMAQVNENKPVCLLGLTVHILVAGATFNLHTRKASAGTLTQGKKG

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221573 Lysobacter sp. Root604 Isolate Unclassified
3 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
4 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
12 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
198 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
199 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
200 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
201 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
226 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
227 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
250 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
251 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
252 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
255 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
258 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
262 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
263 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
264 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
267 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
268 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
269 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
270 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
271 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
277 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
369 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.28
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 5.64
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000646 3300003187 Bacteria 29736
2 JGI25165J46597_1000948 3300003214 Bacteria 19865
3 rootH1_10102292 3300003316 Bacteria 6481
4 rootH2_10081999 3300003320 Bacteria 2230
5 rootL2_10033434 3300003322 Bacteria 2357
6 rootH1_10157784 3300003323 Bacteria 4965
7 Ga0055531_10013284 3300003794 Bacteria 3807
8 Ga0065714_10021006 3300005288 Bacteria 1395
9 Ga0065704_10144304 3300005289 Bacteria 1487
10 Ga0065715_10035465 3300005293 Bacteria 2407
11 Ga0065715_10129804 3300005293 Bacteria 2038
12 Ga0065715_10269957 3300005293 Bacteria 1114
13 Ga0070690_100007554 3300005330 Bacteria 6223
14 Ga0070690_100011025 3300005330 Bacteria 5279
15 Ga0070690_100041825 3300005330 Bacteria 2902
16 Ga0070670_100280129 3300005331 Bacteria 1456
17 Ga0068869_100002005 3300005334 Bacteria 12237
18 Ga0068869_100020047 3300005334 Bacteria 4580
19 Ga0070666_10000329 3300005335 Bacteria 30097
20 Ga0070666_10003623 3300005335 Bacteria 9364
21 Ga0070666_10023636 3300005335 Bacteria 4002
22 Ga0070666_10025604 3300005335 Bacteria 3847
23 Ga0068868_100018307 3300005338 Bacteria 5234
24 Ga0068868_100030353 3300005338 Bacteria 4145
25 Ga0070689_100002277 3300005340 Bacteria 12480
26 Ga0070689_100524634 3300005340 Bacteria 1017
27 Ga0070687_100010303 3300005343 Bacteria 4038
28 Ga0070661_100008429 3300005344 Bacteria 7126
29 Ga0070692_10180210 3300005345 Bacteria 1224
30 Ga0070668_100050278 3300005347 Bacteria 3209
31 Ga0070668_100088538 3300005347 Bacteria 2437
32 Ga0070668_100120549 3300005347 Bacteria 2096
33 Ga0070669_100002403 3300005353 Bacteria 13547
34 Ga0070669_100015089 3300005353 Bacteria 5505
35 Ga0070669_100185761 3300005353 Bacteria 1628
36 Ga0070675_100002814 3300005354 Bacteria 13117
37 Ga0070671_100001491 3300005355 Bacteria 17486
38 Ga0070671_100050852 3300005355 Bacteria 3446
39 Ga0070671_100140217 3300005355 Bacteria 2040
40 Ga0070674_100004601 3300005356 Bacteria 7886
41 Ga0070673_100003918 3300005364 Bacteria 9350
42 Ga0070673_100053807 3300005364 Bacteria 3164
43 Ga0070673_100055472 3300005364 Bacteria 3122
44 Ga0070688_100002281 3300005365 Bacteria 9681
45 Ga0070659_100298236 3300005366 Bacteria 1343
46 Ga0070659_100396798 3300005366 Bacteria 1164
47 Ga0070667_100000150 3300005367 Bacteria 86639
48 Ga0070667_100007212 3300005367 Bacteria 9237
49 Ga0070667_100030058 3300005367 Bacteria 4531
50 Ga0070667_100141969 3300005367 Bacteria 2104
51 Ga0070667_100190379 3300005367 Bacteria 1817
52 Ga0070709_10001305 3300005434 Bacteria 13587
53 Ga0070709_10122021 3300005434 Bacteria 1768
54 Ga0070714_100004395 3300005435 Bacteria 10613
55 Ga0070714_100271051 3300005435 Bacteria 1574
56 Ga0070713_100006878 3300005436 Bacteria 7931
57 Ga0070713_100073283 3300005436 Bacteria 2898
58 Ga0070713_100102889 3300005436 Bacteria 2478
59 Ga0070710_10003030 3300005437 Bacteria 7989
60 Ga0070701_10017023 3300005438 Bacteria 3391
61 Ga0070711_100058968 3300005439 Bacteria 2663
62 Ga0070711_100107743 3300005439 Bacteria 2040
63 Ga0070711_100190015 3300005439 Bacteria 1578
64 Ga0070700_100016722 3300005441 Bacteria 4183
65 Ga0070700_100043337 3300005441 Bacteria 2768
66 Ga0070663_100000029 3300005455 Bacteria 82128
67 Ga0070663_100034907 3300005455 Bacteria 3486
68 Ga0070663_100084273 3300005455 Bacteria 2342
69 Ga0070678_100009491 3300005456 Bacteria 5900
70 Ga0070678_100024718 3300005456 Bacteria 4027
71 Ga0070662_100005675 3300005457 Bacteria 7987
72 Ga0070662_100010672 3300005457 Bacteria 6044
73 Ga0070662_100063080 3300005457 Bacteria 2710
74 Ga0070681_10057315 3300005458 Bacteria 3876
75 Ga0068867_100022309 3300005459 Bacteria 4526
76 Ga0068867_100049470 3300005459 Bacteria 3095
77 Ga0070685_10004628 3300005466 Bacteria 6966
78 Ga0070698_100153532 3300005471 Bacteria 2249
79 Ga0070699_100142595 3300005518 Bacteria 2117
80 Ga0070679_100599310 3300005530 Bacteria 1045
81 Ga0068853_100002157 3300005539 Bacteria 14647
82 Ga0068853_100180333 3300005539 Bacteria 1915
83 Ga0070672_100015169 3300005543 Bacteria 5478
84 Ga0070672_100059954 3300005543 Bacteria 2995
85 Ga0070686_100242582 3300005544 Bacteria 1313
86 Ga0070696_100003241 3300005546 Bacteria 10841
87 Ga0070696_100106770 3300005546 Bacteria 2013
88 Ga0070665_100006814 3300005548 Bacteria 11617
89 Ga0070665_100020338 3300005548 Bacteria 6667
90 Ga0070665_100020954 3300005548 Bacteria 6570
91 Ga0070665_100020971 3300005548 Bacteria 6568
92 Ga0068855_100099729 3300005563 Bacteria 3345
93 Ga0068855_100510210 3300005563 Bacteria 1306
94 Ga0070664_100009917 3300005564 Bacteria 7720
95 Ga0068857_100057393 3300005577 Bacteria 3455
96 Ga0068856_100020255 3300005614 Bacteria 6460
97 Ga0068859_100000602 3300005617 Bacteria 35957
98 Ga0068859_100001108 3300005617 Bacteria 27483
99 Ga0068859_100041015 3300005617 Bacteria 4650
100 Ga0068859_100657588 3300005617 Bacteria 1140
101 Ga0068864_100060758 3300005618 Bacteria 3272
102 Ga0068864_100564744 3300005618 Bacteria 1101
103 Ga0068866_10058368 3300005718 Bacteria 1993
104 Ga0068866_10076247 3300005718 Bacteria 1787
105 Ga0068861_100000334 3300005719 Bacteria 26662
106 Ga0068861_100001652 3300005719 Bacteria 14252
107 Ga0068861_100023236 3300005719 Bacteria 4471
108 Ga0068861_100366864 3300005719 Bacteria 1268
109 Ga0068861_100373367 3300005719 Bacteria 1258
110 Ga0068861_100519936 3300005719 Bacteria 1079
111 Ga0068851_10008873 3300005834 Bacteria 4663
112 Ga0068870_10046151 3300005840 Bacteria 2283
113 Ga0068870_10127149 3300005840 Bacteria 1476
114 Ga0068863_100002939 3300005841 Bacteria 16842
115 Ga0068863_100006641 3300005841 Bacteria 11354
116 Ga0068863_100036091 3300005841 Bacteria 4707
117 Ga0068863_100072876 3300005841 Bacteria 3249
118 Ga0068863_100155698 3300005841 Bacteria 2188
119 Ga0068863_100209109 3300005841 Bacteria 1879
120 Ga0068858_100000906 3300005842 Bacteria 30759
121 Ga0068858_100000915 3300005842 Bacteria 30581
122 Ga0068858_100005611 3300005842 Bacteria 12269
123 Ga0068858_100032425 3300005842 Bacteria 4851
124 Ga0068858_100074674 3300005842 Bacteria 3148
125 Ga0068858_100303538 3300005842 Bacteria 1523
126 Ga0068860_100007946 3300005843 Bacteria 10582
127 Ga0068860_100013020 3300005843 Bacteria 8167
128 Ga0068860_100554925 3300005843 Bacteria 1151
129 Ga0068862_100000393 3300005844 Bacteria 47115
130 Ga0068862_100032786 3300005844 Bacteria 4388
131 Ga0068862_100079400 3300005844 Bacteria 2844
132 Ga0068862_100402457 3300005844 Bacteria 1281
133 Ga0081540_1136257 3300005983 Bacteria 993
134 Ga0070717_10004003 3300006028 Bacteria 10608
135 Ga0070715_10000861 3300006163 Bacteria 8364
136 Ga0070716_100000641 3300006173 Bacteria 14863
137 Ga0070716_100256656 3300006173 Bacteria 1194
138 Ga0070712_100004032 3300006175 Bacteria 9010
139 Ga0070712_100022165 3300006175 Bacteria 4180
140 Ga0070712_100058722 3300006175 Bacteria 2707
141 Ga0097621_100012364 3300006237 Bacteria 6324
142 Ga0068871_100073567 3300006358 Bacteria 2817
143 Ga0075428_100000833 3300006844 Bacteria 32315
144 Ga0075428_100020477 3300006844 Bacteria 7323
145 Ga0075428_100023245 3300006844 Bacteria 6856
146 Ga0075428_100039525 3300006844 Bacteria 5192
147 Ga0075428_100108365 3300006844 Bacteria 3027
148 Ga0075428_100121035 3300006844 Bacteria 2850
149 Ga0075430_100000390 3300006846 Bacteria 32316
150 Ga0075430_100021054 3300006846 Bacteria 5543
151 Ga0075430_100185863 3300006846 Bacteria 1728
152 Ga0075431_100000034 3300006847 Bacteria 71256
153 Ga0075431_100005741 3300006847 Bacteria 12267
154 Ga0075431_100029897 3300006847 Bacteria 5609
155 Ga0075431_100056420 3300006847 Bacteria 4052
156 Ga0075431_100354000 3300006847 Bacteria 1476
157 Ga0075434_100610419 3300006871 Bacteria 1110
158 Ga0075429_100006961 3300006880 Bacteria 9825
159 Ga0075429_100019403 3300006880 Bacteria 5891
160 Ga0075429_100219980 3300006880 Bacteria 1663
161 Ga0068865_100057302 3300006881 Bacteria 2717
162 Ga0068865_100105267 3300006881 Bacteria 2072
163 Ga0068865_100158339 3300006881 Bacteria 1725
164 Ga0097620_100000602 3300006931 Bacteria 35957
165 Ga0097620_100001108 3300006931 Bacteria 27483
166 Ga0097620_100041015 3300006931 Bacteria 4650
167 Ga0097620_100657607 3300006931 Bacteria 1140
168 Ga0075435_100323858 3300007076 Bacteria 1319
169 Ga0099795_10000223 3300007788 Bacteria 9865
170 Ga0099795_10002097 3300007788 Bacteria 4590
171 Ga0105240_10085603 3300009093 Bacteria 3862
172 Ga0111539_10000816 3300009094 Bacteria 40435
173 Ga0111539_10003634 3300009094 Bacteria 20318
174 Ga0111539_10047322 3300009094 Bacteria 5140
175 Ga0111539_10093041 3300009094 Bacteria 3542
176 Ga0111539_10140685 3300009094 Bacteria 2825
177 Ga0111539_10556204 3300009094 Bacteria 1336
178 Ga0111539_10737881 3300009094 Bacteria 1146
179 Ga0105245_10010409 3300009098 Bacteria 8100
180 Ga0105245_10010410 3300009098 Bacteria 8099
181 Ga0105245_10566177 3300009098 Bacteria 1160
182 Ga0105247_10001357 3300009101 Bacteria 17786
183 Ga0105247_10003087 3300009101 Bacteria 11024
184 Ga0114129_10002016 3300009147 Bacteria 27842
185 Ga0114129_10082449 3300009147 Bacteria 4468
186 Ga0114129_10184733 3300009147 Bacteria 2834
187 Ga0114129_10235627 3300009147 Bacteria 2463
188 Ga0105243_10056333 3300009148 Bacteria 3126
189 Ga0105241_10016185 3300009174 Bacteria 5465
190 Ga0105241_10103544 3300009174 Bacteria 2267
191 Ga0105241_10396901 3300009174 Bacteria 1209
192 Ga0105241_10423198 3300009174 Bacteria 1172
193 Ga0105242_10002857 3300009176 Bacteria 13535
194 Ga0105242_10246197 3300009176 Bacteria 1609
195 Ga0105248_10000246 3300009177 Bacteria 62735
196 Ga0105248_10000737 3300009177 Bacteria 36805
197 Ga0105248_10002984 3300009177 Bacteria 18755
198 Ga0105248_10007814 3300009177 Bacteria 11742
199 Ga0105248_10030718 3300009177 Bacteria 6000
200 Ga0105248_10128872 3300009177 Bacteria 2854
201 Ga0105248_10192488 3300009177 Bacteria 2298
202 Ga0105237_10000231 3300009545 Bacteria 79368
203 Ga0105237_10042595 3300009545 Bacteria 4577
204 Ga0105238_10043984 3300009551 Bacteria 4517
205 Ga0105238_10069286 3300009551 Bacteria 3528
206 Ga0105238_10075907 3300009551 Bacteria 3353
207 Ga0105238_10101210 3300009551 Bacteria 2864
208 Ga0105249_10012997 3300009553 Bacteria 7347
209 Ga0105249_10047251 3300009553 Bacteria 3922
210 Ga0105249_10126611 3300009553 Bacteria 2433
211 Ga0105249_10522246 3300009553 Bacteria 1235
212 Ga0105030_100177 3300009987 Bacteria 5345
213 Ga0105239_10086212 3300010375 Bacteria 3461
214 Ga0105239_10086491 3300010375 Bacteria 3455
215 Ga0105239_10122767 3300010375 Bacteria 2886
216 Ga0105239_10370899 3300010375 Bacteria 1618
217 Ga0105239_10420777 3300010375 Bacteria 1513
218 Ga0105239_10589430 3300010375 Bacteria 1268
219 Ga0157370_10087455 3300013104 Bacteria 2927
220 Ga0157369_10381666 3300013105 Bacteria 1463
221 Ga0157374_10021862 3300013296 Bacteria 5700
222 Ga0157374_10214705 3300013296 Bacteria 1887
223 Ga0157378_10006173 3300013297 Bacteria 10486
224 Ga0157378_10008041 3300013297 Bacteria 9205
225 Ga0157378_10402521 3300013297 Bacteria 1349
226 Ga0163162_10009859 3300013306 Bacteria 9292
227 Ga0163162_10013831 3300013306 Bacteria 7884
228 Ga0163162_10063754 3300013306 Bacteria 3729
229 Ga0163162_10084864 3300013306 Bacteria 3243
230 Ga0157375_10034395 3300013308 Bacteria 4828
231 Ga0157375_10071045 3300013308 Bacteria 3493
232 Ga0157375_10090982 3300013308 Bacteria 3111
233 Ga0157375_10093775 3300013308 Bacteria 3068
234 Ga0157375_10321490 3300013308 Bacteria 1712
235 Ga0157514_117819 3300013874 Bacteria 1399
236 Ga0163163_10006892 3300014325 Bacteria 9972
237 Ga0163163_10007177 3300014325 Bacteria 9807
238 Ga0163163_10022048 3300014325 Bacteria 6023
239 Ga0163163_10155715 3300014325 Bacteria 2329
240 Ga0157380_10212372 3300014326 Bacteria 1725
241 Ga0157380_10334370 3300014326 Bacteria 1410
242 Ga0157380_10553380 3300014326 Bacteria 1129
243 Ga0157377_10120278 3300014745 Bacteria 1591
244 Ga0157379_10000582 3300014968 Bacteria 29612
245 Ga0157379_10013160 3300014968 Bacteria 7243
246 Ga0157379_10020478 3300014968 Bacteria 5848
247 Ga0157379_10066258 3300014968 Bacteria 3228
248 Ga0157376_10005475 3300014969 Bacteria 8876
249 Ga0157376_10258612 3300014969 Bacteria 1630
250 Ga0157376_10433034 3300014969 Bacteria 1279
251 Ga0207427_100078 3300025231 Bacteria 147526
252 Ga0209437_100269 3300025233 Bacteria 78465
253 Ga0209233_1000077 3300025261 Bacteria 349570
254 Ga0209025_1000006 3300025294 Bacteria 1153444
255 Ga0209758_1020489 3300025297 Bacteria 3126
256 Ga0209257_1000320 3300025304 Bacteria 100514
257 Ga0207656_10009788 3300025321 Bacteria 3566
258 Ga0207682_10009865 3300025893 Bacteria 3755
259 Ga0207710_10000476 3300025900 Bacteria 25539
260 Ga0207688_10014218 3300025901 Bacteria 4331
261 Ga0207680_10001143 3300025903 Bacteria 12531
262 Ga0207680_10127942 3300025903 Bacteria 1670
263 Ga0207680_10237765 3300025903 Bacteria 1254
264 Ga0207647_10000023 3300025904 Bacteria 115648
265 Ga0207685_10068553 3300025905 Bacteria 1430
266 Ga0207699_10009931 3300025906 Bacteria 4758
267 Ga0207699_10085935 3300025906 Bacteria 1963
268 Ga0207699_10200999 3300025906 Bacteria 1350
269 Ga0207645_10001854 3300025907 Bacteria 17042
270 Ga0207643_10017461 3300025908 Bacteria 3924
271 Ga0207654_10032951 3300025911 Bacteria 2868
272 Ga0207707_10155488 3300025912 Bacteria 2000
273 Ga0207695_10124934 3300025913 Bacteria 2537
274 Ga0207671_10059103 3300025914 Bacteria 2842
275 Ga0207671_10149582 3300025914 Bacteria 1804
276 Ga0207693_10057352 3300025915 Bacteria 3052
277 Ga0207663_10040104 3300025916 Bacteria 2843
278 Ga0207663_10141261 3300025916 Bacteria 1678
279 Ga0207660_10104230 3300025917 Bacteria 2123
280 Ga0207662_10019974 3300025918 Bacteria 3818
281 Ga0207652_10298171 3300025921 Bacteria 1455
282 Ga0207646_10050906 3300025922 Bacteria 3706
283 Ga0207646_10198919 3300025922 Bacteria 1810
284 Ga0207681_10001838 3300025923 Bacteria 13602
285 Ga0207681_10072512 3300025923 Bacteria 2405
286 Ga0207694_10001346 3300025924 Bacteria 21151
287 Ga0207694_10014918 3300025924 Bacteria 5861
288 Ga0207650_10244520 3300025925 Bacteria 1451
289 Ga0207650_10294493 3300025925 Bacteria 1324
290 Ga0207659_10020124 3300025926 Bacteria 4405
291 Ga0207659_10069091 3300025926 Bacteria 2571
292 Ga0207659_10070286 3300025926 Bacteria 2553
293 Ga0207687_10246324 3300025927 Bacteria 1419
294 Ga0207687_10248435 3300025927 Bacteria 1413
295 Ga0207700_10026226 3300025928 Bacteria 4061
296 Ga0207700_10138844 3300025928 Bacteria 1994
297 Ga0207664_10152129 3300025929 Bacteria 1966
298 Ga0207664_10423546 3300025929 Bacteria 1186
299 Ga0207644_10008675 3300025931 Bacteria 6651
300 Ga0207644_10147475 3300025931 Bacteria 1818
301 Ga0207644_10150385 3300025931 Bacteria 1801
302 Ga0207690_10372913 3300025932 Bacteria 1132
303 Ga0207706_10001054 3300025933 Bacteria 28009
304 Ga0207706_10131782 3300025933 Bacteria 2199
305 Ga0207706_10308168 3300025933 Bacteria 1379
306 Ga0207686_10071184 3300025934 Bacteria 2237
307 Ga0207709_10176742 3300025935 Bacteria 1504
308 Ga0207670_10042765 3300025936 Bacteria 2987
309 Ga0207669_10009963 3300025937 Bacteria 4554
310 Ga0207669_10184568 3300025937 Bacteria 1499
311 Ga0207704_10002135 3300025938 Bacteria 8867
312 Ga0207704_10121346 3300025938 Bacteria 1789
313 Ga0207665_10002370 3300025939 Bacteria 12728
314 Ga0207665_10102047 3300025939 Bacteria 2004
315 Ga0207691_10003801 3300025940 Bacteria 14652
316 Ga0207691_10039626 3300025940 Bacteria 4359
317 Ga0207691_10043987 3300025940 Bacteria 4113
318 Ga0207691_10092581 3300025940 Bacteria 2707
319 Ga0207691_10116662 3300025940 Bacteria 2369
320 Ga0207711_10004050 3300025941 Bacteria 12578
321 Ga0207711_10006169 3300025941 Bacteria 10129
322 Ga0207711_10007272 3300025941 Bacteria 9280
323 Ga0207711_10008374 3300025941 Bacteria 8653
324 Ga0207711_10084500 3300025941 Bacteria 2778
325 Ga0207711_10164705 3300025941 Bacteria 2009
326 Ga0207689_10000420 3300025942 Bacteria 39774
327 Ga0207689_10030636 3300025942 Bacteria 4483
328 Ga0207679_10049986 3300025945 Bacteria 3052
329 Ga0207667_10085523 3300025949 Bacteria 3265
330 Ga0207651_10046175 3300025960 Bacteria 2927
331 Ga0207712_10000497 3300025961 Bacteria 32461
332 Ga0207712_10001195 3300025961 Bacteria 17947
333 Ga0207712_10009947 3300025961 Bacteria 6028
334 Ga0207712_10065522 3300025961 Unclassified 2593
335 Ga0207712_10080046 3300025961 Bacteria 2375
336 Ga0207712_10124647 3300025961 Bacteria 1954
337 Ga0207668_10010396 3300025972 Bacteria 5622
338 Ga0207668_10039821 3300025972 Bacteria 3167
339 Ga0207640_10106669 3300025981 Bacteria 1976
340 Ga0207658_10000013 3300025986 Bacteria 220396
341 Ga0207658_10026416 3300025986 Bacteria 4070
342 Ga0207658_10034373 3300025986 Bacteria 3623
343 Ga0207658_10083471 3300025986 Bacteria 2455
344 Ga0207658_10319061 3300025986 Bacteria 1344
345 Ga0207658_10331814 3300025986 Bacteria 1319
346 Ga0207677_10070579 3300026023 Bacteria 2462
347 Ga0207677_10254928 3300026023 Bacteria 1427
348 Ga0207703_10000903 3300026035 Bacteria 29058
349 Ga0207703_10002516 3300026035 Bacteria 15842
350 Ga0207703_10003172 3300026035 Bacteria 13856
351 Ga0207703_10021796 3300026035 Bacteria 5016
352 Ga0207703_10130916 3300026035 Bacteria 2166
353 Ga0207639_10000358 3300026041 Bacteria 31541
354 Ga0207639_10051992 3300026041 Bacteria 3119
355 Ga0207639_10145763 3300026041 Bacteria 1978
356 Ga0207678_10000035 3300026067 Bacteria 104807
357 Ga0207678_10008148 3300026067 Bacteria 9240
358 Ga0207678_10018584 3300026067 Bacteria 6103
359 Ga0207708_10048235 3300026075 Bacteria 3242
360 Ga0207708_10097390 3300026075 Bacteria 2273
361 Ga0207708_10100968 3300026075 Bacteria 2233
362 Ga0207702_10025571 3300026078 Bacteria 4901
363 Ga0207702_10119662 3300026078 Bacteria 2355
364 Ga0207641_10010239 3300026088 Bacteria 7712
365 Ga0207641_10042392 3300026088 Bacteria 3818
366 Ga0207641_10088545 3300026088 Bacteria 2703
367 Ga0207641_10340581 3300026088 Bacteria 1427
368 Ga0207641_10624679 3300026088 Bacteria 1056
369 Ga0207648_10002529 3300026089 Bacteria 19616
370 Ga0207648_10022290 3300026089 Bacteria 5690
371 Ga0207648_10101818 3300026089 Bacteria 2517
372 Ga0207676_10013978 3300026095 Bacteria 5762
373 Ga0207676_10096813 3300026095 Bacteria 2437
374 Ga0207674_10028258 3300026116 Bacteria 5921
375 Ga0207674_10220162 3300026116 Bacteria 1846
376 Ga0207675_100001375 3300026118 Bacteria 24392
377 Ga0207675_100001538 3300026118 Bacteria 23106
378 Ga0207675_100005535 3300026118 Bacteria 12079
379 Ga0207675_100592945 3300026118 Bacteria 1110
380 Ga0207683_10002153 3300026121 Bacteria 17293
381 Ga0207683_10409917 3300026121 Bacteria 1247
382 Ga0207698_10260319 3300026142 Bacteria 1593
383 Ga0209967_1005804 3300027364 Bacteria 1667
384 Ga0209179_1019016 3300027512 Bacteria 1318
385 Ga0209982_1001490 3300027552 Bacteria 3208
386 Ga0209970_1002881 3300027614 Bacteria 2901
387 Ga0209970_1016975 3300027614 Bacteria 1217
388 Ga0209983_1006498 3300027665 Bacteria 2399
389 Ga0209971_1000146 3300027682 Bacteria 21299
390 Ga0209971_1044146 3300027682 Bacteria 1074
391 Ga0209998_10003678 3300027717 Bacteria 3324
392 Ga0209974_10000982 3300027876 Bacteria 10016
393 Ga0207428_10006228 3300027907 Bacteria 11027
394 Ga0207428_10040358 3300027907 Bacteria 3787
395 Ga0207428_10043466 3300027907 Bacteria 3628
396 Ga0268266_10000013 3300028379 Bacteria 649715
397 Ga0268266_10047960 3300028379 Bacteria 3661
398 Ga0268266_10075018 3300028379 Bacteria 2937
399 Ga0268265_10000265 3300028380 Bacteria 59618
400 Ga0268265_10004411 3300028380 Bacteria 9777
401 Ga0268264_10017578 3300028381 Bacteria 5856
402 Ga0268264_10017949 3300028381 Bacteria 5788
403 Ga0268264_10054196 3300028381 Bacteria 3348
404 Ga0268264_10187951 3300028381 Bacteria 1881
405 Ga0268264_10380589 3300028381 Bacteria 1351
406 Ga0307515_10000037 3300028794 Bacteria 331970
407 Ga0307515_10001585 3300028794 Bacteria 50742
408 Ga0307515_10034838 3300028794 Bacteria 8220
409 Ga0307511_10000770 3300030521 Bacteria 34194
410 Ga0307511_10009742 3300030521 Bacteria 9564
411 Ga0316177_1212585 3300030731 Bacteria 2330
412 Ga0314311_1053136 3300030733 Bacteria 3107
413 Ga0316178_1144806 3300030735 Bacteria 2655
414 Ga0316182_1301532 3300030745 Bacteria 1227
415 Ga0265760_10012825 3300031090 Bacteria 2398
416 Ga0265760_10032301 3300031090 Bacteria 1545
417 Ga0265328_10036166 3300031239 Bacteria 1825
418 Ga0265320_10045306 3300031240 Bacteria 2162
419 Ga0265316_10020329 3300031344 Bacteria 5654
420 Ga0307513_10009095 3300031456 Bacteria 12593
421 Ga0307513_10042642 3300031456 Bacteria 4993
422 Ga0307513_10249012 3300031456 Bacteria 1575
423 Ga0307509_10000027 3300031507 Bacteria 228470
424 Ga0307408_100044630 3300031548 Bacteria 3160
425 Ga0307408_100064093 3300031548 Bacteria 2690
426 Ga0307408_100236624 3300031548 Bacteria 1499
427 Ga0307408_100285769 3300031548 Bacteria 1375
428 Ga0307508_10059173 3300031616 Bacteria 3389
429 Ga0307514_10134047 3300031649 Bacteria 1699
430 Ga0316579_10077429 3300031691 Bacteria 1581
431 Ga0316576_10042024 3300031727 Bacteria 3293
432 Ga0316578_10050637 3300031728 Bacteria 2430
433 Ga0307516_10000124 3300031730 Bacteria 90831
434 Ga0307405_10010532 3300031731 Bacteria 4799
435 Ga0307413_10131216 3300031824 Bacteria 1715
436 Ga0307410_10123941 3300031852 Bacteria 1888
437 Ga0307410_10156899 3300031852 Bacteria 1701
438 Ga0307410_10266439 3300031852 Bacteria 1338
439 Ga0307406_10086940 3300031901 Bacteria 2094
440 Ga0307406_10118447 3300031901 Bacteria 1836
441 Ga0307406_10185926 3300031901 Bacteria 1517
442 Ga0307406_10187950 3300031901 Bacteria 1510
443 Ga0307407_10082493 3300031903 Bacteria 1948
444 Ga0307412_10090193 3300031911 Bacteria 2142
445 Ga0307412_10216181 3300031911 Bacteria 1466
446 Ga0307409_100394056 3300031995 Bacteria 1320
447 Ga0307416_100093696 3300032002 Bacteria 2588
448 Ga0307416_100229109 3300032002 Bacteria 1789
449 Ga0307416_100329266 3300032002 Bacteria 1534
450 Ga0307414_10001460 3300032004 Bacteria 12275
451 Ga0307414_10078205 3300032004 Bacteria 2410
452 Ga0307414_10130620 3300032004 Bacteria 1949
453 Ga0307411_10056262 3300032005 Bacteria 2592
454 Ga0307411_10126842 3300032005 Bacteria 1857
455 Ga0307415_100001747 3300032126 Bacteria 10595
456 Ga0307415_100236682 3300032126 Bacteria 1474
457 Ga0316585_10019900 3300032137 Bacteria 2050
458 Ga0316580_10008031 3300032139 Bacteria 3156
459 Ga0307507_10190134 3300033179 Bacteria 1445
460 Ga0307510_10040563 3300033180 Bacteria 5108
461 Ga0373936_0011954 3300035113 Bacteria 3295
462 Ga0373936_0049973 3300035113 Unclassified 1690
463 Ga0373953_0011392 3300035117 Bacteria 3121
464 Ga0373954_0021707 3300035118 Bacteria 2908
465 Ga0373956_0024990 3300035119 Bacteria 2579
466 Ga0373943_0024951 3300035170 Bacteria 2791
467 Ga0373946_0048063 3300035171 Bacteria 1775
468 Ga0373946_0210728 3300035171 Bacteria 935
469 Ga0373955_0003163 3300035172 Bacteria 7205
470 Ga0316574_0008937 3300035398 Bacteria 5593
471 Ga0316574_0027044 3300035398 Bacteria 3453
472 Ga0373924_0076498 3300035410 Bacteria 1418
473 Ga0373927_0005121 3300035695 Bacteria 9071
474 Ga0373947_0114530 3300035725 Bacteria 1708
475 Ga0373937_0167084 3300036401 Bacteria 2063
476 Ga0373937_0211916 3300036401 Bacteria 1823
477 Ga0316582_0016320 3300036647 Bacteria 4269
478 Ga0316584_0052157 3300036712 Bacteria 3059
479 Ga0373925_0392282 3300037068 Bacteria 1131
480 Ga0395905_0387890 3300037471 Bacteria 1291
481 Ga0436365_0070472 3300039437 Bacteria 3727
482 Ga0436360_0224161 3300039438 Bacteria 5586
483 Ga0436360_0301134 3300039438 Bacteria 18034
484 Ga0436363_0111232 3300039450 Bacteria 6624
485 Ga0436363_1716318 3300039450 Bacteria 12929
486 Ga0436362_0385862 3300039453 Bacteria 1218
487 Ga0436362_0749119 3300039453 Bacteria 4045
488 Ga0439436_0012024 3300041404 Bacteria 2628
489 Ga0439439_0000514 3300041406 Bacteria 6699
490 Ga0439447_001277 3300041407 Bacteria 9165
491 Ga0439461_0029806 3300041410 Bacteria 1131
492 Ga0439465_0000082 3300041413 Bacteria 20853
493 Ga0439465_0006147 3300041413 Bacteria 3818
494 Ga0451787_431538 3300041441 Bacteria 1860
495 Ga0451798_0667076 3300041458 Bacteria 1165
496 Ga0451807_1932045 3300041486 Bacteria 1748
497 Ga0451837_0168380 3300041494 Bacteria 2146
498 Ga0451837_0313789 3300041494 Bacteria 3885
499 Ga0451837_0564735 3300041494 Bacteria 2038
500 Ga0451843_0368400 3300041509 Bacteria 3428
501 Ga0451843_0657080 3300041509 Bacteria 2346
502 Ga0439445_0000501 3300042004 Bacteria 7958
503 Ga0439445_0021552 3300042004 Bacteria 1619
504 Ga0439449_0000032 3300042007 Bacteria 41302
505 Ga0439449_0002771 3300042007 Bacteria 6817
506 Ga0439456_007190 3300042013 Bacteria 2283
507 Ga0439462_0003159 3300042015 Bacteria 3926
508 Ga0439462_0024343 3300042015 Bacteria 1590
509 Ga0439462_0034877 3300042015 Bacteria 1336
510 Ga0450912_004142 3300042116 Bacteria 1065
511 Ga0450920_001070 3300042122 Bacteria 4486
512 Ga0450923_003341 3300042125 Bacteria 2410
513 Ga0450894_004776 3300042131 Bacteria 1754
514 Ga0450895_000886 3300042132 Bacteria 1923
515 Ga0450896_001169 3300042133 Bacteria 3140
516 Ga0450896_005553 3300042133 Bacteria 1720
517 Ga0450898_030166 3300042134 Bacteria 992
518 Ga0450899_005738 3300042135 Bacteria 1337
519 Ga0450905_023132 3300042142 Bacteria 926
520 Ga0439446_0000164 3300042156 Bacteria 11604
521 Ga0439446_0001699 3300042156 Bacteria 5098
522 Ga0439446_0011568 3300042156 Bacteria 2399
523 Ga0450908_000154 3300042184 Bacteria 14278
524 Ga0450908_003399 3300042184 Bacteria 3091
525 Ga0439434_0007291 3300042435 Bacteria 3241
526 Ga0439434_0007927 3300042435 Bacteria 3114
527 Ga0439435_0001735 3300042436 Bacteria 4132
528 Ga0439435_0024303 3300042436 Bacteria 1598
529 Ga0439444_0000070 3300042437 Bacteria 7673
530 Ga0439460_0066883 3300042461 Bacteria 1106
531 Ga0451577_0031377 3300042876 Bacteria 4794
532 Ga0451577_0033382 3300042876 Bacteria 4639
533 Ga0451577_0101371 3300042876 Bacteria 2572
534 Ga0451577_0141000 3300042876 Bacteria 2166
535 Ga0453683_0012346 3300044673 Bacteria 5601
536 Ga0453684_0059426 3300044712 Bacteria 4928
537 Ga0451576_0072218 3300045051 Bacteria 3592
538 Ga0451576_0079329 3300045051 Bacteria 3416
539 Ga0451576_0223220 3300045051 Bacteria 1967
540 Ga0495638_0033613 3300046460 Bacteria 3279
541 Ga0495580_0000644 3300046472 Bacteria 29589
542 Ga0495580_0033449 3300046472 Bacteria 3704
543 Ga0495582_0073347 3300046473 Bacteria 1895
544 Ga0495607_0006481 3300046501 Bacteria 8233
545 Ga0495606_0057086 3300046507 Bacteria 2515
546 Ga0495616_0006294 3300046513 Bacteria 7202
547 Ga0495618_0039572 3300046514 Bacteria 2964
548 Ga0495630_0088465 3300046517 Bacteria 2339
549 Ga0495632_0015015 3300046519 Bacteria 4358
550 Ga0495663_0001923 3300046525 Bacteria 6396
551 Ga0495663_0016887 3300046525 Bacteria 2066
552 Ga0495652_0176366 3300046529 Bacteria 1645
553 Ga0495654_0040084 3300046530 Bacteria 2336
554 Ga0495665_0052347 3300046531 Bacteria 2161
555 Ga0495656_0003475 3300046615 Bacteria 5328
556 Ga0495668_0001998 3300046616 Bacteria 17828
557 Ga0495625_0220610 3300046660 Unclassified 1243
558 Ga0495658_0098053 3300046683 Bacteria 1746
559 Ga0495671_0010623 3300046692 Bacteria 5092
560 Ga0495636_0012071 3300047318 Bacteria 3423
561 Ga0495674_0068819 3300047319 Bacteria 3063
562 Ga0495687_039914 3300047443 Bacteria 2073
563 Ga0495687_042586 3300047443 Bacteria 1983
564 Ga0495681_0060317 3300047470 Bacteria 1751
565 Ga0495686_0005221 3300047472 Bacteria 10319
566 Ga0495686_0009853 3300047472 Bacteria 6849
567 Ga0495686_0140710 3300047472 Bacteria 1424
568 Ga0496100_0028539 3300048903 Bacteria 3442
569 Ga0496100_0100353 3300048903 Bacteria 1994
570 Ga0496101_0014924 3300048904 Bacteria 5226
571 Ga0496101_0158631 3300048904 Bacteria 1734
572 Ga0496102_0017596 3300048905 Bacteria 6263
573 Ga0496102_0024722 3300048905 Bacteria 5342
574 Ga0496102_0030471 3300048905 Bacteria 4829
575 Ga0496103_0392308 3300048906 Bacteria 892
576 Ga0496104_0024382 3300048907 Bacteria 5564
577 Ga0496104_0048421 3300048907 Bacteria 4007
578 Ga0496104_0083406 3300048907 Bacteria 3048
579 Ga0496105_0006655 3300048908 Bacteria 8895
580 Ga0496105_0025846 3300048908 Bacteria 4783
581 Ga0496105_0075079 3300048908 Bacteria 2792
582 Ga0496106_0018939 3300048909 Bacteria 5099
583 Ga0496106_0216277 3300048909 Bacteria 1527
584 Ga0496106_0472856 3300048909 Bacteria 1007
585 Ga0496107_0048752 3300048910 Bacteria 3052
586 Ga0496107_0049854 3300048910 Bacteria 3017
587 Ga0496108_0007699 3300048911 Bacteria 8726
588 Ga0496108_0037739 3300048911 Bacteria 4025
589 Ga0496108_0081456 3300048911 Bacteria 2743
590 Ga0496109_0008990 3300048912 Bacteria 8507
591 Ga0496109_0023299 3300048912 Bacteria 5494
592 Ga0496110_0004795 3300048913 Bacteria 10531
593 Ga0496110_0127191 3300048913 Bacteria 2299
594 Ga0496111_0006835 3300048914 Bacteria 7440
595 Ga0496111_0023774 3300048914 Bacteria 4305
596 Ga0496112_0015409 3300048915 Bacteria 7134
597 Ga0496112_0036629 3300048915 Bacteria 4787
598 Ga0496112_0175307 3300048915 Bacteria 2109
599 Ga0496112_0182713 3300048915 Bacteria 2061
600 Ga0496113_0056328 3300048916 Bacteria 2951
601 Ga0496114_0005482 3300048917 Bacteria 9930
602 Ga0496114_0005933 3300048917 Bacteria 9602
603 Ga0496114_0074719 3300048917 Bacteria 2853
604 Ga0496114_0129251 3300048917 Bacteria 2180
605 Ga0496115_0315863 3300048918 Bacteria 1278
606 Ga0496119_0003056 3300048922 Bacteria 17701
607 Ga0496120_0000106 3300048923 Bacteria 140132
608 Ga0496121_0003518 3300048924 Bacteria 22236
609 Ga0496121_0207174 3300048924 Bacteria 1392
610 Ga0496122_0000062 3300048925 Bacteria 241387
611 Ga0496122_0036620 3300048925 Bacteria 3963
612 Ga0496123_0003624 3300048926 Bacteria 17095
613 Ga0496124_0000018 3300048927 Bacteria 442940
614 Ga0496125_0001682 3300048928 Bacteria 30939
615 Ga0496125_0008883 3300048928 Bacteria 10435
616 Ga0496125_0169280 3300048928 Bacteria 1471
617 Ga0496126_0010089 3300048929 Bacteria 9961
618 Ga0496126_0047195 3300048929 Bacteria 3944
619 Ga0496126_0050926 3300048929 Bacteria 3773
620 Ga0496126_0054895 3300048929 Bacteria 3606
621 Ga0501031_0048098 3300049568 Bacteria 2780
622 Ga0501033_0177674 3300049570 Bacteria 1527
623 Ga0501034_0000535 3300049571 Bacteria 60322
624 Ga0501034_0001201 3300049571 Bacteria 35561
625 Ga0501036_0241845 3300049572 Bacteria 1513
626 Ga0501038_0094761 3300049574 Bacteria 2495
627 Ga0501038_0181659 3300049574 Bacteria 1697
628 Ga0501039_0002777 3300049575 Bacteria 13067
629 Ga0501039_0081272 3300049575 Bacteria 2523
630 Ga0501040_0015552 3300049576 Bacteria 5028
631 Ga0501040_0145313 3300049576 Bacteria 1672
632 Ga0501041_0003477 3300049577 Bacteria 9064
633 Ga0501041_0076763 3300049577 Bacteria 2055
634 Ga0501042_0131356 3300049578 Bacteria 1805
635 Ga0501042_0131567 3300049578 Bacteria 1803
636 Ga0501042_0154439 3300049578 Bacteria 1655
637 Ga0501043_0319071 3300049579 Bacteria 1185
638 Ga0501046_0348846 3300049580 Bacteria 1075
639 Ga0501048_0066269 3300049582 Bacteria 2553
640 Ga0501048_0089211 3300049582 Bacteria 2175
641 Ga0501068_0003148 3300049584 Bacteria 8838
642 Ga0501068_0035560 3300049584 Bacteria 2974
643 Ga0501068_0059770 3300049584 Bacteria 2314
644 Ga0501069_0014481 3300049585 Bacteria 4217
645 Ga0501069_0019608 3300049585 Bacteria 3659
646 Ga0501070_0005780 3300049586 Bacteria 10552
647 Ga0501071_0003130 3300049587 Bacteria 10277
648 Ga0501071_0042026 3300049587 Bacteria 3274
649 Ga0501071_0071428 3300049587 Bacteria 2530
650 Ga0501072_0004971 3300049588 Bacteria 10112
651 Ga0501072_0119005 3300049588 Bacteria 2104
652 Ga0501073_0185122 3300049589 Bacteria 1441
653 Ga0501074_0086613 3300049590 Bacteria 2244
654 Ga0501075_0001687 3300049591 Bacteria 14503
655 Ga0501075_0205900 3300049591 Bacteria 1501
656 Ga0501076_0101409 3300049592 Bacteria 2320
657 Ga0501076_0236033 3300049592 Bacteria 1495
658 Ga0501076_0322454 3300049592 Bacteria 1267
659 Ga0501076_0354315 3300049592 Bacteria 1205
660 Ga0501077_0110055 3300049593 Bacteria 1745
661 Ga0501077_0205025 3300049593 Bacteria 1253
662 Ga0501077_0291335 3300049593 Bacteria 1039
663 Ga0501225_0000494 3300049705 Bacteria 12289
664 Ga0501079_0007430 3300049741 Bacteria 8292
665 Ga0501079_0264102 3300049741 Bacteria 1345
666 Ga0501079_0420898 3300049741 Bacteria 1048
667 Ga0501080_0001700 3300049742 Bacteria 18781
668 Ga0501080_0270265 3300049742 Bacteria 1547
669 Ga0501080_0720171 3300049742 Bacteria 879
670 Ga0501081_0034252 3300049743 Bacteria 3454
671 Ga0501081_0119689 3300049743 Bacteria 1874
672 Ga0501083_0097188 3300049744 Bacteria 1943
673 Ga0501083_0190570 3300049744 Bacteria 1338
674 Ga0501035_0125224 3300049822 Bacteria 2243
675 Ga0501035_0263903 3300049822 Bacteria 1459
676 Ga0501044_0213735 3300049823 Bacteria 1882
677 Ga0501045_0002391 3300049824 Bacteria 12747
678 Ga0501045_0104561 3300049824 Bacteria 2098
679 Ga0501045_0203531 3300049824 Bacteria 1475
680 nmdc:mga05p37_16313_c1 3300050507 Bacteria 8942
681 nmdc:mga05p37_535989_c1 3300050507 Bacteria 1336
682 nmdc:mga09592_238721_c1 3300050508 Bacteria 1575
683 nmdc:mga09592_5514_c1 3300050508 Bacteria 10295
684 nmdc:mga09592_7046_c1 3300050508 Bacteria 9134
685 nmdc:mga0qj67_15753_c1 3300050509 Bacteria 4727
686 nmdc:mga0qj67_161091_c1 3300050509 Bacteria 1821
687 nmdc:mga0qj67_16660_c1 3300050509 Bacteria 5578
688 nmdc:mga0qj67_23320_c1 3300050509 Bacteria 4759
689 nmdc:mga06r32_13234_c1 3300050510 Bacteria 7472
690 nmdc:mga06r32_1723_c1 3300050510 Bacteria 19677
691 nmdc:mga06r32_2539_c1 3300050510 Bacteria 16326
692 nmdc:mga06r32_31296_c1 3300050510 Bacteria 4996
693 nmdc:mga06r32_76577_c1 3300050510 Bacteria 3249
694 nmdc:mga06r32_87556_c1 3300050510 Bacteria 3039
695 nmdc:mga08y16_182378_c1 3300050511 Bacteria 2179
696 nmdc:mga08y16_198450_c1 3300050511 Bacteria 2080
697 nmdc:mga08y16_412149_c1 3300050511 Bacteria 1382
698 nmdc:mga08y16_65821_c1 3300050511 Bacteria 3783
699 nmdc:mga08y16_66865_c1 3300050511 Bacteria 3751
700 nmdc:mga0n895_5285_c1 3300050512 Bacteria 10754
701 nmdc:mga0rr50_92098_c1 3300050513 Bacteria 2362
702 nmdc:mga0a205_3924_c1 3300050515 Bacteria 5308
703 Ga0500643_001459 3300053087 Bacteria 13601
704 Ga0500651_0000120 3300053093 Bacteria 48678
705 Ga0500597_000019 3300053120 Bacteria 34589
706 Ga0501084_0016881 3300054114 Bacteria 6066
707 Ga0501084_0145072 3300054114 Bacteria 1999
708 Ga0501082_0006793 3300060353 Bacteria 9887
709 Ga0501082_0027674 3300060353 Bacteria 4880
710 Ga0501082_0044022 3300060353 Bacteria 3851
711 Ga0501082_0058242 3300060353 Bacteria 3328
712 Ga0501082_0251155 3300060353 Bacteria 1539
713 Ga0530510_0073659 3300061734 Bacteria 2479
714 Ga0530510_0180775 3300061734 Bacteria 1564

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100564744 Ga0068864_1005647441 246
2 3300035398 Ga0316574_0008937 Ga0316574_0008937_200_1021 258
3 3300042142 Ga0450905_023132 Ga0450905_023132_62_844 260
4 3300026041 Ga0207639_10145763 Ga0207639_101457632 263
5 3300050509 nmdc:mga0qj67_23320_c1 nmdc:mga0qj67_23320_c1_401_1192 263
6 3300050510 nmdc:mga06r32_31296_c1 nmdc:mga06r32_31296_c1_731_1522 263
7 3300006847 Ga0075431_100056420 Ga0075431_10005642010 265
8 3300007788 Ga0099795_10000223 Ga0099795_100002234 265
9 3300009176 Ga0105242_10246197 Ga0105242_102461972 265
10 3300009177 Ga0105248_10128872 Ga0105248_101288722 265
11 3300009551 Ga0105238_10069286 Ga0105238_100692862 265
12 3300013296 Ga0157374_10021862 Ga0157374_100218623 265
13 3300013297 Ga0157378_10008041 Ga0157378_100080413 265
14 3300013306 Ga0163162_10063754 Ga0163162_100637542 265
15 3300013308 Ga0157375_10090982 Ga0157375_100909822 265
16 3300014968 Ga0157379_10000582 Ga0157379_1000058220 265
17 3300014969 Ga0157376_10005475 Ga0157376_100054756 265
18 3300036401 Ga0373937_0211916 Ga0373937_0211916_238_1035 265
19 3300048906 Ga0496103_0392308 Ga0496103_0392308_62_859 265
20 3300048909 Ga0496106_0472856 Ga0496106_0472856_49_846 265
21 3300048912 Ga0496109_0008990 Ga0496109_0008990_5126_5923 265
22 3300048913 Ga0496110_0127191 Ga0496110_0127191_658_1455 265
23 3300048905 Ga0496102_0017596 Ga0496102_0017596_4210_5049 268
24 3300031616 Ga0307508_10059173 Ga0307508_100591731 273
25 3300009094 Ga0111539_10000816 Ga0111539_1000081622 275
26 3300009177 Ga0105248_10192488 Ga0105248_101924882 275
27 3300009553 Ga0105249_10012997 Ga0105249_100129972 275
28 3300010375 Ga0105239_10589430 Ga0105239_105894302 275
29 3300014969 Ga0157376_10258612 Ga0157376_102586122 275
30 3300037471 Ga0395905_0387890 Ga0395905_0387890_371_1198 275
31 3300046519 Ga0495632_0015015 Ga0495632_0015015_1886_2713 275
32 3300048922 Ga0496119_0003056 Ga0496119_0003056_15754_16581 275
33 3300048923 Ga0496120_0000106 Ga0496120_0000106_128345_129172 275
34 3300048924 Ga0496121_0207174 Ga0496121_0207174_470_1297 275
35 3300048928 Ga0496125_0001682 Ga0496125_0001682_5937_6764 275
36 3300048929 Ga0496126_0047195 Ga0496126_0047195_2461_3288 275
37 3300050508 nmdc:mga09592_5514_c1 nmdc:mga09592_5514_c1_8870_9697 275
38 3300050510 nmdc:mga06r32_13234_c1 nmdc:mga06r32_13234_c1_743_1570 275
39 3300050511 nmdc:mga08y16_66865_c1 nmdc:mga08y16_66865_c1_1546_2373 275
40 iso_pu_bacteria 2643221579 2643908325 275
41 iso_pu_bacteria 2643221581 2643914622 275
42 iso_pu_bacteria 2923516293 2923517049 275
43 3300042007 Ga0439449_0002771 Ga0439449_0002771_874_1704 276
44 3300042015 Ga0439462_0034877 Ga0439462_0034877_339_1169 276
45 3300042156 Ga0439446_0011568 Ga0439446_0011568_253_1149 276
46 iso_pu_bacteria 2643221559 2643818461 276
47 iso_pu_bacteria 2643221573 2643880672 276
48 iso_pu_bacteria 2643221586 2643938398 276
49 iso_pu_bacteria 2643221612 2644079049 276
50 iso_pu_bacteria 2643221720 2644661243 276
51 iso_pu_bacteria 2643221727 2644693826 276
52 iso_pu_bacteria 2643221728 2644699320 276
53 iso_pu_bacteria 2842780639 2842781358 276
54 iso_pu_bacteria 8002869464 8002872379 276
55 3300005983 Ga0081540_1136257 Ga0081540_11362572 277
56 iso_pu_bacteria 2643221593 2643973165 277
57 3300005334 Ga0068869_100020047 Ga0068869_1000200474 278
58 3300005456 Ga0070678_100024718 Ga0070678_1000247182 278
59 3300005471 Ga0070698_100153532 Ga0070698_1001535321 278
60 3300025922 Ga0207646_10050906 Ga0207646_100509062 278
61 3300025940 Ga0207691_10039626 Ga0207691_100396263 278
62 3300025942 Ga0207689_10030636 Ga0207689_100306361 278
63 3300003316 rootH1_10102292 rootH1_101022923 279
64 3300003320 rootH2_10081999 rootH2_100819992 279
65 3300003322 rootL2_10033434 rootL2_100334342 279
66 3300003323 rootH1_10157784 rootH1_101577843 279
67 3300005289 Ga0065704_10144304 Ga0065704_101443041 279
68 3300005293 Ga0065715_10269957 Ga0065715_102699571 279
69 3300005330 Ga0070690_100007554 Ga0070690_1000075543 279
70 3300005330 Ga0070690_100041825 Ga0070690_1000418252 279
71 3300005335 Ga0070666_10003623 Ga0070666_100036232 279
72 3300005335 Ga0070666_10025604 Ga0070666_100256042 279
73 3300005338 Ga0068868_100018307 Ga0068868_1000183077 279
74 3300005338 Ga0068868_100030353 Ga0068868_1000303531 279
75 3300005340 Ga0070689_100524634 Ga0070689_1005246341 279
76 3300005347 Ga0070668_100088538 Ga0070668_1000885382 279
77 3300005353 Ga0070669_100185761 Ga0070669_1001857612 279
78 3300005355 Ga0070671_100001491 Ga0070671_10000149110 279
79 3300005355 Ga0070671_100050852 Ga0070671_1000508522 279
80 3300005355 Ga0070671_100140217 Ga0070671_1001402171 279
81 3300005356 Ga0070674_100004601 Ga0070674_1000046012 279
82 3300005364 Ga0070673_100053807 Ga0070673_1000538072 279
83 3300005364 Ga0070673_100055472 Ga0070673_1000554722 279
84 3300005366 Ga0070659_100298236 Ga0070659_1002982362 279
85 3300005367 Ga0070667_100007212 Ga0070667_1000072124 279
86 3300005367 Ga0070667_100030058 Ga0070667_1000300582 279
87 3300005367 Ga0070667_100141969 Ga0070667_1001419691 279
88 3300005434 Ga0070709_10001305 Ga0070709_100013057 279
89 3300005434 Ga0070709_10122021 Ga0070709_101220212 279
90 3300005435 Ga0070714_100004395 Ga0070714_1000043952 279
91 3300005436 Ga0070713_100006878 Ga0070713_1000068782 279
92 3300005436 Ga0070713_100073283 Ga0070713_1000732832 279
93 3300005436 Ga0070713_100102889 Ga0070713_1001028894 279
94 3300005437 Ga0070710_10003030 Ga0070710_100030305 279
95 3300005439 Ga0070711_100058968 Ga0070711_1000589682 279
96 3300005439 Ga0070711_100107743 Ga0070711_1001077431 279
97 3300005439 Ga0070711_100190015 Ga0070711_1001900152 279
98 3300005441 Ga0070700_100016722 Ga0070700_1000167223 279
99 3300005455 Ga0070663_100034907 Ga0070663_1000349072 279
100 3300005456 Ga0070678_100009491 Ga0070678_1000094913 279
101 3300005457 Ga0070662_100005675 Ga0070662_1000056756 279
102 3300005459 Ga0068867_100022309 Ga0068867_1000223093 279
103 3300005459 Ga0068867_100049470 Ga0068867_1000494702 279
104 3300005518 Ga0070699_100142595 Ga0070699_1001425952 279
105 3300005539 Ga0068853_100180333 Ga0068853_1001803332 279
106 3300005543 Ga0070672_100059954 Ga0070672_1000599544 279
107 3300005546 Ga0070696_100003241 Ga0070696_1000032415 279
108 3300005546 Ga0070696_100106770 Ga0070696_1001067702 279
109 3300005548 Ga0070665_100020954 Ga0070665_1000209544 279
110 3300005548 Ga0070665_100020971 Ga0070665_1000209712 279
111 3300005563 Ga0068855_100099729 Ga0068855_1000997292 279
112 3300005614 Ga0068856_100020255 Ga0068856_1000202552 279
113 3300005617 Ga0068859_100000602 Ga0068859_10000060220 279
114 3300005617 Ga0068859_100041015 Ga0068859_1000410151 279
115 3300005617 Ga0068859_100657588 Ga0068859_1006575882 279
116 3300005718 Ga0068866_10058368 Ga0068866_100583681 279
117 3300005718 Ga0068866_10076247 Ga0068866_100762472 279
118 3300005719 Ga0068861_100023236 Ga0068861_1000232364 279
119 3300005719 Ga0068861_100373367 Ga0068861_1003733672 279
120 3300005719 Ga0068861_100519936 Ga0068861_1005199361 279
121 3300005840 Ga0068870_10046151 Ga0068870_100461513 279
122 3300005841 Ga0068863_100002939 Ga0068863_1000029395 279
123 3300005841 Ga0068863_100036091 Ga0068863_1000360912 279
124 3300005841 Ga0068863_100072876 Ga0068863_1000728763 279
125 3300005841 Ga0068863_100155698 Ga0068863_1001556982 279
126 3300005842 Ga0068858_100000906 Ga0068858_10000090612 279
127 3300005842 Ga0068858_100000915 Ga0068858_1000009155 279
128 3300005842 Ga0068858_100074674 Ga0068858_1000746742 279
129 3300005842 Ga0068858_100303538 Ga0068858_1003035382 279
130 3300005843 Ga0068860_100007946 Ga0068860_1000079467 279
131 3300005843 Ga0068860_100013020 Ga0068860_1000130204 279
132 3300005844 Ga0068862_100032786 Ga0068862_1000327862 279
133 3300006028 Ga0070717_10004003 Ga0070717_100040036 279
134 3300006163 Ga0070715_10000861 Ga0070715_100008615 279
135 3300006173 Ga0070716_100000641 Ga0070716_1000006415 279
136 3300006173 Ga0070716_100256656 Ga0070716_1002566561 279
137 3300006175 Ga0070712_100004032 Ga0070712_1000040323 279
138 3300006175 Ga0070712_100022165 Ga0070712_1000221651 279
139 3300006175 Ga0070712_100058722 Ga0070712_1000587223 279
140 3300006237 Ga0097621_100012364 Ga0097621_1000123643 279
141 3300006358 Ga0068871_100073567 Ga0068871_1000735672 279
142 3300006844 Ga0075428_100039525 Ga0075428_1000395255 279
143 3300006844 Ga0075428_100121035 Ga0075428_1001210352 279
144 3300006846 Ga0075430_100185863 Ga0075430_1001858632 279
145 3300006880 Ga0075429_100219980 Ga0075429_1002199803 279
146 3300006881 Ga0068865_100057302 Ga0068865_1000573022 279
147 3300006881 Ga0068865_100105267 Ga0068865_1001052672 279
148 3300006931 Ga0097620_100000602 Ga0097620_10000060210 279
149 3300006931 Ga0097620_100041015 Ga0097620_1000410153 279
150 3300006931 Ga0097620_100657607 Ga0097620_1006576072 279
151 3300007788 Ga0099795_10002097 Ga0099795_100020972 279
152 3300009093 Ga0105240_10085603 Ga0105240_100856032 279
153 3300009094 Ga0111539_10093041 Ga0111539_100930412 279
154 3300009094 Ga0111539_10140685 Ga0111539_101406853 279
155 3300009094 Ga0111539_10737881 Ga0111539_107378812 279
156 3300009098 Ga0105245_10010409 Ga0105245_100104092 279
157 3300009098 Ga0105245_10010410 Ga0105245_100104106 279
158 3300009101 Ga0105247_10001357 Ga0105247_1000135710 279
159 3300009101 Ga0105247_10003087 Ga0105247_100030876 279
160 3300009147 Ga0114129_10235627 Ga0114129_102356272 279
161 3300009174 Ga0105241_10016185 Ga0105241_100161852 279
162 3300009174 Ga0105241_10396901 Ga0105241_103969012 279
163 3300009174 Ga0105241_10423198 Ga0105241_104231981 279
164 3300009176 Ga0105242_10002857 Ga0105242_100028578 279
165 3300009177 Ga0105248_10002984 Ga0105248_1000298413 279
166 3300009177 Ga0105248_10007814 Ga0105248_100078147 279
167 3300009177 Ga0105248_10030718 Ga0105248_100307182 279
168 3300009545 Ga0105237_10042595 Ga0105237_100425951 279
169 3300009551 Ga0105238_10075907 Ga0105238_100759072 279
170 3300009551 Ga0105238_10101210 Ga0105238_101012102 279
171 3300009553 Ga0105249_10126611 Ga0105249_101266112 279
172 3300009987 Ga0105030_100177 Ga0105030_1001772 279
173 3300010375 Ga0105239_10086212 Ga0105239_100862122 279
174 3300010375 Ga0105239_10370899 Ga0105239_103708992 279
175 3300013105 Ga0157369_10381666 Ga0157369_103816662 279
176 3300013297 Ga0157378_10006173 Ga0157378_100061733 279
177 3300013306 Ga0163162_10013831 Ga0163162_100138316 279
178 3300013306 Ga0163162_10084864 Ga0163162_100848643 279
179 3300013308 Ga0157375_10034395 Ga0157375_100343954 279
180 3300013308 Ga0157375_10071045 Ga0157375_100710453 279
181 3300013874 Ga0157514_117819 Ga0157514_1178191 279
182 3300014325 Ga0163163_10006892 Ga0163163_100068923 279
183 3300014325 Ga0163163_10022048 Ga0163163_100220485 279
184 3300014325 Ga0163163_10155715 Ga0163163_101557152 279
185 3300014326 Ga0157380_10334370 Ga0157380_103343702 279
186 3300014968 Ga0157379_10013160 Ga0157379_100131605 279
187 3300014968 Ga0157379_10020478 Ga0157379_100204783 279
188 3300014968 Ga0157379_10066258 Ga0157379_100662582 279
189 3300025893 Ga0207682_10009865 Ga0207682_100098655 279
190 3300025900 Ga0207710_10000476 Ga0207710_100004768 279
191 3300025903 Ga0207680_10127942 Ga0207680_101279422 279
192 3300025903 Ga0207680_10237765 Ga0207680_102377651 279
193 3300025905 Ga0207685_10068553 Ga0207685_100685531 279
194 3300025906 Ga0207699_10009931 Ga0207699_100099313 279
195 3300025906 Ga0207699_10085935 Ga0207699_100859352 279
196 3300025906 Ga0207699_10200999 Ga0207699_102009992 279
197 3300025907 Ga0207645_10001854 Ga0207645_1000185416 279
198 3300025908 Ga0207643_10017461 Ga0207643_100174615 279
199 3300025914 Ga0207671_10149582 Ga0207671_101495821 279
200 3300025915 Ga0207693_10057352 Ga0207693_100573522 279
201 3300025916 Ga0207663_10040104 Ga0207663_100401042 279
202 3300025916 Ga0207663_10141261 Ga0207663_101412611 279
203 3300025917 Ga0207660_10104230 Ga0207660_101042303 279
204 3300025922 Ga0207646_10198919 Ga0207646_101989193 279
205 3300025923 Ga0207681_10072512 Ga0207681_100725123 279
206 3300025924 Ga0207694_10014918 Ga0207694_100149182 279
207 3300025927 Ga0207687_10246324 Ga0207687_102463242 279
208 3300025927 Ga0207687_10248435 Ga0207687_102484352 279
209 3300025928 Ga0207700_10026226 Ga0207700_100262261 279
210 3300025928 Ga0207700_10138844 Ga0207700_101388442 279
211 3300025929 Ga0207664_10152129 Ga0207664_101521292 279
212 3300025929 Ga0207664_10423546 Ga0207664_104235461 279
213 3300025931 Ga0207644_10008675 Ga0207644_100086752 279
214 3300025931 Ga0207644_10147475 Ga0207644_101474752 279
215 3300025931 Ga0207644_10150385 Ga0207644_101503852 279
216 3300025933 Ga0207706_10001054 Ga0207706_100010543 279
217 3300025934 Ga0207686_10071184 Ga0207686_100711842 279
218 3300025937 Ga0207669_10009963 Ga0207669_100099632 279
219 3300025937 Ga0207669_10184568 Ga0207669_101845681 279
220 3300025938 Ga0207704_10002135 Ga0207704_100021354 279
221 3300025939 Ga0207665_10002370 Ga0207665_100023708 279
222 3300025939 Ga0207665_10102047 Ga0207665_101020471 279
223 3300025940 Ga0207691_10003801 Ga0207691_100038015 279
224 3300025940 Ga0207691_10043987 Ga0207691_100439873 279
225 3300025941 Ga0207711_10004050 Ga0207711_100040503 279
226 3300025941 Ga0207711_10007272 Ga0207711_100072728 279
227 3300025941 Ga0207711_10084500 Ga0207711_100845002 279
228 3300025941 Ga0207711_10164705 Ga0207711_101647052 279
229 3300025949 Ga0207667_10085523 Ga0207667_100855232 279
230 3300025960 Ga0207651_10046175 Ga0207651_100461752 279
231 3300025961 Ga0207712_10065522 Ga0207712_100655222 279
232 3300025961 Ga0207712_10080046 Ga0207712_100800462 279
233 3300025986 Ga0207658_10026416 Ga0207658_100264162 279
234 3300025986 Ga0207658_10034373 Ga0207658_100343733 279
235 3300025986 Ga0207658_10083471 Ga0207658_100834712 279
236 3300026023 Ga0207677_10070579 Ga0207677_100705792 279
237 3300026035 Ga0207703_10000903 Ga0207703_100009036 279
238 3300026035 Ga0207703_10002516 Ga0207703_100025163 279
239 3300026035 Ga0207703_10130916 Ga0207703_101309163 279
240 3300026067 Ga0207678_10008148 Ga0207678_100081484 279
241 3300026075 Ga0207708_10097390 Ga0207708_100973903 279
242 3300026078 Ga0207702_10025571 Ga0207702_100255712 279
243 3300026078 Ga0207702_10119662 Ga0207702_101196622 279
244 3300026088 Ga0207641_10010239 Ga0207641_100102394 279
245 3300026088 Ga0207641_10042392 Ga0207641_100423922 279
246 3300026088 Ga0207641_10624679 Ga0207641_106246792 279
247 3300026089 Ga0207648_10002529 Ga0207648_1000252915 279
248 3300026089 Ga0207648_10022290 Ga0207648_100222903 279
249 3300026095 Ga0207676_10096813 Ga0207676_100968132 279
250 3300026118 Ga0207675_100005535 Ga0207675_10000553511 279
251 3300026118 Ga0207675_100592945 Ga0207675_1005929452 279
252 3300026121 Ga0207683_10002153 Ga0207683_100021532 279
253 3300026121 Ga0207683_10409917 Ga0207683_104099171 279
254 3300027364 Ga0209967_1005804 Ga0209967_10058042 279
255 3300027512 Ga0209179_1019016 Ga0209179_10190162 279
256 3300027552 Ga0209982_1001490 Ga0209982_10014902 279
257 3300027614 Ga0209970_1016975 Ga0209970_10169752 279
258 3300027665 Ga0209983_1006498 Ga0209983_10064982 279
259 3300027682 Ga0209971_1000146 Ga0209971_100014624 279
260 3300027717 Ga0209998_10003678 Ga0209998_100036784 279
261 3300027876 Ga0209974_10000982 Ga0209974_100009822 279
262 3300028379 Ga0268266_10047960 Ga0268266_100479601 279
263 3300028379 Ga0268266_10075018 Ga0268266_100750182 279
264 3300028381 Ga0268264_10017578 Ga0268264_100175784 279
265 3300028381 Ga0268264_10017949 Ga0268264_100179493 279
266 3300028381 Ga0268264_10187951 Ga0268264_101879512 279
267 3300030521 Ga0307511_10000770 Ga0307511_100007705 279
268 3300030521 Ga0307511_10009742 Ga0307511_100097424 279
269 3300031090 Ga0265760_10012825 Ga0265760_100128253 279
270 3300031090 Ga0265760_10032301 Ga0265760_100323012 279
271 3300031239 Ga0265328_10036166 Ga0265328_100361661 279
272 3300031240 Ga0265320_10045306 Ga0265320_100453062 279
273 3300031344 Ga0265316_10020329 Ga0265316_100203293 279
274 3300031456 Ga0307513_10042642 Ga0307513_100426422 279
275 3300031507 Ga0307509_10000027 Ga0307509_1000002718 279
276 3300031548 Ga0307408_100236624 Ga0307408_1002366242 279
277 3300031649 Ga0307514_10134047 Ga0307514_101340472 279
278 3300031730 Ga0307516_10000124 Ga0307516_1000012417 279
279 3300031852 Ga0307410_10156899 Ga0307410_101568991 279
280 3300032002 Ga0307416_100329266 Ga0307416_1003292661 279
281 3300033179 Ga0307507_10190134 Ga0307507_101901342 279
282 3300033180 Ga0307510_10040563 Ga0307510_100405632 279
283 3300035113 Ga0373936_0011954 Ga0373936_0011954_1420_2259 279
284 3300035113 Ga0373936_0049973 Ga0373936_0049973_168_1007 279
285 3300035117 Ga0373953_0011392 Ga0373953_0011392_1883_2722 279
286 3300035118 Ga0373954_0021707 Ga0373954_0021707_560_1399 279
287 3300035119 Ga0373956_0024990 Ga0373956_0024990_758_1597 279
288 3300035170 Ga0373943_0024951 Ga0373943_0024951_917_1756 279
289 3300035171 Ga0373946_0048063 Ga0373946_0048063_115_954 279
290 3300035171 Ga0373946_0210728 Ga0373946_0210728_64_903 279
291 3300035172 Ga0373955_0003163 Ga0373955_0003163_814_1653 279
292 3300035410 Ga0373924_0076498 Ga0373924_0076498_41_880 279
293 3300035695 Ga0373927_0005121 Ga0373927_0005121_3999_4838 279
294 3300035725 Ga0373947_0114530 Ga0373947_0114530_228_1067 279
295 3300036401 Ga0373937_0167084 Ga0373937_0167084_1142_1981 279
296 3300037068 Ga0373925_0392282 Ga0373925_0392282_115_954 279
297 3300039437 Ga0436365_0070472 Ga0436365_0070472_2443_3282 279
298 3300039438 Ga0436360_0224161 Ga0436360_0224161_2782_3621 279
299 3300039438 Ga0436360_0301134 Ga0436360_0301134_7031_7882 279
300 3300039450 Ga0436363_0111232 Ga0436363_0111232_3444_4283 279
301 3300039450 Ga0436363_1716318 Ga0436363_1716318_2416_3255 279
302 3300039453 Ga0436362_0385862 Ga0436362_0385862_65_904 279
303 3300039453 Ga0436362_0749119 Ga0436362_0749119_448_1287 279
304 3300041494 Ga0451837_0564735 Ga0451837_0564735_982_1821 279
305 3300042133 Ga0450896_005553 Ga0450896_005553_738_1577 279
306 3300042436 Ga0439435_0024303 Ga0439435_0024303_422_1261 279
307 3300042876 Ga0451577_0031377 Ga0451577_0031377_485_1324 279
308 3300042876 Ga0451577_0033382 Ga0451577_0033382_3396_4235 279
309 3300042876 Ga0451577_0101371 Ga0451577_0101371_693_1532 279
310 3300042876 Ga0451577_0141000 Ga0451577_0141000_1102_1941 279
311 3300044673 Ga0453683_0012346 Ga0453683_0012346_3856_4695 279
312 3300044712 Ga0453684_0059426 Ga0453684_0059426_2500_3339 279
313 3300045051 Ga0451576_0079329 Ga0451576_0079329_752_1591 279
314 3300046472 Ga0495580_0000644 Ga0495580_0000644_5508_6347 279
315 3300046472 Ga0495580_0033449 Ga0495580_0033449_2830_3669 279
316 3300046473 Ga0495582_0073347 Ga0495582_0073347_626_1465 279
317 3300046513 Ga0495616_0006294 Ga0495616_0006294_909_1748 279
318 3300046514 Ga0495618_0039572 Ga0495618_0039572_1214_2053 279
319 3300046517 Ga0495630_0088465 Ga0495630_0088465_1124_1963 279
320 3300046529 Ga0495652_0176366 Ga0495652_0176366_362_1201 279
321 3300046531 Ga0495665_0052347 Ga0495665_0052347_544_1383 279
322 3300046683 Ga0495658_0098053 Ga0495658_0098053_695_1534 279
323 3300047319 Ga0495674_0068819 Ga0495674_0068819_1059_1898 279
324 3300047443 Ga0495687_039914 Ga0495687_039914_1130_1969 279
325 3300047443 Ga0495687_042586 Ga0495687_042586_885_1724 279
326 3300047472 Ga0495686_0140710 Ga0495686_0140710_313_1152 279
327 3300048903 Ga0496100_0028539 Ga0496100_0028539_1671_2510 279
328 3300048903 Ga0496100_0100353 Ga0496100_0100353_749_1588 279
329 3300048904 Ga0496101_0014924 Ga0496101_0014924_3675_4514 279
330 3300048904 Ga0496101_0158631 Ga0496101_0158631_707_1546 279
331 3300048905 Ga0496102_0024722 Ga0496102_0024722_4315_5154 279
332 3300048905 Ga0496102_0030471 Ga0496102_0030471_2904_3743 279
333 3300048907 Ga0496104_0024382 Ga0496104_0024382_2540_3379 279
334 3300048907 Ga0496104_0048421 Ga0496104_0048421_32_871 279
335 3300048907 Ga0496104_0083406 Ga0496104_0083406_169_1008 279
336 3300048908 Ga0496105_0006655 Ga0496105_0006655_3228_4067 279
337 3300048908 Ga0496105_0025846 Ga0496105_0025846_1919_2758 279
338 3300048908 Ga0496105_0075079 Ga0496105_0075079_438_1277 279
339 3300048909 Ga0496106_0018939 Ga0496106_0018939_1288_2127 279
340 3300048909 Ga0496106_0216277 Ga0496106_0216277_47_886 279
341 3300048910 Ga0496107_0048752 Ga0496107_0048752_731_1570 279
342 3300048910 Ga0496107_0049854 Ga0496107_0049854_966_1805 279
343 3300048911 Ga0496108_0007699 Ga0496108_0007699_5068_5907 279
344 3300048911 Ga0496108_0037739 Ga0496108_0037739_2608_3447 279
345 3300048913 Ga0496110_0004795 Ga0496110_0004795_4285_5124 279
346 3300048914 Ga0496111_0006835 Ga0496111_0006835_4866_5705 279
347 3300048914 Ga0496111_0023774 Ga0496111_0023774_1364_2203 279
348 3300048915 Ga0496112_0015409 Ga0496112_0015409_4829_5668 279
349 3300048915 Ga0496112_0036629 Ga0496112_0036629_3228_4067 279
350 3300048915 Ga0496112_0175307 Ga0496112_0175307_14_853 279
351 3300048917 Ga0496114_0005482 Ga0496114_0005482_389_1228 279
352 3300048917 Ga0496114_0005933 Ga0496114_0005933_4514_5353 279
353 3300048917 Ga0496114_0074719 Ga0496114_0074719_1312_2151 279
354 3300048918 Ga0496115_0315863 Ga0496115_0315863_115_954 279
355 3300048924 Ga0496121_0003518 Ga0496121_0003518_11587_12426 279
356 3300048928 Ga0496125_0008883 Ga0496125_0008883_3947_4786 279
357 3300048928 Ga0496125_0169280 Ga0496125_0169280_468_1307 279
358 3300048929 Ga0496126_0010089 Ga0496126_0010089_4326_5165 279
359 3300048929 Ga0496126_0050926 Ga0496126_0050926_139_978 279
360 3300049571 Ga0501034_0000535 Ga0501034_0000535_49386_50225 279
361 3300049571 Ga0501034_0001201 Ga0501034_0001201_15652_16491 279
362 3300049584 Ga0501068_0059770 Ga0501068_0059770_929_1768 279
363 3300049593 Ga0501077_0110055 Ga0501077_0110055_880_1719 279
364 3300049742 Ga0501080_0001700 Ga0501080_0001700_5495_6334 279
365 3300050508 nmdc:mga09592_238721_c1 nmdc:mga09592_238721_c1_159_998 279
366 3300050509 nmdc:mga0qj67_161091_c1 nmdc:mga0qj67_161091_c1_625_1464 279
367 3300050510 nmdc:mga06r32_76577_c1 nmdc:mga06r32_76577_c1_330_1169 279
368 3300050510 nmdc:mga06r32_87556_c1 nmdc:mga06r32_87556_c1_817_1656 279
369 3300050511 nmdc:mga08y16_182378_c1 nmdc:mga08y16_182378_c1_198_1037 279
370 3300050511 nmdc:mga08y16_198450_c1 nmdc:mga08y16_198450_c1_340_1179 279
371 3300050513 nmdc:mga0rr50_92098_c1 nmdc:mga0rr50_92098_c1_687_1526 279
372 3300054114 Ga0501084_0145072 Ga0501084_0145072_396_1235 279
373 3300060353 Ga0501082_0006793 Ga0501082_0006793_7953_8792 279
374 3300003794 Ga0055531_10013284 Ga0055531_100132844 280
375 3300005288 Ga0065714_10021006 Ga0065714_100210061 280
376 3300005293 Ga0065715_10035465 Ga0065715_100354652 280
377 3300005293 Ga0065715_10129804 Ga0065715_101298042 280
378 3300005330 Ga0070690_100011025 Ga0070690_1000110252 280
379 3300005331 Ga0070670_100280129 Ga0070670_1002801291 280
380 3300005334 Ga0068869_100002005 Ga0068869_1000020054 280
381 3300005335 Ga0070666_10000329 Ga0070666_1000032924 280
382 3300005335 Ga0070666_10023636 Ga0070666_100236363 280
383 3300005340 Ga0070689_100002277 Ga0070689_1000022776 280
384 3300005343 Ga0070687_100010303 Ga0070687_1000103032 280
385 3300005344 Ga0070661_100008429 Ga0070661_1000084298 280
386 3300005345 Ga0070692_10180210 Ga0070692_101802102 280
387 3300005347 Ga0070668_100050278 Ga0070668_1000502782 280
388 3300005347 Ga0070668_100120549 Ga0070668_1001205492 280
389 3300005353 Ga0070669_100002403 Ga0070669_1000024039 280
390 3300005354 Ga0070675_100002814 Ga0070675_10000281414 280
391 3300005364 Ga0070673_100003918 Ga0070673_1000039187 280
392 3300005365 Ga0070688_100002281 Ga0070688_1000022819 280
393 3300005366 Ga0070659_100396798 Ga0070659_1003967981 280
394 3300005367 Ga0070667_100190379 Ga0070667_1001903792 280
395 3300005435 Ga0070714_100271051 Ga0070714_1002710512 280
396 3300005438 Ga0070701_10017023 Ga0070701_100170232 280
397 3300005441 Ga0070700_100043337 Ga0070700_1000433372 280
398 3300005455 Ga0070663_100084273 Ga0070663_1000842732 280
399 3300005457 Ga0070662_100010672 Ga0070662_1000106724 280
400 3300005457 Ga0070662_100063080 Ga0070662_1000630802 280
401 3300005458 Ga0070681_10057315 Ga0070681_100573152 280
402 3300005466 Ga0070685_10004628 Ga0070685_100046287 280
403 3300005530 Ga0070679_100599310 Ga0070679_1005993101 280
404 3300005543 Ga0070672_100015169 Ga0070672_1000151694 280
405 3300005544 Ga0070686_100242582 Ga0070686_1002425822 280
406 3300005548 Ga0070665_100006814 Ga0070665_1000068142 280
407 3300005548 Ga0070665_100020338 Ga0070665_1000203384 280
408 3300005563 Ga0068855_100510210 Ga0068855_1005102102 280
409 3300005564 Ga0070664_100009917 Ga0070664_1000099174 280
410 3300005577 Ga0068857_100057393 Ga0068857_1000573932 280
411 3300005617 Ga0068859_100001108 Ga0068859_1000011089 280
412 3300005618 Ga0068864_100060758 Ga0068864_1000607582 280
413 3300005719 Ga0068861_100000334 Ga0068861_10000033413 280
414 3300005719 Ga0068861_100001652 Ga0068861_1000016523 280
415 3300005719 Ga0068861_100366864 Ga0068861_1003668641 280
416 3300005834 Ga0068851_10008873 Ga0068851_100088732 280
417 3300005840 Ga0068870_10127149 Ga0068870_101271492 280
418 3300005841 Ga0068863_100006641 Ga0068863_1000066414 280
419 3300005841 Ga0068863_100209109 Ga0068863_1002091092 280
420 3300005842 Ga0068858_100005611 Ga0068858_1000056117 280
421 3300005842 Ga0068858_100032425 Ga0068858_1000324252 280
422 3300005843 Ga0068860_100554925 Ga0068860_1005549252 280
423 3300005844 Ga0068862_100000393 Ga0068862_10000039317 280
424 3300005844 Ga0068862_100079400 Ga0068862_1000794002 280
425 3300005844 Ga0068862_100402457 Ga0068862_1004024572 280
426 3300006844 Ga0075428_100000833 Ga0075428_1000008332 280
427 3300006844 Ga0075428_100020477 Ga0075428_1000204772 280
428 3300006844 Ga0075428_100023245 Ga0075428_1000232457 280
429 3300006844 Ga0075428_100108365 Ga0075428_1001083652 280
430 3300006846 Ga0075430_100000390 Ga0075430_10000039027 280
431 3300006846 Ga0075430_100021054 Ga0075430_1000210542 280
432 3300006847 Ga0075431_100000034 Ga0075431_10000003454 280
433 3300006847 Ga0075431_100005741 Ga0075431_1000057412 280
434 3300006847 Ga0075431_100029897 Ga0075431_1000298972 280
435 3300006847 Ga0075431_100354000 Ga0075431_1003540002 280
436 3300006871 Ga0075434_100610419 Ga0075434_1006104192 280
437 3300006880 Ga0075429_100006961 Ga0075429_1000069612 280
438 3300006880 Ga0075429_100019403 Ga0075429_1000194034 280
439 3300006881 Ga0068865_100158339 Ga0068865_1001583392 280
440 3300006931 Ga0097620_100001108 Ga0097620_1000011089 280
441 3300007076 Ga0075435_100323858 Ga0075435_1003238582 280
442 3300009094 Ga0111539_10003634 Ga0111539_100036343 280
443 3300009094 Ga0111539_10047322 Ga0111539_100473224 280
444 3300009094 Ga0111539_10556204 Ga0111539_105562042 280
445 3300009098 Ga0105245_10566177 Ga0105245_105661772 280
446 3300009147 Ga0114129_10002016 Ga0114129_1000201613 280
447 3300009147 Ga0114129_10082449 Ga0114129_100824492 280
448 3300009147 Ga0114129_10184733 Ga0114129_101847333 280
449 3300009148 Ga0105243_10056333 Ga0105243_100563332 280
450 3300009174 Ga0105241_10103544 Ga0105241_101035441 280
451 3300009177 Ga0105248_10000737 Ga0105248_1000073730 280
452 3300009551 Ga0105238_10043984 Ga0105238_100439842 280
453 3300009553 Ga0105249_10047251 Ga0105249_100472514 280
454 3300009553 Ga0105249_10522246 Ga0105249_105222462 280
455 3300010375 Ga0105239_10420777 Ga0105239_104207772 280
456 3300013296 Ga0157374_10214705 Ga0157374_102147053 280
457 3300013297 Ga0157378_10402521 Ga0157378_104025212 280
458 3300013306 Ga0163162_10009859 Ga0163162_100098596 280
459 3300013308 Ga0157375_10093775 Ga0157375_100937752 280
460 3300013308 Ga0157375_10321490 Ga0157375_103214902 280
461 3300014325 Ga0163163_10007177 Ga0163163_100071773 280
462 3300014326 Ga0157380_10212372 Ga0157380_102123722 280
463 3300014326 Ga0157380_10553380 Ga0157380_105533802 280
464 3300014745 Ga0157377_10120278 Ga0157377_101202783 280
465 3300025304 Ga0209257_1000320 Ga0209257_100032092 280
466 3300025321 Ga0207656_10009788 Ga0207656_100097884 280
467 3300025901 Ga0207688_10014218 Ga0207688_100142182 280
468 3300025903 Ga0207680_10001143 Ga0207680_100011433 280
469 3300025904 Ga0207647_10000023 Ga0207647_1000002327 280
470 3300025911 Ga0207654_10032951 Ga0207654_100329511 280
471 3300025912 Ga0207707_10155488 Ga0207707_101554882 280
472 3300025913 Ga0207695_10124934 Ga0207695_101249342 280
473 3300025918 Ga0207662_10019974 Ga0207662_100199742 280
474 3300025921 Ga0207652_10298171 Ga0207652_102981712 280
475 3300025923 Ga0207681_10001838 Ga0207681_100018388 280
476 3300025924 Ga0207694_10001346 Ga0207694_1000134617 280
477 3300025925 Ga0207650_10244520 Ga0207650_102445202 280
478 3300025925 Ga0207650_10294493 Ga0207650_102944932 280
479 3300025926 Ga0207659_10020124 Ga0207659_100201244 280
480 3300025926 Ga0207659_10069091 Ga0207659_100690912 280
481 3300025926 Ga0207659_10070286 Ga0207659_100702864 280
482 3300025932 Ga0207690_10372913 Ga0207690_103729131 280
483 3300025933 Ga0207706_10131782 Ga0207706_101317824 280
484 3300025933 Ga0207706_10308168 Ga0207706_103081681 280
485 3300025935 Ga0207709_10176742 Ga0207709_101767422 280
486 3300025936 Ga0207670_10042765 Ga0207670_100427651 280
487 3300025938 Ga0207704_10121346 Ga0207704_101213462 280
488 3300025940 Ga0207691_10092581 Ga0207691_100925812 280
489 3300025940 Ga0207691_10116662 Ga0207691_101166622 280
490 3300025941 Ga0207711_10006169 Ga0207711_100061694 280
491 3300025942 Ga0207689_10000420 Ga0207689_1000042021 280
492 3300025945 Ga0207679_10049986 Ga0207679_100499862 280
493 3300025961 Ga0207712_10000497 Ga0207712_100004972 280
494 3300025961 Ga0207712_10009947 Ga0207712_100099473 280
495 3300025961 Ga0207712_10124647 Ga0207712_101246472 280
496 3300025972 Ga0207668_10010396 Ga0207668_100103963 280
497 3300025972 Ga0207668_10039821 Ga0207668_100398211 280
498 3300025986 Ga0207658_10331814 Ga0207658_103318142 280
499 3300026023 Ga0207677_10254928 Ga0207677_102549282 280
500 3300026035 Ga0207703_10003172 Ga0207703_100031727 280
501 3300026035 Ga0207703_10021796 Ga0207703_100217964 280
502 3300026041 Ga0207639_10000358 Ga0207639_1000035812 280
503 3300026067 Ga0207678_10018584 Ga0207678_100185843 280
504 3300026075 Ga0207708_10048235 Ga0207708_100482353 280
505 3300026075 Ga0207708_10100968 Ga0207708_101009682 280
506 3300026088 Ga0207641_10088545 Ga0207641_100885452 280
507 3300026088 Ga0207641_10340581 Ga0207641_103405812 280
508 3300026089 Ga0207648_10101818 Ga0207648_101018182 280
509 3300026095 Ga0207676_10013978 Ga0207676_100139782 280
510 3300026116 Ga0207674_10028258 Ga0207674_100282582 280
511 3300026116 Ga0207674_10220162 Ga0207674_102201622 280
512 3300026118 Ga0207675_100001375 Ga0207675_1000013753 280
513 3300026118 Ga0207675_100001538 Ga0207675_10000153818 280
514 3300026142 Ga0207698_10260319 Ga0207698_102603192 280
515 3300027614 Ga0209970_1002881 Ga0209970_10028812 280
516 3300027682 Ga0209971_1044146 Ga0209971_10441462 280
517 3300027907 Ga0207428_10006228 Ga0207428_100062285 280
518 3300027907 Ga0207428_10040358 Ga0207428_100403582 280
519 3300027907 Ga0207428_10043466 Ga0207428_100434662 280
520 3300028379 Ga0268266_10000013 Ga0268266_10000013390 280
521 3300028380 Ga0268265_10000265 Ga0268265_1000026544 280
522 3300028380 Ga0268265_10004411 Ga0268265_100044119 280
523 3300028381 Ga0268264_10054196 Ga0268264_100541963 280
524 3300028381 Ga0268264_10380589 Ga0268264_103805892 280
525 3300028794 Ga0307515_10000037 Ga0307515_10000037305 280
526 3300028794 Ga0307515_10001585 Ga0307515_1000158526 280
527 3300028794 Ga0307515_10034838 Ga0307515_100348384 280
528 3300030731 Ga0316177_1212585 Ga0316177_12125852 280
529 3300030733 Ga0314311_1053136 Ga0314311_10531363 280
530 3300030735 Ga0316178_1144806 Ga0316178_11448062 280
531 3300031456 Ga0307513_10009095 Ga0307513_100090953 280
532 3300031456 Ga0307513_10249012 Ga0307513_102490122 280
533 3300031548 Ga0307408_100044630 Ga0307408_1000446301 280
534 3300031548 Ga0307408_100064093 Ga0307408_1000640932 280
535 3300031548 Ga0307408_100285769 Ga0307408_1002857692 280
536 3300031691 Ga0316579_10077429 Ga0316579_100774292 280
537 3300031727 Ga0316576_10042024 Ga0316576_100420242 280
538 3300031728 Ga0316578_10050637 Ga0316578_100506372 280
539 3300031731 Ga0307405_10010532 Ga0307405_100105323 280
540 3300031824 Ga0307413_10131216 Ga0307413_101312162 280
541 3300031852 Ga0307410_10123941 Ga0307410_101239412 280
542 3300031852 Ga0307410_10266439 Ga0307410_102664392 280
543 3300031901 Ga0307406_10086940 Ga0307406_100869403 280
544 3300031901 Ga0307406_10118447 Ga0307406_101184471 280
545 3300031901 Ga0307406_10185926 Ga0307406_101859262 280
546 3300031901 Ga0307406_10187950 Ga0307406_101879502 280
547 3300031903 Ga0307407_10082493 Ga0307407_100824931 280
548 3300031911 Ga0307412_10090193 Ga0307412_100901932 280
549 3300031911 Ga0307412_10216181 Ga0307412_102161812 280
550 3300031995 Ga0307409_100394056 Ga0307409_1003940562 280
551 3300032002 Ga0307416_100093696 Ga0307416_1000936964 280
552 3300032002 Ga0307416_100229109 Ga0307416_1002291092 280
553 3300032005 Ga0307411_10056262 Ga0307411_100562622 280
554 3300032005 Ga0307411_10126842 Ga0307411_101268422 280
555 3300032126 Ga0307415_100001747 Ga0307415_1000017474 280
556 3300032126 Ga0307415_100236682 Ga0307415_1002366822 280
557 3300032137 Ga0316585_10019900 Ga0316585_100199002 280
558 3300032139 Ga0316580_10008031 Ga0316580_100080312 280
559 3300035398 Ga0316574_0027044 Ga0316574_0027044_2351_3193 280
560 3300036647 Ga0316582_0016320 Ga0316582_0016320_707_1549 280
561 3300036712 Ga0316584_0052157 Ga0316584_0052157_1346_2188 280
562 3300041404 Ga0439436_0012024 Ga0439436_0012024_52_894 280
563 3300041406 Ga0439439_0000514 Ga0439439_0000514_2122_2964 280
564 3300041410 Ga0439461_0029806 Ga0439461_0029806_88_930 280
565 3300041413 Ga0439465_0006147 Ga0439465_0006147_1845_2753 280
566 3300041458 Ga0451798_0667076 Ga0451798_0667076_277_1119 280
567 3300041494 Ga0451837_0168380 Ga0451837_0168380_762_1604 280
568 3300041494 Ga0451837_0313789 Ga0451837_0313789_155_997 280
569 3300041509 Ga0451843_0368400 Ga0451843_0368400_131_973 280
570 3300041509 Ga0451843_0657080 Ga0451843_0657080_754_1596 280
571 3300042013 Ga0439456_007190 Ga0439456_007190_366_1208 280
572 3300042015 Ga0439462_0003159 Ga0439462_0003159_706_1548 280
573 3300042015 Ga0439462_0024343 Ga0439462_0024343_223_1065 280
574 3300042116 Ga0450912_004142 Ga0450912_004142_210_1052 280
575 3300042122 Ga0450920_001070 Ga0450920_001070_610_1452 280
576 3300042125 Ga0450923_003341 Ga0450923_003341_1355_2197 280
577 3300042131 Ga0450894_004776 Ga0450894_004776_129_971 280
578 3300042132 Ga0450895_000886 Ga0450895_000886_486_1328 280
579 3300042133 Ga0450896_001169 Ga0450896_001169_785_1627 280
580 3300042134 Ga0450898_030166 Ga0450898_030166_111_953 280
581 3300042135 Ga0450899_005738 Ga0450899_005738_248_1090 280
582 3300042156 Ga0439446_0000164 Ga0439446_0000164_9430_10272 280
583 3300042156 Ga0439446_0001699 Ga0439446_0001699_2426_3268 280
584 3300042184 Ga0450908_000154 Ga0450908_000154_4212_5054 280
585 3300042184 Ga0450908_003399 Ga0450908_003399_79_921 280
586 3300042435 Ga0439434_0007291 Ga0439434_0007291_2283_3125 280
587 3300042435 Ga0439434_0007927 Ga0439434_0007927_480_1322 280
588 3300042436 Ga0439435_0001735 Ga0439435_0001735_787_1629 280
589 3300042437 Ga0439444_0000070 Ga0439444_0000070_3279_4121 280
590 3300042461 Ga0439460_0066883 Ga0439460_0066883_65_907 280
591 3300045051 Ga0451576_0072218 Ga0451576_0072218_1537_2379 280
592 3300045051 Ga0451576_0223220 Ga0451576_0223220_303_1145 280
593 3300046460 Ga0495638_0033613 Ga0495638_0033613_1591_2433 280
594 3300046501 Ga0495607_0006481 Ga0495607_0006481_4940_5782 280
595 3300046507 Ga0495606_0057086 Ga0495606_0057086_1331_2173 280
596 3300046615 Ga0495656_0003475 Ga0495656_0003475_2822_3664 280
597 3300046660 Ga0495625_0220610 Ga0495625_0220610_229_1071 280
598 3300047318 Ga0495636_0012071 Ga0495636_0012071_1594_2436 280
599 3300047470 Ga0495681_0060317 Ga0495681_0060317_399_1241 280
600 3300047472 Ga0495686_0005221 Ga0495686_0005221_6404_7246 280
601 3300048911 Ga0496108_0081456 Ga0496108_0081456_132_974 280
602 3300048912 Ga0496109_0023299 Ga0496109_0023299_3801_4643 280
603 3300048915 Ga0496112_0182713 Ga0496112_0182713_917_1759 280
604 3300048916 Ga0496113_0056328 Ga0496113_0056328_2044_2886 280
605 3300048917 Ga0496114_0129251 Ga0496114_0129251_84_926 280
606 3300048925 Ga0496122_0036620 Ga0496122_0036620_1663_2505 280
607 3300048927 Ga0496124_0000018 Ga0496124_0000018_108990_109832 280
608 3300049568 Ga0501031_0048098 Ga0501031_0048098_1009_1851 280
609 3300049570 Ga0501033_0177674 Ga0501033_0177674_361_1203 280
610 3300049572 Ga0501036_0241845 Ga0501036_0241845_260_1102 280
611 3300049574 Ga0501038_0094761 Ga0501038_0094761_963_1805 280
612 3300049574 Ga0501038_0181659 Ga0501038_0181659_437_1279 280
613 3300049575 Ga0501039_0002777 Ga0501039_0002777_6061_6903 280
614 3300049575 Ga0501039_0081272 Ga0501039_0081272_1066_1908 280
615 3300049576 Ga0501040_0015552 Ga0501040_0015552_2206_3048 280
616 3300049576 Ga0501040_0145313 Ga0501040_0145313_753_1595 280
617 3300049577 Ga0501041_0003477 Ga0501041_0003477_5715_6557 280
618 3300049577 Ga0501041_0076763 Ga0501041_0076763_1020_1862 280
619 3300049578 Ga0501042_0131356 Ga0501042_0131356_845_1687 280
620 3300049578 Ga0501042_0131567 Ga0501042_0131567_680_1522 280
621 3300049578 Ga0501042_0154439 Ga0501042_0154439_614_1456 280
622 3300049579 Ga0501043_0319071 Ga0501043_0319071_210_1052 280
623 3300049580 Ga0501046_0348846 Ga0501046_0348846_191_1033 280
624 3300049582 Ga0501048_0066269 Ga0501048_0066269_281_1123 280
625 3300049582 Ga0501048_0089211 Ga0501048_0089211_404_1246 280
626 3300049584 Ga0501068_0003148 Ga0501068_0003148_4645_5487 280
627 3300049584 Ga0501068_0035560 Ga0501068_0035560_1494_2336 280
628 3300049585 Ga0501069_0014481 Ga0501069_0014481_2353_3198 280
629 3300049587 Ga0501071_0003130 Ga0501071_0003130_5000_5842 280
630 3300049587 Ga0501071_0042026 Ga0501071_0042026_1739_2581 280
631 3300049587 Ga0501071_0071428 Ga0501071_0071428_1285_2127 280
632 3300049588 Ga0501072_0004971 Ga0501072_0004971_3951_4793 280
633 3300049588 Ga0501072_0119005 Ga0501072_0119005_984_1826 280
634 3300049589 Ga0501073_0185122 Ga0501073_0185122_412_1254 280
635 3300049590 Ga0501074_0086613 Ga0501074_0086613_856_1698 280
636 3300049591 Ga0501075_0001687 Ga0501075_0001687_13029_13871 280
637 3300049591 Ga0501075_0205900 Ga0501075_0205900_423_1265 280
638 3300049592 Ga0501076_0101409 Ga0501076_0101409_299_1141 280
639 3300049592 Ga0501076_0236033 Ga0501076_0236033_320_1162 280
640 3300049592 Ga0501076_0322454 Ga0501076_0322454_103_945 280
641 3300049592 Ga0501076_0354315 Ga0501076_0354315_208_1050 280
642 3300049593 Ga0501077_0205025 Ga0501077_0205025_276_1118 280
643 3300049593 Ga0501077_0291335 Ga0501077_0291335_29_871 280
644 3300049741 Ga0501079_0007430 Ga0501079_0007430_6575_7417 280
645 3300049741 Ga0501079_0264102 Ga0501079_0264102_73_915 280
646 3300049741 Ga0501079_0420898 Ga0501079_0420898_70_912 280
647 3300049742 Ga0501080_0270265 Ga0501080_0270265_298_1140 280
648 3300049742 Ga0501080_0720171 Ga0501080_0720171_26_868 280
649 3300049743 Ga0501081_0034252 Ga0501081_0034252_1869_2711 280
650 3300049743 Ga0501081_0119689 Ga0501081_0119689_221_1063 280
651 3300049744 Ga0501083_0097188 Ga0501083_0097188_429_1271 280
652 3300049744 Ga0501083_0190570 Ga0501083_0190570_379_1221 280
653 3300049822 Ga0501035_0125224 Ga0501035_0125224_172_1014 280
654 3300049822 Ga0501035_0263903 Ga0501035_0263903_471_1313 280
655 3300049823 Ga0501044_0213735 Ga0501044_0213735_825_1667 280
656 3300049824 Ga0501045_0002391 Ga0501045_0002391_4180_5022 280
657 3300049824 Ga0501045_0104561 Ga0501045_0104561_935_1777 280
658 3300049824 Ga0501045_0203531 Ga0501045_0203531_506_1348 280
659 3300050507 nmdc:mga05p37_16313_c1 nmdc:mga05p37_16313_c1_2540_3382 280
660 3300050507 nmdc:mga05p37_535989_c1 nmdc:mga05p37_535989_c1_403_1245 280
661 3300050508 nmdc:mga09592_7046_c1 nmdc:mga09592_7046_c1_3276_4118 280
662 3300050509 nmdc:mga0qj67_15753_c1 nmdc:mga0qj67_15753_c1_2552_3394 280
663 3300050509 nmdc:mga0qj67_16660_c1 nmdc:mga0qj67_16660_c1_2218_3060 280
664 3300050510 nmdc:mga06r32_1723_c1 nmdc:mga06r32_1723_c1_6014_6856 280
665 3300050510 nmdc:mga06r32_2539_c1 nmdc:mga06r32_2539_c1_11200_12042 280
666 3300050511 nmdc:mga08y16_412149_c1 nmdc:mga08y16_412149_c1_106_948 280
667 3300050511 nmdc:mga08y16_65821_c1 nmdc:mga08y16_65821_c1_56_898 280
668 3300050512 nmdc:mga0n895_5285_c1 nmdc:mga0n895_5285_c1_4410_5252 280
669 3300050515 nmdc:mga0a205_3924_c1 nmdc:mga0a205_3924_c1_703_1545 280
670 3300054114 Ga0501084_0016881 Ga0501084_0016881_2811_3653 280
671 3300060353 Ga0501082_0027674 Ga0501082_0027674_1374_2216 280
672 3300060353 Ga0501082_0044022 Ga0501082_0044022_2889_3731 280
673 3300060353 Ga0501082_0058242 Ga0501082_0058242_1614_2456 280
674 3300060353 Ga0501082_0251155 Ga0501082_0251155_493_1335 280
675 3300061734 Ga0530510_0073659 Ga0530510_0073659_696_1538 280
676 3300061734 Ga0530510_0180775 Ga0530510_0180775_451_1293 280
677 3300003187 JGI25151J46595_10000646 JGI25151J46595_1000064616 281
678 3300003214 JGI25165J46597_1000948 JGI25165J46597_100094813 281
679 3300005353 Ga0070669_100015089 Ga0070669_1000150891 281
680 3300005367 Ga0070667_100000150 Ga0070667_10000015031 281
681 3300005455 Ga0070663_100000029 Ga0070663_10000002953 281
682 3300005539 Ga0068853_100002157 Ga0068853_10000215711 281
683 3300009177 Ga0105248_10000246 Ga0105248_1000024632 281
684 3300009545 Ga0105237_10000231 Ga0105237_1000023127 281
685 3300010375 Ga0105239_10086491 Ga0105239_100864912 281
686 3300010375 Ga0105239_10122767 Ga0105239_101227674 281
687 3300013104 Ga0157370_10087455 Ga0157370_100874552 281
688 3300014969 Ga0157376_10433034 Ga0157376_104330341 281
689 3300025231 Ga0207427_100078 Ga0207427_10007815 281
690 3300025233 Ga0209437_100269 Ga0209437_1002697 281
691 3300025261 Ga0209233_1000077 Ga0209233_100007792 281
692 3300025294 Ga0209025_1000006 Ga0209025_1000006455 281
693 3300025297 Ga0209758_1020489 Ga0209758_10204892 281
694 3300025914 Ga0207671_10059103 Ga0207671_100591032 281
695 3300025941 Ga0207711_10008374 Ga0207711_100083746 281
696 3300025961 Ga0207712_10001195 Ga0207712_1000119515 281
697 3300025981 Ga0207640_10106669 Ga0207640_101066692 281
698 3300025986 Ga0207658_10000013 Ga0207658_10000013158 281
699 3300025986 Ga0207658_10319061 Ga0207658_103190612 281
700 3300026041 Ga0207639_10051992 Ga0207639_100519923 281
701 3300026067 Ga0207678_10000035 Ga0207678_1000003583 281
702 3300030745 Ga0316182_1301532 Ga0316182_13015321 281
703 3300032004 Ga0307414_10001460 Ga0307414_100014606 281
704 3300032004 Ga0307414_10078205 Ga0307414_100782052 281
705 3300032004 Ga0307414_10130620 Ga0307414_101306202 281
706 3300041407 Ga0439447_001277 Ga0439447_001277_5748_6593 281
707 3300041413 Ga0439465_0000082 Ga0439465_0000082_7692_8537 281
708 3300041441 Ga0451787_431538 Ga0451787_431538_939_1787 281
709 3300041486 Ga0451807_1932045 Ga0451807_1932045_610_1458 281
710 3300042004 Ga0439445_0000501 Ga0439445_0000501_5760_6605 281
711 3300042004 Ga0439445_0021552 Ga0439445_0021552_46_891 281
712 3300042007 Ga0439449_0000032 Ga0439449_0000032_4718_5563 281
713 3300046525 Ga0495663_0001923 Ga0495663_0001923_5315_6226 281
714 3300046525 Ga0495663_0016887 Ga0495663_0016887_390_1235 281
715 3300046530 Ga0495654_0040084 Ga0495654_0040084_254_1165 281
716 3300046616 Ga0495668_0001998 Ga0495668_0001998_11491_12336 281
717 3300046692 Ga0495671_0010623 Ga0495671_0010623_334_1245 281
718 3300047472 Ga0495686_0009853 Ga0495686_0009853_5879_6727 281
719 3300048925 Ga0496122_0000062 Ga0496122_0000062_212369_213217 281
720 3300048926 Ga0496123_0003624 Ga0496123_0003624_11891_12739 281
721 3300048929 Ga0496126_0054895 Ga0496126_0054895_1701_2549 281
722 3300049585 Ga0501069_0019608 Ga0501069_0019608_2501_3349 281
723 3300049586 Ga0501070_0005780 Ga0501070_0005780_5690_6538 281
724 3300049705 Ga0501225_0000494 Ga0501225_0000494_9404_10249 281
725 3300053087 Ga0500643_001459 Ga0500643_001459_6528_7376 281
726 3300053093 Ga0500651_0000120 Ga0500651_0000120_21621_22469 281
727 3300053120 Ga0500597_000019 Ga0500597_000019_7725_8573 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

37

241

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uqw-assembly1.cif.gz_A pcc6803 cyanophycinase s132dap covalently bound to cyanophycin dimer 0.8631 12 271
7uqv-assembly1.cif.gz_B pseudobacteroides cellulosolvens pseudo-cphb 0.8629 13 270
3en0-assembly1.cif.gz_B the structure of cyanophycinase 0.8595 12 271
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.858 13 270
7uqv-assembly2.cif.gz_C pseudobacteroides cellulosolvens pseudo-cphb 0.8561 15 270
ID Description Score Start End Superfamily
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8431 10 271 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8338 10 271 3.40.50.880
2ywdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7351 45 138 3.40.50.880
1um9D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7238 42 102 3.40.50.920
af_K7KS65_46_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7082 34 76 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N9PGD3-F1-model_v4 Cyanophycinase 0.9415 11 141 GO:0006508
GO:0008236
AF-A0A353T2L3-F1-model_v4 Cyanophycinase (EC 3.4.15.6) 0.9293 8 137 GO:0006508
GO:0008236
AF-A0A3D5V7F7-F1-model_v4 Cyanophycinase 0.9268 186 271 GO:0016787
AF-A0A356ZBV8-F1-model_v4 Cyanophycinase 0.914 200 271 GO:0016787
AF-A0A7Y1XUA9-F1-model_v4 Cyanophycinase 0.9126 194 273

Feature Viewer

pLDDT pTM Quality
81.48 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map