F477760
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 373 | 714 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300046525|Ga0495663_0001923|Ga0495663_0001923_5315_6226 |
| Length | 303 |
| Sequence | MALPAPVAAALRGTLQFQESCCMCPSKVADGGERGWIVPIGGAENKEDNPRILKRFLDLCGGRDAEIVVIPTASQLADTGTRYEGIFGDLGASRVDVLDFDTRRDCHEQNRLDRIENASGIFFTGGNQLRLSTILGGTPAAKLIRERNAAGITVGGTSAGASILSEHMIGFGKEGASPQADSVRLAPGLGLTNRFIIDQHFRQRDRLGRLVAALAYNPFAIGIGLDEDTAAFIGPDNTLEVEGSGAVTVVDADGLTFSSMAQVNENKPVCLLGLTVHILVAGATFNLHTRKASAGTLTQGKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 2 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 3 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 4 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 5 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 6 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 7 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 8 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 9 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 10 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 11 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 12 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 197 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 198 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 199 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 200 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 201 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 226 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 227 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 242 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 250 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 251 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 252 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 253 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 254 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 262 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 263 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 264 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 265 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 266 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 267 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 268 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 269 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 270 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 271 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 276 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 277 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 368 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 369 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 373 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.65 |
| Nodule | 0 |
| Rhizoplane | 5.64 |
| Rhizosphere | 85.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000646 | 3300003187 | Bacteria | 29736 |
| 2 | JGI25165J46597_1000948 | 3300003214 | Bacteria | 19865 |
| 3 | rootH1_10102292 | 3300003316 | Bacteria | 6481 |
| 4 | rootH2_10081999 | 3300003320 | Bacteria | 2230 |
| 5 | rootL2_10033434 | 3300003322 | Bacteria | 2357 |
| 6 | rootH1_10157784 | 3300003323 | Bacteria | 4965 |
| 7 | Ga0055531_10013284 | 3300003794 | Bacteria | 3807 |
| 8 | Ga0065714_10021006 | 3300005288 | Bacteria | 1395 |
| 9 | Ga0065704_10144304 | 3300005289 | Bacteria | 1487 |
| 10 | Ga0065715_10035465 | 3300005293 | Bacteria | 2407 |
| 11 | Ga0065715_10129804 | 3300005293 | Bacteria | 2038 |
| 12 | Ga0065715_10269957 | 3300005293 | Bacteria | 1114 |
| 13 | Ga0070690_100007554 | 3300005330 | Bacteria | 6223 |
| 14 | Ga0070690_100011025 | 3300005330 | Bacteria | 5279 |
| 15 | Ga0070690_100041825 | 3300005330 | Bacteria | 2902 |
| 16 | Ga0070670_100280129 | 3300005331 | Bacteria | 1456 |
| 17 | Ga0068869_100002005 | 3300005334 | Bacteria | 12237 |
| 18 | Ga0068869_100020047 | 3300005334 | Bacteria | 4580 |
| 19 | Ga0070666_10000329 | 3300005335 | Bacteria | 30097 |
| 20 | Ga0070666_10003623 | 3300005335 | Bacteria | 9364 |
| 21 | Ga0070666_10023636 | 3300005335 | Bacteria | 4002 |
| 22 | Ga0070666_10025604 | 3300005335 | Bacteria | 3847 |
| 23 | Ga0068868_100018307 | 3300005338 | Bacteria | 5234 |
| 24 | Ga0068868_100030353 | 3300005338 | Bacteria | 4145 |
| 25 | Ga0070689_100002277 | 3300005340 | Bacteria | 12480 |
| 26 | Ga0070689_100524634 | 3300005340 | Bacteria | 1017 |
| 27 | Ga0070687_100010303 | 3300005343 | Bacteria | 4038 |
| 28 | Ga0070661_100008429 | 3300005344 | Bacteria | 7126 |
| 29 | Ga0070692_10180210 | 3300005345 | Bacteria | 1224 |
| 30 | Ga0070668_100050278 | 3300005347 | Bacteria | 3209 |
| 31 | Ga0070668_100088538 | 3300005347 | Bacteria | 2437 |
| 32 | Ga0070668_100120549 | 3300005347 | Bacteria | 2096 |
| 33 | Ga0070669_100002403 | 3300005353 | Bacteria | 13547 |
| 34 | Ga0070669_100015089 | 3300005353 | Bacteria | 5505 |
| 35 | Ga0070669_100185761 | 3300005353 | Bacteria | 1628 |
| 36 | Ga0070675_100002814 | 3300005354 | Bacteria | 13117 |
| 37 | Ga0070671_100001491 | 3300005355 | Bacteria | 17486 |
| 38 | Ga0070671_100050852 | 3300005355 | Bacteria | 3446 |
| 39 | Ga0070671_100140217 | 3300005355 | Bacteria | 2040 |
| 40 | Ga0070674_100004601 | 3300005356 | Bacteria | 7886 |
| 41 | Ga0070673_100003918 | 3300005364 | Bacteria | 9350 |
| 42 | Ga0070673_100053807 | 3300005364 | Bacteria | 3164 |
| 43 | Ga0070673_100055472 | 3300005364 | Bacteria | 3122 |
| 44 | Ga0070688_100002281 | 3300005365 | Bacteria | 9681 |
| 45 | Ga0070659_100298236 | 3300005366 | Bacteria | 1343 |
| 46 | Ga0070659_100396798 | 3300005366 | Bacteria | 1164 |
| 47 | Ga0070667_100000150 | 3300005367 | Bacteria | 86639 |
| 48 | Ga0070667_100007212 | 3300005367 | Bacteria | 9237 |
| 49 | Ga0070667_100030058 | 3300005367 | Bacteria | 4531 |
| 50 | Ga0070667_100141969 | 3300005367 | Bacteria | 2104 |
| 51 | Ga0070667_100190379 | 3300005367 | Bacteria | 1817 |
| 52 | Ga0070709_10001305 | 3300005434 | Bacteria | 13587 |
| 53 | Ga0070709_10122021 | 3300005434 | Bacteria | 1768 |
| 54 | Ga0070714_100004395 | 3300005435 | Bacteria | 10613 |
| 55 | Ga0070714_100271051 | 3300005435 | Bacteria | 1574 |
| 56 | Ga0070713_100006878 | 3300005436 | Bacteria | 7931 |
| 57 | Ga0070713_100073283 | 3300005436 | Bacteria | 2898 |
| 58 | Ga0070713_100102889 | 3300005436 | Bacteria | 2478 |
| 59 | Ga0070710_10003030 | 3300005437 | Bacteria | 7989 |
| 60 | Ga0070701_10017023 | 3300005438 | Bacteria | 3391 |
| 61 | Ga0070711_100058968 | 3300005439 | Bacteria | 2663 |
| 62 | Ga0070711_100107743 | 3300005439 | Bacteria | 2040 |
| 63 | Ga0070711_100190015 | 3300005439 | Bacteria | 1578 |
| 64 | Ga0070700_100016722 | 3300005441 | Bacteria | 4183 |
| 65 | Ga0070700_100043337 | 3300005441 | Bacteria | 2768 |
| 66 | Ga0070663_100000029 | 3300005455 | Bacteria | 82128 |
| 67 | Ga0070663_100034907 | 3300005455 | Bacteria | 3486 |
| 68 | Ga0070663_100084273 | 3300005455 | Bacteria | 2342 |
| 69 | Ga0070678_100009491 | 3300005456 | Bacteria | 5900 |
| 70 | Ga0070678_100024718 | 3300005456 | Bacteria | 4027 |
| 71 | Ga0070662_100005675 | 3300005457 | Bacteria | 7987 |
| 72 | Ga0070662_100010672 | 3300005457 | Bacteria | 6044 |
| 73 | Ga0070662_100063080 | 3300005457 | Bacteria | 2710 |
| 74 | Ga0070681_10057315 | 3300005458 | Bacteria | 3876 |
| 75 | Ga0068867_100022309 | 3300005459 | Bacteria | 4526 |
| 76 | Ga0068867_100049470 | 3300005459 | Bacteria | 3095 |
| 77 | Ga0070685_10004628 | 3300005466 | Bacteria | 6966 |
| 78 | Ga0070698_100153532 | 3300005471 | Bacteria | 2249 |
| 79 | Ga0070699_100142595 | 3300005518 | Bacteria | 2117 |
| 80 | Ga0070679_100599310 | 3300005530 | Bacteria | 1045 |
| 81 | Ga0068853_100002157 | 3300005539 | Bacteria | 14647 |
| 82 | Ga0068853_100180333 | 3300005539 | Bacteria | 1915 |
| 83 | Ga0070672_100015169 | 3300005543 | Bacteria | 5478 |
| 84 | Ga0070672_100059954 | 3300005543 | Bacteria | 2995 |
| 85 | Ga0070686_100242582 | 3300005544 | Bacteria | 1313 |
| 86 | Ga0070696_100003241 | 3300005546 | Bacteria | 10841 |
| 87 | Ga0070696_100106770 | 3300005546 | Bacteria | 2013 |
| 88 | Ga0070665_100006814 | 3300005548 | Bacteria | 11617 |
| 89 | Ga0070665_100020338 | 3300005548 | Bacteria | 6667 |
| 90 | Ga0070665_100020954 | 3300005548 | Bacteria | 6570 |
| 91 | Ga0070665_100020971 | 3300005548 | Bacteria | 6568 |
| 92 | Ga0068855_100099729 | 3300005563 | Bacteria | 3345 |
| 93 | Ga0068855_100510210 | 3300005563 | Bacteria | 1306 |
| 94 | Ga0070664_100009917 | 3300005564 | Bacteria | 7720 |
| 95 | Ga0068857_100057393 | 3300005577 | Bacteria | 3455 |
| 96 | Ga0068856_100020255 | 3300005614 | Bacteria | 6460 |
| 97 | Ga0068859_100000602 | 3300005617 | Bacteria | 35957 |
| 98 | Ga0068859_100001108 | 3300005617 | Bacteria | 27483 |
| 99 | Ga0068859_100041015 | 3300005617 | Bacteria | 4650 |
| 100 | Ga0068859_100657588 | 3300005617 | Bacteria | 1140 |
| 101 | Ga0068864_100060758 | 3300005618 | Bacteria | 3272 |
| 102 | Ga0068864_100564744 | 3300005618 | Bacteria | 1101 |
| 103 | Ga0068866_10058368 | 3300005718 | Bacteria | 1993 |
| 104 | Ga0068866_10076247 | 3300005718 | Bacteria | 1787 |
| 105 | Ga0068861_100000334 | 3300005719 | Bacteria | 26662 |
| 106 | Ga0068861_100001652 | 3300005719 | Bacteria | 14252 |
| 107 | Ga0068861_100023236 | 3300005719 | Bacteria | 4471 |
| 108 | Ga0068861_100366864 | 3300005719 | Bacteria | 1268 |
| 109 | Ga0068861_100373367 | 3300005719 | Bacteria | 1258 |
| 110 | Ga0068861_100519936 | 3300005719 | Bacteria | 1079 |
| 111 | Ga0068851_10008873 | 3300005834 | Bacteria | 4663 |
| 112 | Ga0068870_10046151 | 3300005840 | Bacteria | 2283 |
| 113 | Ga0068870_10127149 | 3300005840 | Bacteria | 1476 |
| 114 | Ga0068863_100002939 | 3300005841 | Bacteria | 16842 |
| 115 | Ga0068863_100006641 | 3300005841 | Bacteria | 11354 |
| 116 | Ga0068863_100036091 | 3300005841 | Bacteria | 4707 |
| 117 | Ga0068863_100072876 | 3300005841 | Bacteria | 3249 |
| 118 | Ga0068863_100155698 | 3300005841 | Bacteria | 2188 |
| 119 | Ga0068863_100209109 | 3300005841 | Bacteria | 1879 |
| 120 | Ga0068858_100000906 | 3300005842 | Bacteria | 30759 |
| 121 | Ga0068858_100000915 | 3300005842 | Bacteria | 30581 |
| 122 | Ga0068858_100005611 | 3300005842 | Bacteria | 12269 |
| 123 | Ga0068858_100032425 | 3300005842 | Bacteria | 4851 |
| 124 | Ga0068858_100074674 | 3300005842 | Bacteria | 3148 |
| 125 | Ga0068858_100303538 | 3300005842 | Bacteria | 1523 |
| 126 | Ga0068860_100007946 | 3300005843 | Bacteria | 10582 |
| 127 | Ga0068860_100013020 | 3300005843 | Bacteria | 8167 |
| 128 | Ga0068860_100554925 | 3300005843 | Bacteria | 1151 |
| 129 | Ga0068862_100000393 | 3300005844 | Bacteria | 47115 |
| 130 | Ga0068862_100032786 | 3300005844 | Bacteria | 4388 |
| 131 | Ga0068862_100079400 | 3300005844 | Bacteria | 2844 |
| 132 | Ga0068862_100402457 | 3300005844 | Bacteria | 1281 |
| 133 | Ga0081540_1136257 | 3300005983 | Bacteria | 993 |
| 134 | Ga0070717_10004003 | 3300006028 | Bacteria | 10608 |
| 135 | Ga0070715_10000861 | 3300006163 | Bacteria | 8364 |
| 136 | Ga0070716_100000641 | 3300006173 | Bacteria | 14863 |
| 137 | Ga0070716_100256656 | 3300006173 | Bacteria | 1194 |
| 138 | Ga0070712_100004032 | 3300006175 | Bacteria | 9010 |
| 139 | Ga0070712_100022165 | 3300006175 | Bacteria | 4180 |
| 140 | Ga0070712_100058722 | 3300006175 | Bacteria | 2707 |
| 141 | Ga0097621_100012364 | 3300006237 | Bacteria | 6324 |
| 142 | Ga0068871_100073567 | 3300006358 | Bacteria | 2817 |
| 143 | Ga0075428_100000833 | 3300006844 | Bacteria | 32315 |
| 144 | Ga0075428_100020477 | 3300006844 | Bacteria | 7323 |
| 145 | Ga0075428_100023245 | 3300006844 | Bacteria | 6856 |
| 146 | Ga0075428_100039525 | 3300006844 | Bacteria | 5192 |
| 147 | Ga0075428_100108365 | 3300006844 | Bacteria | 3027 |
| 148 | Ga0075428_100121035 | 3300006844 | Bacteria | 2850 |
| 149 | Ga0075430_100000390 | 3300006846 | Bacteria | 32316 |
| 150 | Ga0075430_100021054 | 3300006846 | Bacteria | 5543 |
| 151 | Ga0075430_100185863 | 3300006846 | Bacteria | 1728 |
| 152 | Ga0075431_100000034 | 3300006847 | Bacteria | 71256 |
| 153 | Ga0075431_100005741 | 3300006847 | Bacteria | 12267 |
| 154 | Ga0075431_100029897 | 3300006847 | Bacteria | 5609 |
| 155 | Ga0075431_100056420 | 3300006847 | Bacteria | 4052 |
| 156 | Ga0075431_100354000 | 3300006847 | Bacteria | 1476 |
| 157 | Ga0075434_100610419 | 3300006871 | Bacteria | 1110 |
| 158 | Ga0075429_100006961 | 3300006880 | Bacteria | 9825 |
| 159 | Ga0075429_100019403 | 3300006880 | Bacteria | 5891 |
| 160 | Ga0075429_100219980 | 3300006880 | Bacteria | 1663 |
| 161 | Ga0068865_100057302 | 3300006881 | Bacteria | 2717 |
| 162 | Ga0068865_100105267 | 3300006881 | Bacteria | 2072 |
| 163 | Ga0068865_100158339 | 3300006881 | Bacteria | 1725 |
| 164 | Ga0097620_100000602 | 3300006931 | Bacteria | 35957 |
| 165 | Ga0097620_100001108 | 3300006931 | Bacteria | 27483 |
| 166 | Ga0097620_100041015 | 3300006931 | Bacteria | 4650 |
| 167 | Ga0097620_100657607 | 3300006931 | Bacteria | 1140 |
| 168 | Ga0075435_100323858 | 3300007076 | Bacteria | 1319 |
| 169 | Ga0099795_10000223 | 3300007788 | Bacteria | 9865 |
| 170 | Ga0099795_10002097 | 3300007788 | Bacteria | 4590 |
| 171 | Ga0105240_10085603 | 3300009093 | Bacteria | 3862 |
| 172 | Ga0111539_10000816 | 3300009094 | Bacteria | 40435 |
| 173 | Ga0111539_10003634 | 3300009094 | Bacteria | 20318 |
| 174 | Ga0111539_10047322 | 3300009094 | Bacteria | 5140 |
| 175 | Ga0111539_10093041 | 3300009094 | Bacteria | 3542 |
| 176 | Ga0111539_10140685 | 3300009094 | Bacteria | 2825 |
| 177 | Ga0111539_10556204 | 3300009094 | Bacteria | 1336 |
| 178 | Ga0111539_10737881 | 3300009094 | Bacteria | 1146 |
| 179 | Ga0105245_10010409 | 3300009098 | Bacteria | 8100 |
| 180 | Ga0105245_10010410 | 3300009098 | Bacteria | 8099 |
| 181 | Ga0105245_10566177 | 3300009098 | Bacteria | 1160 |
| 182 | Ga0105247_10001357 | 3300009101 | Bacteria | 17786 |
| 183 | Ga0105247_10003087 | 3300009101 | Bacteria | 11024 |
| 184 | Ga0114129_10002016 | 3300009147 | Bacteria | 27842 |
| 185 | Ga0114129_10082449 | 3300009147 | Bacteria | 4468 |
| 186 | Ga0114129_10184733 | 3300009147 | Bacteria | 2834 |
| 187 | Ga0114129_10235627 | 3300009147 | Bacteria | 2463 |
| 188 | Ga0105243_10056333 | 3300009148 | Bacteria | 3126 |
| 189 | Ga0105241_10016185 | 3300009174 | Bacteria | 5465 |
| 190 | Ga0105241_10103544 | 3300009174 | Bacteria | 2267 |
| 191 | Ga0105241_10396901 | 3300009174 | Bacteria | 1209 |
| 192 | Ga0105241_10423198 | 3300009174 | Bacteria | 1172 |
| 193 | Ga0105242_10002857 | 3300009176 | Bacteria | 13535 |
| 194 | Ga0105242_10246197 | 3300009176 | Bacteria | 1609 |
| 195 | Ga0105248_10000246 | 3300009177 | Bacteria | 62735 |
| 196 | Ga0105248_10000737 | 3300009177 | Bacteria | 36805 |
| 197 | Ga0105248_10002984 | 3300009177 | Bacteria | 18755 |
| 198 | Ga0105248_10007814 | 3300009177 | Bacteria | 11742 |
| 199 | Ga0105248_10030718 | 3300009177 | Bacteria | 6000 |
| 200 | Ga0105248_10128872 | 3300009177 | Bacteria | 2854 |
| 201 | Ga0105248_10192488 | 3300009177 | Bacteria | 2298 |
| 202 | Ga0105237_10000231 | 3300009545 | Bacteria | 79368 |
| 203 | Ga0105237_10042595 | 3300009545 | Bacteria | 4577 |
| 204 | Ga0105238_10043984 | 3300009551 | Bacteria | 4517 |
| 205 | Ga0105238_10069286 | 3300009551 | Bacteria | 3528 |
| 206 | Ga0105238_10075907 | 3300009551 | Bacteria | 3353 |
| 207 | Ga0105238_10101210 | 3300009551 | Bacteria | 2864 |
| 208 | Ga0105249_10012997 | 3300009553 | Bacteria | 7347 |
| 209 | Ga0105249_10047251 | 3300009553 | Bacteria | 3922 |
| 210 | Ga0105249_10126611 | 3300009553 | Bacteria | 2433 |
| 211 | Ga0105249_10522246 | 3300009553 | Bacteria | 1235 |
| 212 | Ga0105030_100177 | 3300009987 | Bacteria | 5345 |
| 213 | Ga0105239_10086212 | 3300010375 | Bacteria | 3461 |
| 214 | Ga0105239_10086491 | 3300010375 | Bacteria | 3455 |
| 215 | Ga0105239_10122767 | 3300010375 | Bacteria | 2886 |
| 216 | Ga0105239_10370899 | 3300010375 | Bacteria | 1618 |
| 217 | Ga0105239_10420777 | 3300010375 | Bacteria | 1513 |
| 218 | Ga0105239_10589430 | 3300010375 | Bacteria | 1268 |
| 219 | Ga0157370_10087455 | 3300013104 | Bacteria | 2927 |
| 220 | Ga0157369_10381666 | 3300013105 | Bacteria | 1463 |
| 221 | Ga0157374_10021862 | 3300013296 | Bacteria | 5700 |
| 222 | Ga0157374_10214705 | 3300013296 | Bacteria | 1887 |
| 223 | Ga0157378_10006173 | 3300013297 | Bacteria | 10486 |
| 224 | Ga0157378_10008041 | 3300013297 | Bacteria | 9205 |
| 225 | Ga0157378_10402521 | 3300013297 | Bacteria | 1349 |
| 226 | Ga0163162_10009859 | 3300013306 | Bacteria | 9292 |
| 227 | Ga0163162_10013831 | 3300013306 | Bacteria | 7884 |
| 228 | Ga0163162_10063754 | 3300013306 | Bacteria | 3729 |
| 229 | Ga0163162_10084864 | 3300013306 | Bacteria | 3243 |
| 230 | Ga0157375_10034395 | 3300013308 | Bacteria | 4828 |
| 231 | Ga0157375_10071045 | 3300013308 | Bacteria | 3493 |
| 232 | Ga0157375_10090982 | 3300013308 | Bacteria | 3111 |
| 233 | Ga0157375_10093775 | 3300013308 | Bacteria | 3068 |
| 234 | Ga0157375_10321490 | 3300013308 | Bacteria | 1712 |
| 235 | Ga0157514_117819 | 3300013874 | Bacteria | 1399 |
| 236 | Ga0163163_10006892 | 3300014325 | Bacteria | 9972 |
| 237 | Ga0163163_10007177 | 3300014325 | Bacteria | 9807 |
| 238 | Ga0163163_10022048 | 3300014325 | Bacteria | 6023 |
| 239 | Ga0163163_10155715 | 3300014325 | Bacteria | 2329 |
| 240 | Ga0157380_10212372 | 3300014326 | Bacteria | 1725 |
| 241 | Ga0157380_10334370 | 3300014326 | Bacteria | 1410 |
| 242 | Ga0157380_10553380 | 3300014326 | Bacteria | 1129 |
| 243 | Ga0157377_10120278 | 3300014745 | Bacteria | 1591 |
| 244 | Ga0157379_10000582 | 3300014968 | Bacteria | 29612 |
| 245 | Ga0157379_10013160 | 3300014968 | Bacteria | 7243 |
| 246 | Ga0157379_10020478 | 3300014968 | Bacteria | 5848 |
| 247 | Ga0157379_10066258 | 3300014968 | Bacteria | 3228 |
| 248 | Ga0157376_10005475 | 3300014969 | Bacteria | 8876 |
| 249 | Ga0157376_10258612 | 3300014969 | Bacteria | 1630 |
| 250 | Ga0157376_10433034 | 3300014969 | Bacteria | 1279 |
| 251 | Ga0207427_100078 | 3300025231 | Bacteria | 147526 |
| 252 | Ga0209437_100269 | 3300025233 | Bacteria | 78465 |
| 253 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 254 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 255 | Ga0209758_1020489 | 3300025297 | Bacteria | 3126 |
| 256 | Ga0209257_1000320 | 3300025304 | Bacteria | 100514 |
| 257 | Ga0207656_10009788 | 3300025321 | Bacteria | 3566 |
| 258 | Ga0207682_10009865 | 3300025893 | Bacteria | 3755 |
| 259 | Ga0207710_10000476 | 3300025900 | Bacteria | 25539 |
| 260 | Ga0207688_10014218 | 3300025901 | Bacteria | 4331 |
| 261 | Ga0207680_10001143 | 3300025903 | Bacteria | 12531 |
| 262 | Ga0207680_10127942 | 3300025903 | Bacteria | 1670 |
| 263 | Ga0207680_10237765 | 3300025903 | Bacteria | 1254 |
| 264 | Ga0207647_10000023 | 3300025904 | Bacteria | 115648 |
| 265 | Ga0207685_10068553 | 3300025905 | Bacteria | 1430 |
| 266 | Ga0207699_10009931 | 3300025906 | Bacteria | 4758 |
| 267 | Ga0207699_10085935 | 3300025906 | Bacteria | 1963 |
| 268 | Ga0207699_10200999 | 3300025906 | Bacteria | 1350 |
| 269 | Ga0207645_10001854 | 3300025907 | Bacteria | 17042 |
| 270 | Ga0207643_10017461 | 3300025908 | Bacteria | 3924 |
| 271 | Ga0207654_10032951 | 3300025911 | Bacteria | 2868 |
| 272 | Ga0207707_10155488 | 3300025912 | Bacteria | 2000 |
| 273 | Ga0207695_10124934 | 3300025913 | Bacteria | 2537 |
| 274 | Ga0207671_10059103 | 3300025914 | Bacteria | 2842 |
| 275 | Ga0207671_10149582 | 3300025914 | Bacteria | 1804 |
| 276 | Ga0207693_10057352 | 3300025915 | Bacteria | 3052 |
| 277 | Ga0207663_10040104 | 3300025916 | Bacteria | 2843 |
| 278 | Ga0207663_10141261 | 3300025916 | Bacteria | 1678 |
| 279 | Ga0207660_10104230 | 3300025917 | Bacteria | 2123 |
| 280 | Ga0207662_10019974 | 3300025918 | Bacteria | 3818 |
| 281 | Ga0207652_10298171 | 3300025921 | Bacteria | 1455 |
| 282 | Ga0207646_10050906 | 3300025922 | Bacteria | 3706 |
| 283 | Ga0207646_10198919 | 3300025922 | Bacteria | 1810 |
| 284 | Ga0207681_10001838 | 3300025923 | Bacteria | 13602 |
| 285 | Ga0207681_10072512 | 3300025923 | Bacteria | 2405 |
| 286 | Ga0207694_10001346 | 3300025924 | Bacteria | 21151 |
| 287 | Ga0207694_10014918 | 3300025924 | Bacteria | 5861 |
| 288 | Ga0207650_10244520 | 3300025925 | Bacteria | 1451 |
| 289 | Ga0207650_10294493 | 3300025925 | Bacteria | 1324 |
| 290 | Ga0207659_10020124 | 3300025926 | Bacteria | 4405 |
| 291 | Ga0207659_10069091 | 3300025926 | Bacteria | 2571 |
| 292 | Ga0207659_10070286 | 3300025926 | Bacteria | 2553 |
| 293 | Ga0207687_10246324 | 3300025927 | Bacteria | 1419 |
| 294 | Ga0207687_10248435 | 3300025927 | Bacteria | 1413 |
| 295 | Ga0207700_10026226 | 3300025928 | Bacteria | 4061 |
| 296 | Ga0207700_10138844 | 3300025928 | Bacteria | 1994 |
| 297 | Ga0207664_10152129 | 3300025929 | Bacteria | 1966 |
| 298 | Ga0207664_10423546 | 3300025929 | Bacteria | 1186 |
| 299 | Ga0207644_10008675 | 3300025931 | Bacteria | 6651 |
| 300 | Ga0207644_10147475 | 3300025931 | Bacteria | 1818 |
| 301 | Ga0207644_10150385 | 3300025931 | Bacteria | 1801 |
| 302 | Ga0207690_10372913 | 3300025932 | Bacteria | 1132 |
| 303 | Ga0207706_10001054 | 3300025933 | Bacteria | 28009 |
| 304 | Ga0207706_10131782 | 3300025933 | Bacteria | 2199 |
| 305 | Ga0207706_10308168 | 3300025933 | Bacteria | 1379 |
| 306 | Ga0207686_10071184 | 3300025934 | Bacteria | 2237 |
| 307 | Ga0207709_10176742 | 3300025935 | Bacteria | 1504 |
| 308 | Ga0207670_10042765 | 3300025936 | Bacteria | 2987 |
| 309 | Ga0207669_10009963 | 3300025937 | Bacteria | 4554 |
| 310 | Ga0207669_10184568 | 3300025937 | Bacteria | 1499 |
| 311 | Ga0207704_10002135 | 3300025938 | Bacteria | 8867 |
| 312 | Ga0207704_10121346 | 3300025938 | Bacteria | 1789 |
| 313 | Ga0207665_10002370 | 3300025939 | Bacteria | 12728 |
| 314 | Ga0207665_10102047 | 3300025939 | Bacteria | 2004 |
| 315 | Ga0207691_10003801 | 3300025940 | Bacteria | 14652 |
| 316 | Ga0207691_10039626 | 3300025940 | Bacteria | 4359 |
| 317 | Ga0207691_10043987 | 3300025940 | Bacteria | 4113 |
| 318 | Ga0207691_10092581 | 3300025940 | Bacteria | 2707 |
| 319 | Ga0207691_10116662 | 3300025940 | Bacteria | 2369 |
| 320 | Ga0207711_10004050 | 3300025941 | Bacteria | 12578 |
| 321 | Ga0207711_10006169 | 3300025941 | Bacteria | 10129 |
| 322 | Ga0207711_10007272 | 3300025941 | Bacteria | 9280 |
| 323 | Ga0207711_10008374 | 3300025941 | Bacteria | 8653 |
| 324 | Ga0207711_10084500 | 3300025941 | Bacteria | 2778 |
| 325 | Ga0207711_10164705 | 3300025941 | Bacteria | 2009 |
| 326 | Ga0207689_10000420 | 3300025942 | Bacteria | 39774 |
| 327 | Ga0207689_10030636 | 3300025942 | Bacteria | 4483 |
| 328 | Ga0207679_10049986 | 3300025945 | Bacteria | 3052 |
| 329 | Ga0207667_10085523 | 3300025949 | Bacteria | 3265 |
| 330 | Ga0207651_10046175 | 3300025960 | Bacteria | 2927 |
| 331 | Ga0207712_10000497 | 3300025961 | Bacteria | 32461 |
| 332 | Ga0207712_10001195 | 3300025961 | Bacteria | 17947 |
| 333 | Ga0207712_10009947 | 3300025961 | Bacteria | 6028 |
| 334 | Ga0207712_10065522 | 3300025961 | Unclassified | 2593 |
| 335 | Ga0207712_10080046 | 3300025961 | Bacteria | 2375 |
| 336 | Ga0207712_10124647 | 3300025961 | Bacteria | 1954 |
| 337 | Ga0207668_10010396 | 3300025972 | Bacteria | 5622 |
| 338 | Ga0207668_10039821 | 3300025972 | Bacteria | 3167 |
| 339 | Ga0207640_10106669 | 3300025981 | Bacteria | 1976 |
| 340 | Ga0207658_10000013 | 3300025986 | Bacteria | 220396 |
| 341 | Ga0207658_10026416 | 3300025986 | Bacteria | 4070 |
| 342 | Ga0207658_10034373 | 3300025986 | Bacteria | 3623 |
| 343 | Ga0207658_10083471 | 3300025986 | Bacteria | 2455 |
| 344 | Ga0207658_10319061 | 3300025986 | Bacteria | 1344 |
| 345 | Ga0207658_10331814 | 3300025986 | Bacteria | 1319 |
| 346 | Ga0207677_10070579 | 3300026023 | Bacteria | 2462 |
| 347 | Ga0207677_10254928 | 3300026023 | Bacteria | 1427 |
| 348 | Ga0207703_10000903 | 3300026035 | Bacteria | 29058 |
| 349 | Ga0207703_10002516 | 3300026035 | Bacteria | 15842 |
| 350 | Ga0207703_10003172 | 3300026035 | Bacteria | 13856 |
| 351 | Ga0207703_10021796 | 3300026035 | Bacteria | 5016 |
| 352 | Ga0207703_10130916 | 3300026035 | Bacteria | 2166 |
| 353 | Ga0207639_10000358 | 3300026041 | Bacteria | 31541 |
| 354 | Ga0207639_10051992 | 3300026041 | Bacteria | 3119 |
| 355 | Ga0207639_10145763 | 3300026041 | Bacteria | 1978 |
| 356 | Ga0207678_10000035 | 3300026067 | Bacteria | 104807 |
| 357 | Ga0207678_10008148 | 3300026067 | Bacteria | 9240 |
| 358 | Ga0207678_10018584 | 3300026067 | Bacteria | 6103 |
| 359 | Ga0207708_10048235 | 3300026075 | Bacteria | 3242 |
| 360 | Ga0207708_10097390 | 3300026075 | Bacteria | 2273 |
| 361 | Ga0207708_10100968 | 3300026075 | Bacteria | 2233 |
| 362 | Ga0207702_10025571 | 3300026078 | Bacteria | 4901 |
| 363 | Ga0207702_10119662 | 3300026078 | Bacteria | 2355 |
| 364 | Ga0207641_10010239 | 3300026088 | Bacteria | 7712 |
| 365 | Ga0207641_10042392 | 3300026088 | Bacteria | 3818 |
| 366 | Ga0207641_10088545 | 3300026088 | Bacteria | 2703 |
| 367 | Ga0207641_10340581 | 3300026088 | Bacteria | 1427 |
| 368 | Ga0207641_10624679 | 3300026088 | Bacteria | 1056 |
| 369 | Ga0207648_10002529 | 3300026089 | Bacteria | 19616 |
| 370 | Ga0207648_10022290 | 3300026089 | Bacteria | 5690 |
| 371 | Ga0207648_10101818 | 3300026089 | Bacteria | 2517 |
| 372 | Ga0207676_10013978 | 3300026095 | Bacteria | 5762 |
| 373 | Ga0207676_10096813 | 3300026095 | Bacteria | 2437 |
| 374 | Ga0207674_10028258 | 3300026116 | Bacteria | 5921 |
| 375 | Ga0207674_10220162 | 3300026116 | Bacteria | 1846 |
| 376 | Ga0207675_100001375 | 3300026118 | Bacteria | 24392 |
| 377 | Ga0207675_100001538 | 3300026118 | Bacteria | 23106 |
| 378 | Ga0207675_100005535 | 3300026118 | Bacteria | 12079 |
| 379 | Ga0207675_100592945 | 3300026118 | Bacteria | 1110 |
| 380 | Ga0207683_10002153 | 3300026121 | Bacteria | 17293 |
| 381 | Ga0207683_10409917 | 3300026121 | Bacteria | 1247 |
| 382 | Ga0207698_10260319 | 3300026142 | Bacteria | 1593 |
| 383 | Ga0209967_1005804 | 3300027364 | Bacteria | 1667 |
| 384 | Ga0209179_1019016 | 3300027512 | Bacteria | 1318 |
| 385 | Ga0209982_1001490 | 3300027552 | Bacteria | 3208 |
| 386 | Ga0209970_1002881 | 3300027614 | Bacteria | 2901 |
| 387 | Ga0209970_1016975 | 3300027614 | Bacteria | 1217 |
| 388 | Ga0209983_1006498 | 3300027665 | Bacteria | 2399 |
| 389 | Ga0209971_1000146 | 3300027682 | Bacteria | 21299 |
| 390 | Ga0209971_1044146 | 3300027682 | Bacteria | 1074 |
| 391 | Ga0209998_10003678 | 3300027717 | Bacteria | 3324 |
| 392 | Ga0209974_10000982 | 3300027876 | Bacteria | 10016 |
| 393 | Ga0207428_10006228 | 3300027907 | Bacteria | 11027 |
| 394 | Ga0207428_10040358 | 3300027907 | Bacteria | 3787 |
| 395 | Ga0207428_10043466 | 3300027907 | Bacteria | 3628 |
| 396 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 397 | Ga0268266_10047960 | 3300028379 | Bacteria | 3661 |
| 398 | Ga0268266_10075018 | 3300028379 | Bacteria | 2937 |
| 399 | Ga0268265_10000265 | 3300028380 | Bacteria | 59618 |
| 400 | Ga0268265_10004411 | 3300028380 | Bacteria | 9777 |
| 401 | Ga0268264_10017578 | 3300028381 | Bacteria | 5856 |
| 402 | Ga0268264_10017949 | 3300028381 | Bacteria | 5788 |
| 403 | Ga0268264_10054196 | 3300028381 | Bacteria | 3348 |
| 404 | Ga0268264_10187951 | 3300028381 | Bacteria | 1881 |
| 405 | Ga0268264_10380589 | 3300028381 | Bacteria | 1351 |
| 406 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 407 | Ga0307515_10001585 | 3300028794 | Bacteria | 50742 |
| 408 | Ga0307515_10034838 | 3300028794 | Bacteria | 8220 |
| 409 | Ga0307511_10000770 | 3300030521 | Bacteria | 34194 |
| 410 | Ga0307511_10009742 | 3300030521 | Bacteria | 9564 |
| 411 | Ga0316177_1212585 | 3300030731 | Bacteria | 2330 |
| 412 | Ga0314311_1053136 | 3300030733 | Bacteria | 3107 |
| 413 | Ga0316178_1144806 | 3300030735 | Bacteria | 2655 |
| 414 | Ga0316182_1301532 | 3300030745 | Bacteria | 1227 |
| 415 | Ga0265760_10012825 | 3300031090 | Bacteria | 2398 |
| 416 | Ga0265760_10032301 | 3300031090 | Bacteria | 1545 |
| 417 | Ga0265328_10036166 | 3300031239 | Bacteria | 1825 |
| 418 | Ga0265320_10045306 | 3300031240 | Bacteria | 2162 |
| 419 | Ga0265316_10020329 | 3300031344 | Bacteria | 5654 |
| 420 | Ga0307513_10009095 | 3300031456 | Bacteria | 12593 |
| 421 | Ga0307513_10042642 | 3300031456 | Bacteria | 4993 |
| 422 | Ga0307513_10249012 | 3300031456 | Bacteria | 1575 |
| 423 | Ga0307509_10000027 | 3300031507 | Bacteria | 228470 |
| 424 | Ga0307408_100044630 | 3300031548 | Bacteria | 3160 |
| 425 | Ga0307408_100064093 | 3300031548 | Bacteria | 2690 |
| 426 | Ga0307408_100236624 | 3300031548 | Bacteria | 1499 |
| 427 | Ga0307408_100285769 | 3300031548 | Bacteria | 1375 |
| 428 | Ga0307508_10059173 | 3300031616 | Bacteria | 3389 |
| 429 | Ga0307514_10134047 | 3300031649 | Bacteria | 1699 |
| 430 | Ga0316579_10077429 | 3300031691 | Bacteria | 1581 |
| 431 | Ga0316576_10042024 | 3300031727 | Bacteria | 3293 |
| 432 | Ga0316578_10050637 | 3300031728 | Bacteria | 2430 |
| 433 | Ga0307516_10000124 | 3300031730 | Bacteria | 90831 |
| 434 | Ga0307405_10010532 | 3300031731 | Bacteria | 4799 |
| 435 | Ga0307413_10131216 | 3300031824 | Bacteria | 1715 |
| 436 | Ga0307410_10123941 | 3300031852 | Bacteria | 1888 |
| 437 | Ga0307410_10156899 | 3300031852 | Bacteria | 1701 |
| 438 | Ga0307410_10266439 | 3300031852 | Bacteria | 1338 |
| 439 | Ga0307406_10086940 | 3300031901 | Bacteria | 2094 |
| 440 | Ga0307406_10118447 | 3300031901 | Bacteria | 1836 |
| 441 | Ga0307406_10185926 | 3300031901 | Bacteria | 1517 |
| 442 | Ga0307406_10187950 | 3300031901 | Bacteria | 1510 |
| 443 | Ga0307407_10082493 | 3300031903 | Bacteria | 1948 |
| 444 | Ga0307412_10090193 | 3300031911 | Bacteria | 2142 |
| 445 | Ga0307412_10216181 | 3300031911 | Bacteria | 1466 |
| 446 | Ga0307409_100394056 | 3300031995 | Bacteria | 1320 |
| 447 | Ga0307416_100093696 | 3300032002 | Bacteria | 2588 |
| 448 | Ga0307416_100229109 | 3300032002 | Bacteria | 1789 |
| 449 | Ga0307416_100329266 | 3300032002 | Bacteria | 1534 |
| 450 | Ga0307414_10001460 | 3300032004 | Bacteria | 12275 |
| 451 | Ga0307414_10078205 | 3300032004 | Bacteria | 2410 |
| 452 | Ga0307414_10130620 | 3300032004 | Bacteria | 1949 |
| 453 | Ga0307411_10056262 | 3300032005 | Bacteria | 2592 |
| 454 | Ga0307411_10126842 | 3300032005 | Bacteria | 1857 |
| 455 | Ga0307415_100001747 | 3300032126 | Bacteria | 10595 |
| 456 | Ga0307415_100236682 | 3300032126 | Bacteria | 1474 |
| 457 | Ga0316585_10019900 | 3300032137 | Bacteria | 2050 |
| 458 | Ga0316580_10008031 | 3300032139 | Bacteria | 3156 |
| 459 | Ga0307507_10190134 | 3300033179 | Bacteria | 1445 |
| 460 | Ga0307510_10040563 | 3300033180 | Bacteria | 5108 |
| 461 | Ga0373936_0011954 | 3300035113 | Bacteria | 3295 |
| 462 | Ga0373936_0049973 | 3300035113 | Unclassified | 1690 |
| 463 | Ga0373953_0011392 | 3300035117 | Bacteria | 3121 |
| 464 | Ga0373954_0021707 | 3300035118 | Bacteria | 2908 |
| 465 | Ga0373956_0024990 | 3300035119 | Bacteria | 2579 |
| 466 | Ga0373943_0024951 | 3300035170 | Bacteria | 2791 |
| 467 | Ga0373946_0048063 | 3300035171 | Bacteria | 1775 |
| 468 | Ga0373946_0210728 | 3300035171 | Bacteria | 935 |
| 469 | Ga0373955_0003163 | 3300035172 | Bacteria | 7205 |
| 470 | Ga0316574_0008937 | 3300035398 | Bacteria | 5593 |
| 471 | Ga0316574_0027044 | 3300035398 | Bacteria | 3453 |
| 472 | Ga0373924_0076498 | 3300035410 | Bacteria | 1418 |
| 473 | Ga0373927_0005121 | 3300035695 | Bacteria | 9071 |
| 474 | Ga0373947_0114530 | 3300035725 | Bacteria | 1708 |
| 475 | Ga0373937_0167084 | 3300036401 | Bacteria | 2063 |
| 476 | Ga0373937_0211916 | 3300036401 | Bacteria | 1823 |
| 477 | Ga0316582_0016320 | 3300036647 | Bacteria | 4269 |
| 478 | Ga0316584_0052157 | 3300036712 | Bacteria | 3059 |
| 479 | Ga0373925_0392282 | 3300037068 | Bacteria | 1131 |
| 480 | Ga0395905_0387890 | 3300037471 | Bacteria | 1291 |
| 481 | Ga0436365_0070472 | 3300039437 | Bacteria | 3727 |
| 482 | Ga0436360_0224161 | 3300039438 | Bacteria | 5586 |
| 483 | Ga0436360_0301134 | 3300039438 | Bacteria | 18034 |
| 484 | Ga0436363_0111232 | 3300039450 | Bacteria | 6624 |
| 485 | Ga0436363_1716318 | 3300039450 | Bacteria | 12929 |
| 486 | Ga0436362_0385862 | 3300039453 | Bacteria | 1218 |
| 487 | Ga0436362_0749119 | 3300039453 | Bacteria | 4045 |
| 488 | Ga0439436_0012024 | 3300041404 | Bacteria | 2628 |
| 489 | Ga0439439_0000514 | 3300041406 | Bacteria | 6699 |
| 490 | Ga0439447_001277 | 3300041407 | Bacteria | 9165 |
| 491 | Ga0439461_0029806 | 3300041410 | Bacteria | 1131 |
| 492 | Ga0439465_0000082 | 3300041413 | Bacteria | 20853 |
| 493 | Ga0439465_0006147 | 3300041413 | Bacteria | 3818 |
| 494 | Ga0451787_431538 | 3300041441 | Bacteria | 1860 |
| 495 | Ga0451798_0667076 | 3300041458 | Bacteria | 1165 |
| 496 | Ga0451807_1932045 | 3300041486 | Bacteria | 1748 |
| 497 | Ga0451837_0168380 | 3300041494 | Bacteria | 2146 |
| 498 | Ga0451837_0313789 | 3300041494 | Bacteria | 3885 |
| 499 | Ga0451837_0564735 | 3300041494 | Bacteria | 2038 |
| 500 | Ga0451843_0368400 | 3300041509 | Bacteria | 3428 |
| 501 | Ga0451843_0657080 | 3300041509 | Bacteria | 2346 |
| 502 | Ga0439445_0000501 | 3300042004 | Bacteria | 7958 |
| 503 | Ga0439445_0021552 | 3300042004 | Bacteria | 1619 |
| 504 | Ga0439449_0000032 | 3300042007 | Bacteria | 41302 |
| 505 | Ga0439449_0002771 | 3300042007 | Bacteria | 6817 |
| 506 | Ga0439456_007190 | 3300042013 | Bacteria | 2283 |
| 507 | Ga0439462_0003159 | 3300042015 | Bacteria | 3926 |
| 508 | Ga0439462_0024343 | 3300042015 | Bacteria | 1590 |
| 509 | Ga0439462_0034877 | 3300042015 | Bacteria | 1336 |
| 510 | Ga0450912_004142 | 3300042116 | Bacteria | 1065 |
| 511 | Ga0450920_001070 | 3300042122 | Bacteria | 4486 |
| 512 | Ga0450923_003341 | 3300042125 | Bacteria | 2410 |
| 513 | Ga0450894_004776 | 3300042131 | Bacteria | 1754 |
| 514 | Ga0450895_000886 | 3300042132 | Bacteria | 1923 |
| 515 | Ga0450896_001169 | 3300042133 | Bacteria | 3140 |
| 516 | Ga0450896_005553 | 3300042133 | Bacteria | 1720 |
| 517 | Ga0450898_030166 | 3300042134 | Bacteria | 992 |
| 518 | Ga0450899_005738 | 3300042135 | Bacteria | 1337 |
| 519 | Ga0450905_023132 | 3300042142 | Bacteria | 926 |
| 520 | Ga0439446_0000164 | 3300042156 | Bacteria | 11604 |
| 521 | Ga0439446_0001699 | 3300042156 | Bacteria | 5098 |
| 522 | Ga0439446_0011568 | 3300042156 | Bacteria | 2399 |
| 523 | Ga0450908_000154 | 3300042184 | Bacteria | 14278 |
| 524 | Ga0450908_003399 | 3300042184 | Bacteria | 3091 |
| 525 | Ga0439434_0007291 | 3300042435 | Bacteria | 3241 |
| 526 | Ga0439434_0007927 | 3300042435 | Bacteria | 3114 |
| 527 | Ga0439435_0001735 | 3300042436 | Bacteria | 4132 |
| 528 | Ga0439435_0024303 | 3300042436 | Bacteria | 1598 |
| 529 | Ga0439444_0000070 | 3300042437 | Bacteria | 7673 |
| 530 | Ga0439460_0066883 | 3300042461 | Bacteria | 1106 |
| 531 | Ga0451577_0031377 | 3300042876 | Bacteria | 4794 |
| 532 | Ga0451577_0033382 | 3300042876 | Bacteria | 4639 |
| 533 | Ga0451577_0101371 | 3300042876 | Bacteria | 2572 |
| 534 | Ga0451577_0141000 | 3300042876 | Bacteria | 2166 |
| 535 | Ga0453683_0012346 | 3300044673 | Bacteria | 5601 |
| 536 | Ga0453684_0059426 | 3300044712 | Bacteria | 4928 |
| 537 | Ga0451576_0072218 | 3300045051 | Bacteria | 3592 |
| 538 | Ga0451576_0079329 | 3300045051 | Bacteria | 3416 |
| 539 | Ga0451576_0223220 | 3300045051 | Bacteria | 1967 |
| 540 | Ga0495638_0033613 | 3300046460 | Bacteria | 3279 |
| 541 | Ga0495580_0000644 | 3300046472 | Bacteria | 29589 |
| 542 | Ga0495580_0033449 | 3300046472 | Bacteria | 3704 |
| 543 | Ga0495582_0073347 | 3300046473 | Bacteria | 1895 |
| 544 | Ga0495607_0006481 | 3300046501 | Bacteria | 8233 |
| 545 | Ga0495606_0057086 | 3300046507 | Bacteria | 2515 |
| 546 | Ga0495616_0006294 | 3300046513 | Bacteria | 7202 |
| 547 | Ga0495618_0039572 | 3300046514 | Bacteria | 2964 |
| 548 | Ga0495630_0088465 | 3300046517 | Bacteria | 2339 |
| 549 | Ga0495632_0015015 | 3300046519 | Bacteria | 4358 |
| 550 | Ga0495663_0001923 | 3300046525 | Bacteria | 6396 |
| 551 | Ga0495663_0016887 | 3300046525 | Bacteria | 2066 |
| 552 | Ga0495652_0176366 | 3300046529 | Bacteria | 1645 |
| 553 | Ga0495654_0040084 | 3300046530 | Bacteria | 2336 |
| 554 | Ga0495665_0052347 | 3300046531 | Bacteria | 2161 |
| 555 | Ga0495656_0003475 | 3300046615 | Bacteria | 5328 |
| 556 | Ga0495668_0001998 | 3300046616 | Bacteria | 17828 |
| 557 | Ga0495625_0220610 | 3300046660 | Unclassified | 1243 |
| 558 | Ga0495658_0098053 | 3300046683 | Bacteria | 1746 |
| 559 | Ga0495671_0010623 | 3300046692 | Bacteria | 5092 |
| 560 | Ga0495636_0012071 | 3300047318 | Bacteria | 3423 |
| 561 | Ga0495674_0068819 | 3300047319 | Bacteria | 3063 |
| 562 | Ga0495687_039914 | 3300047443 | Bacteria | 2073 |
| 563 | Ga0495687_042586 | 3300047443 | Bacteria | 1983 |
| 564 | Ga0495681_0060317 | 3300047470 | Bacteria | 1751 |
| 565 | Ga0495686_0005221 | 3300047472 | Bacteria | 10319 |
| 566 | Ga0495686_0009853 | 3300047472 | Bacteria | 6849 |
| 567 | Ga0495686_0140710 | 3300047472 | Bacteria | 1424 |
| 568 | Ga0496100_0028539 | 3300048903 | Bacteria | 3442 |
| 569 | Ga0496100_0100353 | 3300048903 | Bacteria | 1994 |
| 570 | Ga0496101_0014924 | 3300048904 | Bacteria | 5226 |
| 571 | Ga0496101_0158631 | 3300048904 | Bacteria | 1734 |
| 572 | Ga0496102_0017596 | 3300048905 | Bacteria | 6263 |
| 573 | Ga0496102_0024722 | 3300048905 | Bacteria | 5342 |
| 574 | Ga0496102_0030471 | 3300048905 | Bacteria | 4829 |
| 575 | Ga0496103_0392308 | 3300048906 | Bacteria | 892 |
| 576 | Ga0496104_0024382 | 3300048907 | Bacteria | 5564 |
| 577 | Ga0496104_0048421 | 3300048907 | Bacteria | 4007 |
| 578 | Ga0496104_0083406 | 3300048907 | Bacteria | 3048 |
| 579 | Ga0496105_0006655 | 3300048908 | Bacteria | 8895 |
| 580 | Ga0496105_0025846 | 3300048908 | Bacteria | 4783 |
| 581 | Ga0496105_0075079 | 3300048908 | Bacteria | 2792 |
| 582 | Ga0496106_0018939 | 3300048909 | Bacteria | 5099 |
| 583 | Ga0496106_0216277 | 3300048909 | Bacteria | 1527 |
| 584 | Ga0496106_0472856 | 3300048909 | Bacteria | 1007 |
| 585 | Ga0496107_0048752 | 3300048910 | Bacteria | 3052 |
| 586 | Ga0496107_0049854 | 3300048910 | Bacteria | 3017 |
| 587 | Ga0496108_0007699 | 3300048911 | Bacteria | 8726 |
| 588 | Ga0496108_0037739 | 3300048911 | Bacteria | 4025 |
| 589 | Ga0496108_0081456 | 3300048911 | Bacteria | 2743 |
| 590 | Ga0496109_0008990 | 3300048912 | Bacteria | 8507 |
| 591 | Ga0496109_0023299 | 3300048912 | Bacteria | 5494 |
| 592 | Ga0496110_0004795 | 3300048913 | Bacteria | 10531 |
| 593 | Ga0496110_0127191 | 3300048913 | Bacteria | 2299 |
| 594 | Ga0496111_0006835 | 3300048914 | Bacteria | 7440 |
| 595 | Ga0496111_0023774 | 3300048914 | Bacteria | 4305 |
| 596 | Ga0496112_0015409 | 3300048915 | Bacteria | 7134 |
| 597 | Ga0496112_0036629 | 3300048915 | Bacteria | 4787 |
| 598 | Ga0496112_0175307 | 3300048915 | Bacteria | 2109 |
| 599 | Ga0496112_0182713 | 3300048915 | Bacteria | 2061 |
| 600 | Ga0496113_0056328 | 3300048916 | Bacteria | 2951 |
| 601 | Ga0496114_0005482 | 3300048917 | Bacteria | 9930 |
| 602 | Ga0496114_0005933 | 3300048917 | Bacteria | 9602 |
| 603 | Ga0496114_0074719 | 3300048917 | Bacteria | 2853 |
| 604 | Ga0496114_0129251 | 3300048917 | Bacteria | 2180 |
| 605 | Ga0496115_0315863 | 3300048918 | Bacteria | 1278 |
| 606 | Ga0496119_0003056 | 3300048922 | Bacteria | 17701 |
| 607 | Ga0496120_0000106 | 3300048923 | Bacteria | 140132 |
| 608 | Ga0496121_0003518 | 3300048924 | Bacteria | 22236 |
| 609 | Ga0496121_0207174 | 3300048924 | Bacteria | 1392 |
| 610 | Ga0496122_0000062 | 3300048925 | Bacteria | 241387 |
| 611 | Ga0496122_0036620 | 3300048925 | Bacteria | 3963 |
| 612 | Ga0496123_0003624 | 3300048926 | Bacteria | 17095 |
| 613 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 614 | Ga0496125_0001682 | 3300048928 | Bacteria | 30939 |
| 615 | Ga0496125_0008883 | 3300048928 | Bacteria | 10435 |
| 616 | Ga0496125_0169280 | 3300048928 | Bacteria | 1471 |
| 617 | Ga0496126_0010089 | 3300048929 | Bacteria | 9961 |
| 618 | Ga0496126_0047195 | 3300048929 | Bacteria | 3944 |
| 619 | Ga0496126_0050926 | 3300048929 | Bacteria | 3773 |
| 620 | Ga0496126_0054895 | 3300048929 | Bacteria | 3606 |
| 621 | Ga0501031_0048098 | 3300049568 | Bacteria | 2780 |
| 622 | Ga0501033_0177674 | 3300049570 | Bacteria | 1527 |
| 623 | Ga0501034_0000535 | 3300049571 | Bacteria | 60322 |
| 624 | Ga0501034_0001201 | 3300049571 | Bacteria | 35561 |
| 625 | Ga0501036_0241845 | 3300049572 | Bacteria | 1513 |
| 626 | Ga0501038_0094761 | 3300049574 | Bacteria | 2495 |
| 627 | Ga0501038_0181659 | 3300049574 | Bacteria | 1697 |
| 628 | Ga0501039_0002777 | 3300049575 | Bacteria | 13067 |
| 629 | Ga0501039_0081272 | 3300049575 | Bacteria | 2523 |
| 630 | Ga0501040_0015552 | 3300049576 | Bacteria | 5028 |
| 631 | Ga0501040_0145313 | 3300049576 | Bacteria | 1672 |
| 632 | Ga0501041_0003477 | 3300049577 | Bacteria | 9064 |
| 633 | Ga0501041_0076763 | 3300049577 | Bacteria | 2055 |
| 634 | Ga0501042_0131356 | 3300049578 | Bacteria | 1805 |
| 635 | Ga0501042_0131567 | 3300049578 | Bacteria | 1803 |
| 636 | Ga0501042_0154439 | 3300049578 | Bacteria | 1655 |
| 637 | Ga0501043_0319071 | 3300049579 | Bacteria | 1185 |
| 638 | Ga0501046_0348846 | 3300049580 | Bacteria | 1075 |
| 639 | Ga0501048_0066269 | 3300049582 | Bacteria | 2553 |
| 640 | Ga0501048_0089211 | 3300049582 | Bacteria | 2175 |
| 641 | Ga0501068_0003148 | 3300049584 | Bacteria | 8838 |
| 642 | Ga0501068_0035560 | 3300049584 | Bacteria | 2974 |
| 643 | Ga0501068_0059770 | 3300049584 | Bacteria | 2314 |
| 644 | Ga0501069_0014481 | 3300049585 | Bacteria | 4217 |
| 645 | Ga0501069_0019608 | 3300049585 | Bacteria | 3659 |
| 646 | Ga0501070_0005780 | 3300049586 | Bacteria | 10552 |
| 647 | Ga0501071_0003130 | 3300049587 | Bacteria | 10277 |
| 648 | Ga0501071_0042026 | 3300049587 | Bacteria | 3274 |
| 649 | Ga0501071_0071428 | 3300049587 | Bacteria | 2530 |
| 650 | Ga0501072_0004971 | 3300049588 | Bacteria | 10112 |
| 651 | Ga0501072_0119005 | 3300049588 | Bacteria | 2104 |
| 652 | Ga0501073_0185122 | 3300049589 | Bacteria | 1441 |
| 653 | Ga0501074_0086613 | 3300049590 | Bacteria | 2244 |
| 654 | Ga0501075_0001687 | 3300049591 | Bacteria | 14503 |
| 655 | Ga0501075_0205900 | 3300049591 | Bacteria | 1501 |
| 656 | Ga0501076_0101409 | 3300049592 | Bacteria | 2320 |
| 657 | Ga0501076_0236033 | 3300049592 | Bacteria | 1495 |
| 658 | Ga0501076_0322454 | 3300049592 | Bacteria | 1267 |
| 659 | Ga0501076_0354315 | 3300049592 | Bacteria | 1205 |
| 660 | Ga0501077_0110055 | 3300049593 | Bacteria | 1745 |
| 661 | Ga0501077_0205025 | 3300049593 | Bacteria | 1253 |
| 662 | Ga0501077_0291335 | 3300049593 | Bacteria | 1039 |
| 663 | Ga0501225_0000494 | 3300049705 | Bacteria | 12289 |
| 664 | Ga0501079_0007430 | 3300049741 | Bacteria | 8292 |
| 665 | Ga0501079_0264102 | 3300049741 | Bacteria | 1345 |
| 666 | Ga0501079_0420898 | 3300049741 | Bacteria | 1048 |
| 667 | Ga0501080_0001700 | 3300049742 | Bacteria | 18781 |
| 668 | Ga0501080_0270265 | 3300049742 | Bacteria | 1547 |
| 669 | Ga0501080_0720171 | 3300049742 | Bacteria | 879 |
| 670 | Ga0501081_0034252 | 3300049743 | Bacteria | 3454 |
| 671 | Ga0501081_0119689 | 3300049743 | Bacteria | 1874 |
| 672 | Ga0501083_0097188 | 3300049744 | Bacteria | 1943 |
| 673 | Ga0501083_0190570 | 3300049744 | Bacteria | 1338 |
| 674 | Ga0501035_0125224 | 3300049822 | Bacteria | 2243 |
| 675 | Ga0501035_0263903 | 3300049822 | Bacteria | 1459 |
| 676 | Ga0501044_0213735 | 3300049823 | Bacteria | 1882 |
| 677 | Ga0501045_0002391 | 3300049824 | Bacteria | 12747 |
| 678 | Ga0501045_0104561 | 3300049824 | Bacteria | 2098 |
| 679 | Ga0501045_0203531 | 3300049824 | Bacteria | 1475 |
| 680 | nmdc:mga05p37_16313_c1 | 3300050507 | Bacteria | 8942 |
| 681 | nmdc:mga05p37_535989_c1 | 3300050507 | Bacteria | 1336 |
| 682 | nmdc:mga09592_238721_c1 | 3300050508 | Bacteria | 1575 |
| 683 | nmdc:mga09592_5514_c1 | 3300050508 | Bacteria | 10295 |
| 684 | nmdc:mga09592_7046_c1 | 3300050508 | Bacteria | 9134 |
| 685 | nmdc:mga0qj67_15753_c1 | 3300050509 | Bacteria | 4727 |
| 686 | nmdc:mga0qj67_161091_c1 | 3300050509 | Bacteria | 1821 |
| 687 | nmdc:mga0qj67_16660_c1 | 3300050509 | Bacteria | 5578 |
| 688 | nmdc:mga0qj67_23320_c1 | 3300050509 | Bacteria | 4759 |
| 689 | nmdc:mga06r32_13234_c1 | 3300050510 | Bacteria | 7472 |
| 690 | nmdc:mga06r32_1723_c1 | 3300050510 | Bacteria | 19677 |
| 691 | nmdc:mga06r32_2539_c1 | 3300050510 | Bacteria | 16326 |
| 692 | nmdc:mga06r32_31296_c1 | 3300050510 | Bacteria | 4996 |
| 693 | nmdc:mga06r32_76577_c1 | 3300050510 | Bacteria | 3249 |
| 694 | nmdc:mga06r32_87556_c1 | 3300050510 | Bacteria | 3039 |
| 695 | nmdc:mga08y16_182378_c1 | 3300050511 | Bacteria | 2179 |
| 696 | nmdc:mga08y16_198450_c1 | 3300050511 | Bacteria | 2080 |
| 697 | nmdc:mga08y16_412149_c1 | 3300050511 | Bacteria | 1382 |
| 698 | nmdc:mga08y16_65821_c1 | 3300050511 | Bacteria | 3783 |
| 699 | nmdc:mga08y16_66865_c1 | 3300050511 | Bacteria | 3751 |
| 700 | nmdc:mga0n895_5285_c1 | 3300050512 | Bacteria | 10754 |
| 701 | nmdc:mga0rr50_92098_c1 | 3300050513 | Bacteria | 2362 |
| 702 | nmdc:mga0a205_3924_c1 | 3300050515 | Bacteria | 5308 |
| 703 | Ga0500643_001459 | 3300053087 | Bacteria | 13601 |
| 704 | Ga0500651_0000120 | 3300053093 | Bacteria | 48678 |
| 705 | Ga0500597_000019 | 3300053120 | Bacteria | 34589 |
| 706 | Ga0501084_0016881 | 3300054114 | Bacteria | 6066 |
| 707 | Ga0501084_0145072 | 3300054114 | Bacteria | 1999 |
| 708 | Ga0501082_0006793 | 3300060353 | Bacteria | 9887 |
| 709 | Ga0501082_0027674 | 3300060353 | Bacteria | 4880 |
| 710 | Ga0501082_0044022 | 3300060353 | Bacteria | 3851 |
| 711 | Ga0501082_0058242 | 3300060353 | Bacteria | 3328 |
| 712 | Ga0501082_0251155 | 3300060353 | Bacteria | 1539 |
| 713 | Ga0530510_0073659 | 3300061734 | Bacteria | 2479 |
| 714 | Ga0530510_0180775 | 3300061734 | Bacteria | 1564 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005618 | Ga0068864_100564744 | Ga0068864_1005647441 | 246 |
| 2 | 3300035398 | Ga0316574_0008937 | Ga0316574_0008937_200_1021 | 258 |
| 3 | 3300042142 | Ga0450905_023132 | Ga0450905_023132_62_844 | 260 |
| 4 | 3300026041 | Ga0207639_10145763 | Ga0207639_101457632 | 263 |
| 5 | 3300050509 | nmdc:mga0qj67_23320_c1 | nmdc:mga0qj67_23320_c1_401_1192 | 263 |
| 6 | 3300050510 | nmdc:mga06r32_31296_c1 | nmdc:mga06r32_31296_c1_731_1522 | 263 |
| 7 | 3300006847 | Ga0075431_100056420 | Ga0075431_10005642010 | 265 |
| 8 | 3300007788 | Ga0099795_10000223 | Ga0099795_100002234 | 265 |
| 9 | 3300009176 | Ga0105242_10246197 | Ga0105242_102461972 | 265 |
| 10 | 3300009177 | Ga0105248_10128872 | Ga0105248_101288722 | 265 |
| 11 | 3300009551 | Ga0105238_10069286 | Ga0105238_100692862 | 265 |
| 12 | 3300013296 | Ga0157374_10021862 | Ga0157374_100218623 | 265 |
| 13 | 3300013297 | Ga0157378_10008041 | Ga0157378_100080413 | 265 |
| 14 | 3300013306 | Ga0163162_10063754 | Ga0163162_100637542 | 265 |
| 15 | 3300013308 | Ga0157375_10090982 | Ga0157375_100909822 | 265 |
| 16 | 3300014968 | Ga0157379_10000582 | Ga0157379_1000058220 | 265 |
| 17 | 3300014969 | Ga0157376_10005475 | Ga0157376_100054756 | 265 |
| 18 | 3300036401 | Ga0373937_0211916 | Ga0373937_0211916_238_1035 | 265 |
| 19 | 3300048906 | Ga0496103_0392308 | Ga0496103_0392308_62_859 | 265 |
| 20 | 3300048909 | Ga0496106_0472856 | Ga0496106_0472856_49_846 | 265 |
| 21 | 3300048912 | Ga0496109_0008990 | Ga0496109_0008990_5126_5923 | 265 |
| 22 | 3300048913 | Ga0496110_0127191 | Ga0496110_0127191_658_1455 | 265 |
| 23 | 3300048905 | Ga0496102_0017596 | Ga0496102_0017596_4210_5049 | 268 |
| 24 | 3300031616 | Ga0307508_10059173 | Ga0307508_100591731 | 273 |
| 25 | 3300009094 | Ga0111539_10000816 | Ga0111539_1000081622 | 275 |
| 26 | 3300009177 | Ga0105248_10192488 | Ga0105248_101924882 | 275 |
| 27 | 3300009553 | Ga0105249_10012997 | Ga0105249_100129972 | 275 |
| 28 | 3300010375 | Ga0105239_10589430 | Ga0105239_105894302 | 275 |
| 29 | 3300014969 | Ga0157376_10258612 | Ga0157376_102586122 | 275 |
| 30 | 3300037471 | Ga0395905_0387890 | Ga0395905_0387890_371_1198 | 275 |
| 31 | 3300046519 | Ga0495632_0015015 | Ga0495632_0015015_1886_2713 | 275 |
| 32 | 3300048922 | Ga0496119_0003056 | Ga0496119_0003056_15754_16581 | 275 |
| 33 | 3300048923 | Ga0496120_0000106 | Ga0496120_0000106_128345_129172 | 275 |
| 34 | 3300048924 | Ga0496121_0207174 | Ga0496121_0207174_470_1297 | 275 |
| 35 | 3300048928 | Ga0496125_0001682 | Ga0496125_0001682_5937_6764 | 275 |
| 36 | 3300048929 | Ga0496126_0047195 | Ga0496126_0047195_2461_3288 | 275 |
| 37 | 3300050508 | nmdc:mga09592_5514_c1 | nmdc:mga09592_5514_c1_8870_9697 | 275 |
| 38 | 3300050510 | nmdc:mga06r32_13234_c1 | nmdc:mga06r32_13234_c1_743_1570 | 275 |
| 39 | 3300050511 | nmdc:mga08y16_66865_c1 | nmdc:mga08y16_66865_c1_1546_2373 | 275 |
| 40 | iso_pu_bacteria | 2643221579 | 2643908325 | 275 |
| 41 | iso_pu_bacteria | 2643221581 | 2643914622 | 275 |
| 42 | iso_pu_bacteria | 2923516293 | 2923517049 | 275 |
| 43 | 3300042007 | Ga0439449_0002771 | Ga0439449_0002771_874_1704 | 276 |
| 44 | 3300042015 | Ga0439462_0034877 | Ga0439462_0034877_339_1169 | 276 |
| 45 | 3300042156 | Ga0439446_0011568 | Ga0439446_0011568_253_1149 | 276 |
| 46 | iso_pu_bacteria | 2643221559 | 2643818461 | 276 |
| 47 | iso_pu_bacteria | 2643221573 | 2643880672 | 276 |
| 48 | iso_pu_bacteria | 2643221586 | 2643938398 | 276 |
| 49 | iso_pu_bacteria | 2643221612 | 2644079049 | 276 |
| 50 | iso_pu_bacteria | 2643221720 | 2644661243 | 276 |
| 51 | iso_pu_bacteria | 2643221727 | 2644693826 | 276 |
| 52 | iso_pu_bacteria | 2643221728 | 2644699320 | 276 |
| 53 | iso_pu_bacteria | 2842780639 | 2842781358 | 276 |
| 54 | iso_pu_bacteria | 8002869464 | 8002872379 | 276 |
| 55 | 3300005983 | Ga0081540_1136257 | Ga0081540_11362572 | 277 |
| 56 | iso_pu_bacteria | 2643221593 | 2643973165 | 277 |
| 57 | 3300005334 | Ga0068869_100020047 | Ga0068869_1000200474 | 278 |
| 58 | 3300005456 | Ga0070678_100024718 | Ga0070678_1000247182 | 278 |
| 59 | 3300005471 | Ga0070698_100153532 | Ga0070698_1001535321 | 278 |
| 60 | 3300025922 | Ga0207646_10050906 | Ga0207646_100509062 | 278 |
| 61 | 3300025940 | Ga0207691_10039626 | Ga0207691_100396263 | 278 |
| 62 | 3300025942 | Ga0207689_10030636 | Ga0207689_100306361 | 278 |
| 63 | 3300003316 | rootH1_10102292 | rootH1_101022923 | 279 |
| 64 | 3300003320 | rootH2_10081999 | rootH2_100819992 | 279 |
| 65 | 3300003322 | rootL2_10033434 | rootL2_100334342 | 279 |
| 66 | 3300003323 | rootH1_10157784 | rootH1_101577843 | 279 |
| 67 | 3300005289 | Ga0065704_10144304 | Ga0065704_101443041 | 279 |
| 68 | 3300005293 | Ga0065715_10269957 | Ga0065715_102699571 | 279 |
| 69 | 3300005330 | Ga0070690_100007554 | Ga0070690_1000075543 | 279 |
| 70 | 3300005330 | Ga0070690_100041825 | Ga0070690_1000418252 | 279 |
| 71 | 3300005335 | Ga0070666_10003623 | Ga0070666_100036232 | 279 |
| 72 | 3300005335 | Ga0070666_10025604 | Ga0070666_100256042 | 279 |
| 73 | 3300005338 | Ga0068868_100018307 | Ga0068868_1000183077 | 279 |
| 74 | 3300005338 | Ga0068868_100030353 | Ga0068868_1000303531 | 279 |
| 75 | 3300005340 | Ga0070689_100524634 | Ga0070689_1005246341 | 279 |
| 76 | 3300005347 | Ga0070668_100088538 | Ga0070668_1000885382 | 279 |
| 77 | 3300005353 | Ga0070669_100185761 | Ga0070669_1001857612 | 279 |
| 78 | 3300005355 | Ga0070671_100001491 | Ga0070671_10000149110 | 279 |
| 79 | 3300005355 | Ga0070671_100050852 | Ga0070671_1000508522 | 279 |
| 80 | 3300005355 | Ga0070671_100140217 | Ga0070671_1001402171 | 279 |
| 81 | 3300005356 | Ga0070674_100004601 | Ga0070674_1000046012 | 279 |
| 82 | 3300005364 | Ga0070673_100053807 | Ga0070673_1000538072 | 279 |
| 83 | 3300005364 | Ga0070673_100055472 | Ga0070673_1000554722 | 279 |
| 84 | 3300005366 | Ga0070659_100298236 | Ga0070659_1002982362 | 279 |
| 85 | 3300005367 | Ga0070667_100007212 | Ga0070667_1000072124 | 279 |
| 86 | 3300005367 | Ga0070667_100030058 | Ga0070667_1000300582 | 279 |
| 87 | 3300005367 | Ga0070667_100141969 | Ga0070667_1001419691 | 279 |
| 88 | 3300005434 | Ga0070709_10001305 | Ga0070709_100013057 | 279 |
| 89 | 3300005434 | Ga0070709_10122021 | Ga0070709_101220212 | 279 |
| 90 | 3300005435 | Ga0070714_100004395 | Ga0070714_1000043952 | 279 |
| 91 | 3300005436 | Ga0070713_100006878 | Ga0070713_1000068782 | 279 |
| 92 | 3300005436 | Ga0070713_100073283 | Ga0070713_1000732832 | 279 |
| 93 | 3300005436 | Ga0070713_100102889 | Ga0070713_1001028894 | 279 |
| 94 | 3300005437 | Ga0070710_10003030 | Ga0070710_100030305 | 279 |
| 95 | 3300005439 | Ga0070711_100058968 | Ga0070711_1000589682 | 279 |
| 96 | 3300005439 | Ga0070711_100107743 | Ga0070711_1001077431 | 279 |
| 97 | 3300005439 | Ga0070711_100190015 | Ga0070711_1001900152 | 279 |
| 98 | 3300005441 | Ga0070700_100016722 | Ga0070700_1000167223 | 279 |
| 99 | 3300005455 | Ga0070663_100034907 | Ga0070663_1000349072 | 279 |
| 100 | 3300005456 | Ga0070678_100009491 | Ga0070678_1000094913 | 279 |
| 101 | 3300005457 | Ga0070662_100005675 | Ga0070662_1000056756 | 279 |
| 102 | 3300005459 | Ga0068867_100022309 | Ga0068867_1000223093 | 279 |
| 103 | 3300005459 | Ga0068867_100049470 | Ga0068867_1000494702 | 279 |
| 104 | 3300005518 | Ga0070699_100142595 | Ga0070699_1001425952 | 279 |
| 105 | 3300005539 | Ga0068853_100180333 | Ga0068853_1001803332 | 279 |
| 106 | 3300005543 | Ga0070672_100059954 | Ga0070672_1000599544 | 279 |
| 107 | 3300005546 | Ga0070696_100003241 | Ga0070696_1000032415 | 279 |
| 108 | 3300005546 | Ga0070696_100106770 | Ga0070696_1001067702 | 279 |
| 109 | 3300005548 | Ga0070665_100020954 | Ga0070665_1000209544 | 279 |
| 110 | 3300005548 | Ga0070665_100020971 | Ga0070665_1000209712 | 279 |
| 111 | 3300005563 | Ga0068855_100099729 | Ga0068855_1000997292 | 279 |
| 112 | 3300005614 | Ga0068856_100020255 | Ga0068856_1000202552 | 279 |
| 113 | 3300005617 | Ga0068859_100000602 | Ga0068859_10000060220 | 279 |
| 114 | 3300005617 | Ga0068859_100041015 | Ga0068859_1000410151 | 279 |
| 115 | 3300005617 | Ga0068859_100657588 | Ga0068859_1006575882 | 279 |
| 116 | 3300005718 | Ga0068866_10058368 | Ga0068866_100583681 | 279 |
| 117 | 3300005718 | Ga0068866_10076247 | Ga0068866_100762472 | 279 |
| 118 | 3300005719 | Ga0068861_100023236 | Ga0068861_1000232364 | 279 |
| 119 | 3300005719 | Ga0068861_100373367 | Ga0068861_1003733672 | 279 |
| 120 | 3300005719 | Ga0068861_100519936 | Ga0068861_1005199361 | 279 |
| 121 | 3300005840 | Ga0068870_10046151 | Ga0068870_100461513 | 279 |
| 122 | 3300005841 | Ga0068863_100002939 | Ga0068863_1000029395 | 279 |
| 123 | 3300005841 | Ga0068863_100036091 | Ga0068863_1000360912 | 279 |
| 124 | 3300005841 | Ga0068863_100072876 | Ga0068863_1000728763 | 279 |
| 125 | 3300005841 | Ga0068863_100155698 | Ga0068863_1001556982 | 279 |
| 126 | 3300005842 | Ga0068858_100000906 | Ga0068858_10000090612 | 279 |
| 127 | 3300005842 | Ga0068858_100000915 | Ga0068858_1000009155 | 279 |
| 128 | 3300005842 | Ga0068858_100074674 | Ga0068858_1000746742 | 279 |
| 129 | 3300005842 | Ga0068858_100303538 | Ga0068858_1003035382 | 279 |
| 130 | 3300005843 | Ga0068860_100007946 | Ga0068860_1000079467 | 279 |
| 131 | 3300005843 | Ga0068860_100013020 | Ga0068860_1000130204 | 279 |
| 132 | 3300005844 | Ga0068862_100032786 | Ga0068862_1000327862 | 279 |
| 133 | 3300006028 | Ga0070717_10004003 | Ga0070717_100040036 | 279 |
| 134 | 3300006163 | Ga0070715_10000861 | Ga0070715_100008615 | 279 |
| 135 | 3300006173 | Ga0070716_100000641 | Ga0070716_1000006415 | 279 |
| 136 | 3300006173 | Ga0070716_100256656 | Ga0070716_1002566561 | 279 |
| 137 | 3300006175 | Ga0070712_100004032 | Ga0070712_1000040323 | 279 |
| 138 | 3300006175 | Ga0070712_100022165 | Ga0070712_1000221651 | 279 |
| 139 | 3300006175 | Ga0070712_100058722 | Ga0070712_1000587223 | 279 |
| 140 | 3300006237 | Ga0097621_100012364 | Ga0097621_1000123643 | 279 |
| 141 | 3300006358 | Ga0068871_100073567 | Ga0068871_1000735672 | 279 |
| 142 | 3300006844 | Ga0075428_100039525 | Ga0075428_1000395255 | 279 |
| 143 | 3300006844 | Ga0075428_100121035 | Ga0075428_1001210352 | 279 |
| 144 | 3300006846 | Ga0075430_100185863 | Ga0075430_1001858632 | 279 |
| 145 | 3300006880 | Ga0075429_100219980 | Ga0075429_1002199803 | 279 |
| 146 | 3300006881 | Ga0068865_100057302 | Ga0068865_1000573022 | 279 |
| 147 | 3300006881 | Ga0068865_100105267 | Ga0068865_1001052672 | 279 |
| 148 | 3300006931 | Ga0097620_100000602 | Ga0097620_10000060210 | 279 |
| 149 | 3300006931 | Ga0097620_100041015 | Ga0097620_1000410153 | 279 |
| 150 | 3300006931 | Ga0097620_100657607 | Ga0097620_1006576072 | 279 |
| 151 | 3300007788 | Ga0099795_10002097 | Ga0099795_100020972 | 279 |
| 152 | 3300009093 | Ga0105240_10085603 | Ga0105240_100856032 | 279 |
| 153 | 3300009094 | Ga0111539_10093041 | Ga0111539_100930412 | 279 |
| 154 | 3300009094 | Ga0111539_10140685 | Ga0111539_101406853 | 279 |
| 155 | 3300009094 | Ga0111539_10737881 | Ga0111539_107378812 | 279 |
| 156 | 3300009098 | Ga0105245_10010409 | Ga0105245_100104092 | 279 |
| 157 | 3300009098 | Ga0105245_10010410 | Ga0105245_100104106 | 279 |
| 158 | 3300009101 | Ga0105247_10001357 | Ga0105247_1000135710 | 279 |
| 159 | 3300009101 | Ga0105247_10003087 | Ga0105247_100030876 | 279 |
| 160 | 3300009147 | Ga0114129_10235627 | Ga0114129_102356272 | 279 |
| 161 | 3300009174 | Ga0105241_10016185 | Ga0105241_100161852 | 279 |
| 162 | 3300009174 | Ga0105241_10396901 | Ga0105241_103969012 | 279 |
| 163 | 3300009174 | Ga0105241_10423198 | Ga0105241_104231981 | 279 |
| 164 | 3300009176 | Ga0105242_10002857 | Ga0105242_100028578 | 279 |
| 165 | 3300009177 | Ga0105248_10002984 | Ga0105248_1000298413 | 279 |
| 166 | 3300009177 | Ga0105248_10007814 | Ga0105248_100078147 | 279 |
| 167 | 3300009177 | Ga0105248_10030718 | Ga0105248_100307182 | 279 |
| 168 | 3300009545 | Ga0105237_10042595 | Ga0105237_100425951 | 279 |
| 169 | 3300009551 | Ga0105238_10075907 | Ga0105238_100759072 | 279 |
| 170 | 3300009551 | Ga0105238_10101210 | Ga0105238_101012102 | 279 |
| 171 | 3300009553 | Ga0105249_10126611 | Ga0105249_101266112 | 279 |
| 172 | 3300009987 | Ga0105030_100177 | Ga0105030_1001772 | 279 |
| 173 | 3300010375 | Ga0105239_10086212 | Ga0105239_100862122 | 279 |
| 174 | 3300010375 | Ga0105239_10370899 | Ga0105239_103708992 | 279 |
| 175 | 3300013105 | Ga0157369_10381666 | Ga0157369_103816662 | 279 |
| 176 | 3300013297 | Ga0157378_10006173 | Ga0157378_100061733 | 279 |
| 177 | 3300013306 | Ga0163162_10013831 | Ga0163162_100138316 | 279 |
| 178 | 3300013306 | Ga0163162_10084864 | Ga0163162_100848643 | 279 |
| 179 | 3300013308 | Ga0157375_10034395 | Ga0157375_100343954 | 279 |
| 180 | 3300013308 | Ga0157375_10071045 | Ga0157375_100710453 | 279 |
| 181 | 3300013874 | Ga0157514_117819 | Ga0157514_1178191 | 279 |
| 182 | 3300014325 | Ga0163163_10006892 | Ga0163163_100068923 | 279 |
| 183 | 3300014325 | Ga0163163_10022048 | Ga0163163_100220485 | 279 |
| 184 | 3300014325 | Ga0163163_10155715 | Ga0163163_101557152 | 279 |
| 185 | 3300014326 | Ga0157380_10334370 | Ga0157380_103343702 | 279 |
| 186 | 3300014968 | Ga0157379_10013160 | Ga0157379_100131605 | 279 |
| 187 | 3300014968 | Ga0157379_10020478 | Ga0157379_100204783 | 279 |
| 188 | 3300014968 | Ga0157379_10066258 | Ga0157379_100662582 | 279 |
| 189 | 3300025893 | Ga0207682_10009865 | Ga0207682_100098655 | 279 |
| 190 | 3300025900 | Ga0207710_10000476 | Ga0207710_100004768 | 279 |
| 191 | 3300025903 | Ga0207680_10127942 | Ga0207680_101279422 | 279 |
| 192 | 3300025903 | Ga0207680_10237765 | Ga0207680_102377651 | 279 |
| 193 | 3300025905 | Ga0207685_10068553 | Ga0207685_100685531 | 279 |
| 194 | 3300025906 | Ga0207699_10009931 | Ga0207699_100099313 | 279 |
| 195 | 3300025906 | Ga0207699_10085935 | Ga0207699_100859352 | 279 |
| 196 | 3300025906 | Ga0207699_10200999 | Ga0207699_102009992 | 279 |
| 197 | 3300025907 | Ga0207645_10001854 | Ga0207645_1000185416 | 279 |
| 198 | 3300025908 | Ga0207643_10017461 | Ga0207643_100174615 | 279 |
| 199 | 3300025914 | Ga0207671_10149582 | Ga0207671_101495821 | 279 |
| 200 | 3300025915 | Ga0207693_10057352 | Ga0207693_100573522 | 279 |
| 201 | 3300025916 | Ga0207663_10040104 | Ga0207663_100401042 | 279 |
| 202 | 3300025916 | Ga0207663_10141261 | Ga0207663_101412611 | 279 |
| 203 | 3300025917 | Ga0207660_10104230 | Ga0207660_101042303 | 279 |
| 204 | 3300025922 | Ga0207646_10198919 | Ga0207646_101989193 | 279 |
| 205 | 3300025923 | Ga0207681_10072512 | Ga0207681_100725123 | 279 |
| 206 | 3300025924 | Ga0207694_10014918 | Ga0207694_100149182 | 279 |
| 207 | 3300025927 | Ga0207687_10246324 | Ga0207687_102463242 | 279 |
| 208 | 3300025927 | Ga0207687_10248435 | Ga0207687_102484352 | 279 |
| 209 | 3300025928 | Ga0207700_10026226 | Ga0207700_100262261 | 279 |
| 210 | 3300025928 | Ga0207700_10138844 | Ga0207700_101388442 | 279 |
| 211 | 3300025929 | Ga0207664_10152129 | Ga0207664_101521292 | 279 |
| 212 | 3300025929 | Ga0207664_10423546 | Ga0207664_104235461 | 279 |
| 213 | 3300025931 | Ga0207644_10008675 | Ga0207644_100086752 | 279 |
| 214 | 3300025931 | Ga0207644_10147475 | Ga0207644_101474752 | 279 |
| 215 | 3300025931 | Ga0207644_10150385 | Ga0207644_101503852 | 279 |
| 216 | 3300025933 | Ga0207706_10001054 | Ga0207706_100010543 | 279 |
| 217 | 3300025934 | Ga0207686_10071184 | Ga0207686_100711842 | 279 |
| 218 | 3300025937 | Ga0207669_10009963 | Ga0207669_100099632 | 279 |
| 219 | 3300025937 | Ga0207669_10184568 | Ga0207669_101845681 | 279 |
| 220 | 3300025938 | Ga0207704_10002135 | Ga0207704_100021354 | 279 |
| 221 | 3300025939 | Ga0207665_10002370 | Ga0207665_100023708 | 279 |
| 222 | 3300025939 | Ga0207665_10102047 | Ga0207665_101020471 | 279 |
| 223 | 3300025940 | Ga0207691_10003801 | Ga0207691_100038015 | 279 |
| 224 | 3300025940 | Ga0207691_10043987 | Ga0207691_100439873 | 279 |
| 225 | 3300025941 | Ga0207711_10004050 | Ga0207711_100040503 | 279 |
| 226 | 3300025941 | Ga0207711_10007272 | Ga0207711_100072728 | 279 |
| 227 | 3300025941 | Ga0207711_10084500 | Ga0207711_100845002 | 279 |
| 228 | 3300025941 | Ga0207711_10164705 | Ga0207711_101647052 | 279 |
| 229 | 3300025949 | Ga0207667_10085523 | Ga0207667_100855232 | 279 |
| 230 | 3300025960 | Ga0207651_10046175 | Ga0207651_100461752 | 279 |
| 231 | 3300025961 | Ga0207712_10065522 | Ga0207712_100655222 | 279 |
| 232 | 3300025961 | Ga0207712_10080046 | Ga0207712_100800462 | 279 |
| 233 | 3300025986 | Ga0207658_10026416 | Ga0207658_100264162 | 279 |
| 234 | 3300025986 | Ga0207658_10034373 | Ga0207658_100343733 | 279 |
| 235 | 3300025986 | Ga0207658_10083471 | Ga0207658_100834712 | 279 |
| 236 | 3300026023 | Ga0207677_10070579 | Ga0207677_100705792 | 279 |
| 237 | 3300026035 | Ga0207703_10000903 | Ga0207703_100009036 | 279 |
| 238 | 3300026035 | Ga0207703_10002516 | Ga0207703_100025163 | 279 |
| 239 | 3300026035 | Ga0207703_10130916 | Ga0207703_101309163 | 279 |
| 240 | 3300026067 | Ga0207678_10008148 | Ga0207678_100081484 | 279 |
| 241 | 3300026075 | Ga0207708_10097390 | Ga0207708_100973903 | 279 |
| 242 | 3300026078 | Ga0207702_10025571 | Ga0207702_100255712 | 279 |
| 243 | 3300026078 | Ga0207702_10119662 | Ga0207702_101196622 | 279 |
| 244 | 3300026088 | Ga0207641_10010239 | Ga0207641_100102394 | 279 |
| 245 | 3300026088 | Ga0207641_10042392 | Ga0207641_100423922 | 279 |
| 246 | 3300026088 | Ga0207641_10624679 | Ga0207641_106246792 | 279 |
| 247 | 3300026089 | Ga0207648_10002529 | Ga0207648_1000252915 | 279 |
| 248 | 3300026089 | Ga0207648_10022290 | Ga0207648_100222903 | 279 |
| 249 | 3300026095 | Ga0207676_10096813 | Ga0207676_100968132 | 279 |
| 250 | 3300026118 | Ga0207675_100005535 | Ga0207675_10000553511 | 279 |
| 251 | 3300026118 | Ga0207675_100592945 | Ga0207675_1005929452 | 279 |
| 252 | 3300026121 | Ga0207683_10002153 | Ga0207683_100021532 | 279 |
| 253 | 3300026121 | Ga0207683_10409917 | Ga0207683_104099171 | 279 |
| 254 | 3300027364 | Ga0209967_1005804 | Ga0209967_10058042 | 279 |
| 255 | 3300027512 | Ga0209179_1019016 | Ga0209179_10190162 | 279 |
| 256 | 3300027552 | Ga0209982_1001490 | Ga0209982_10014902 | 279 |
| 257 | 3300027614 | Ga0209970_1016975 | Ga0209970_10169752 | 279 |
| 258 | 3300027665 | Ga0209983_1006498 | Ga0209983_10064982 | 279 |
| 259 | 3300027682 | Ga0209971_1000146 | Ga0209971_100014624 | 279 |
| 260 | 3300027717 | Ga0209998_10003678 | Ga0209998_100036784 | 279 |
| 261 | 3300027876 | Ga0209974_10000982 | Ga0209974_100009822 | 279 |
| 262 | 3300028379 | Ga0268266_10047960 | Ga0268266_100479601 | 279 |
| 263 | 3300028379 | Ga0268266_10075018 | Ga0268266_100750182 | 279 |
| 264 | 3300028381 | Ga0268264_10017578 | Ga0268264_100175784 | 279 |
| 265 | 3300028381 | Ga0268264_10017949 | Ga0268264_100179493 | 279 |
| 266 | 3300028381 | Ga0268264_10187951 | Ga0268264_101879512 | 279 |
| 267 | 3300030521 | Ga0307511_10000770 | Ga0307511_100007705 | 279 |
| 268 | 3300030521 | Ga0307511_10009742 | Ga0307511_100097424 | 279 |
| 269 | 3300031090 | Ga0265760_10012825 | Ga0265760_100128253 | 279 |
| 270 | 3300031090 | Ga0265760_10032301 | Ga0265760_100323012 | 279 |
| 271 | 3300031239 | Ga0265328_10036166 | Ga0265328_100361661 | 279 |
| 272 | 3300031240 | Ga0265320_10045306 | Ga0265320_100453062 | 279 |
| 273 | 3300031344 | Ga0265316_10020329 | Ga0265316_100203293 | 279 |
| 274 | 3300031456 | Ga0307513_10042642 | Ga0307513_100426422 | 279 |
| 275 | 3300031507 | Ga0307509_10000027 | Ga0307509_1000002718 | 279 |
| 276 | 3300031548 | Ga0307408_100236624 | Ga0307408_1002366242 | 279 |
| 277 | 3300031649 | Ga0307514_10134047 | Ga0307514_101340472 | 279 |
| 278 | 3300031730 | Ga0307516_10000124 | Ga0307516_1000012417 | 279 |
| 279 | 3300031852 | Ga0307410_10156899 | Ga0307410_101568991 | 279 |
| 280 | 3300032002 | Ga0307416_100329266 | Ga0307416_1003292661 | 279 |
| 281 | 3300033179 | Ga0307507_10190134 | Ga0307507_101901342 | 279 |
| 282 | 3300033180 | Ga0307510_10040563 | Ga0307510_100405632 | 279 |
| 283 | 3300035113 | Ga0373936_0011954 | Ga0373936_0011954_1420_2259 | 279 |
| 284 | 3300035113 | Ga0373936_0049973 | Ga0373936_0049973_168_1007 | 279 |
| 285 | 3300035117 | Ga0373953_0011392 | Ga0373953_0011392_1883_2722 | 279 |
| 286 | 3300035118 | Ga0373954_0021707 | Ga0373954_0021707_560_1399 | 279 |
| 287 | 3300035119 | Ga0373956_0024990 | Ga0373956_0024990_758_1597 | 279 |
| 288 | 3300035170 | Ga0373943_0024951 | Ga0373943_0024951_917_1756 | 279 |
| 289 | 3300035171 | Ga0373946_0048063 | Ga0373946_0048063_115_954 | 279 |
| 290 | 3300035171 | Ga0373946_0210728 | Ga0373946_0210728_64_903 | 279 |
| 291 | 3300035172 | Ga0373955_0003163 | Ga0373955_0003163_814_1653 | 279 |
| 292 | 3300035410 | Ga0373924_0076498 | Ga0373924_0076498_41_880 | 279 |
| 293 | 3300035695 | Ga0373927_0005121 | Ga0373927_0005121_3999_4838 | 279 |
| 294 | 3300035725 | Ga0373947_0114530 | Ga0373947_0114530_228_1067 | 279 |
| 295 | 3300036401 | Ga0373937_0167084 | Ga0373937_0167084_1142_1981 | 279 |
| 296 | 3300037068 | Ga0373925_0392282 | Ga0373925_0392282_115_954 | 279 |
| 297 | 3300039437 | Ga0436365_0070472 | Ga0436365_0070472_2443_3282 | 279 |
| 298 | 3300039438 | Ga0436360_0224161 | Ga0436360_0224161_2782_3621 | 279 |
| 299 | 3300039438 | Ga0436360_0301134 | Ga0436360_0301134_7031_7882 | 279 |
| 300 | 3300039450 | Ga0436363_0111232 | Ga0436363_0111232_3444_4283 | 279 |
| 301 | 3300039450 | Ga0436363_1716318 | Ga0436363_1716318_2416_3255 | 279 |
| 302 | 3300039453 | Ga0436362_0385862 | Ga0436362_0385862_65_904 | 279 |
| 303 | 3300039453 | Ga0436362_0749119 | Ga0436362_0749119_448_1287 | 279 |
| 304 | 3300041494 | Ga0451837_0564735 | Ga0451837_0564735_982_1821 | 279 |
| 305 | 3300042133 | Ga0450896_005553 | Ga0450896_005553_738_1577 | 279 |
| 306 | 3300042436 | Ga0439435_0024303 | Ga0439435_0024303_422_1261 | 279 |
| 307 | 3300042876 | Ga0451577_0031377 | Ga0451577_0031377_485_1324 | 279 |
| 308 | 3300042876 | Ga0451577_0033382 | Ga0451577_0033382_3396_4235 | 279 |
| 309 | 3300042876 | Ga0451577_0101371 | Ga0451577_0101371_693_1532 | 279 |
| 310 | 3300042876 | Ga0451577_0141000 | Ga0451577_0141000_1102_1941 | 279 |
| 311 | 3300044673 | Ga0453683_0012346 | Ga0453683_0012346_3856_4695 | 279 |
| 312 | 3300044712 | Ga0453684_0059426 | Ga0453684_0059426_2500_3339 | 279 |
| 313 | 3300045051 | Ga0451576_0079329 | Ga0451576_0079329_752_1591 | 279 |
| 314 | 3300046472 | Ga0495580_0000644 | Ga0495580_0000644_5508_6347 | 279 |
| 315 | 3300046472 | Ga0495580_0033449 | Ga0495580_0033449_2830_3669 | 279 |
| 316 | 3300046473 | Ga0495582_0073347 | Ga0495582_0073347_626_1465 | 279 |
| 317 | 3300046513 | Ga0495616_0006294 | Ga0495616_0006294_909_1748 | 279 |
| 318 | 3300046514 | Ga0495618_0039572 | Ga0495618_0039572_1214_2053 | 279 |
| 319 | 3300046517 | Ga0495630_0088465 | Ga0495630_0088465_1124_1963 | 279 |
| 320 | 3300046529 | Ga0495652_0176366 | Ga0495652_0176366_362_1201 | 279 |
| 321 | 3300046531 | Ga0495665_0052347 | Ga0495665_0052347_544_1383 | 279 |
| 322 | 3300046683 | Ga0495658_0098053 | Ga0495658_0098053_695_1534 | 279 |
| 323 | 3300047319 | Ga0495674_0068819 | Ga0495674_0068819_1059_1898 | 279 |
| 324 | 3300047443 | Ga0495687_039914 | Ga0495687_039914_1130_1969 | 279 |
| 325 | 3300047443 | Ga0495687_042586 | Ga0495687_042586_885_1724 | 279 |
| 326 | 3300047472 | Ga0495686_0140710 | Ga0495686_0140710_313_1152 | 279 |
| 327 | 3300048903 | Ga0496100_0028539 | Ga0496100_0028539_1671_2510 | 279 |
| 328 | 3300048903 | Ga0496100_0100353 | Ga0496100_0100353_749_1588 | 279 |
| 329 | 3300048904 | Ga0496101_0014924 | Ga0496101_0014924_3675_4514 | 279 |
| 330 | 3300048904 | Ga0496101_0158631 | Ga0496101_0158631_707_1546 | 279 |
| 331 | 3300048905 | Ga0496102_0024722 | Ga0496102_0024722_4315_5154 | 279 |
| 332 | 3300048905 | Ga0496102_0030471 | Ga0496102_0030471_2904_3743 | 279 |
| 333 | 3300048907 | Ga0496104_0024382 | Ga0496104_0024382_2540_3379 | 279 |
| 334 | 3300048907 | Ga0496104_0048421 | Ga0496104_0048421_32_871 | 279 |
| 335 | 3300048907 | Ga0496104_0083406 | Ga0496104_0083406_169_1008 | 279 |
| 336 | 3300048908 | Ga0496105_0006655 | Ga0496105_0006655_3228_4067 | 279 |
| 337 | 3300048908 | Ga0496105_0025846 | Ga0496105_0025846_1919_2758 | 279 |
| 338 | 3300048908 | Ga0496105_0075079 | Ga0496105_0075079_438_1277 | 279 |
| 339 | 3300048909 | Ga0496106_0018939 | Ga0496106_0018939_1288_2127 | 279 |
| 340 | 3300048909 | Ga0496106_0216277 | Ga0496106_0216277_47_886 | 279 |
| 341 | 3300048910 | Ga0496107_0048752 | Ga0496107_0048752_731_1570 | 279 |
| 342 | 3300048910 | Ga0496107_0049854 | Ga0496107_0049854_966_1805 | 279 |
| 343 | 3300048911 | Ga0496108_0007699 | Ga0496108_0007699_5068_5907 | 279 |
| 344 | 3300048911 | Ga0496108_0037739 | Ga0496108_0037739_2608_3447 | 279 |
| 345 | 3300048913 | Ga0496110_0004795 | Ga0496110_0004795_4285_5124 | 279 |
| 346 | 3300048914 | Ga0496111_0006835 | Ga0496111_0006835_4866_5705 | 279 |
| 347 | 3300048914 | Ga0496111_0023774 | Ga0496111_0023774_1364_2203 | 279 |
| 348 | 3300048915 | Ga0496112_0015409 | Ga0496112_0015409_4829_5668 | 279 |
| 349 | 3300048915 | Ga0496112_0036629 | Ga0496112_0036629_3228_4067 | 279 |
| 350 | 3300048915 | Ga0496112_0175307 | Ga0496112_0175307_14_853 | 279 |
| 351 | 3300048917 | Ga0496114_0005482 | Ga0496114_0005482_389_1228 | 279 |
| 352 | 3300048917 | Ga0496114_0005933 | Ga0496114_0005933_4514_5353 | 279 |
| 353 | 3300048917 | Ga0496114_0074719 | Ga0496114_0074719_1312_2151 | 279 |
| 354 | 3300048918 | Ga0496115_0315863 | Ga0496115_0315863_115_954 | 279 |
| 355 | 3300048924 | Ga0496121_0003518 | Ga0496121_0003518_11587_12426 | 279 |
| 356 | 3300048928 | Ga0496125_0008883 | Ga0496125_0008883_3947_4786 | 279 |
| 357 | 3300048928 | Ga0496125_0169280 | Ga0496125_0169280_468_1307 | 279 |
| 358 | 3300048929 | Ga0496126_0010089 | Ga0496126_0010089_4326_5165 | 279 |
| 359 | 3300048929 | Ga0496126_0050926 | Ga0496126_0050926_139_978 | 279 |
| 360 | 3300049571 | Ga0501034_0000535 | Ga0501034_0000535_49386_50225 | 279 |
| 361 | 3300049571 | Ga0501034_0001201 | Ga0501034_0001201_15652_16491 | 279 |
| 362 | 3300049584 | Ga0501068_0059770 | Ga0501068_0059770_929_1768 | 279 |
| 363 | 3300049593 | Ga0501077_0110055 | Ga0501077_0110055_880_1719 | 279 |
| 364 | 3300049742 | Ga0501080_0001700 | Ga0501080_0001700_5495_6334 | 279 |
| 365 | 3300050508 | nmdc:mga09592_238721_c1 | nmdc:mga09592_238721_c1_159_998 | 279 |
| 366 | 3300050509 | nmdc:mga0qj67_161091_c1 | nmdc:mga0qj67_161091_c1_625_1464 | 279 |
| 367 | 3300050510 | nmdc:mga06r32_76577_c1 | nmdc:mga06r32_76577_c1_330_1169 | 279 |
| 368 | 3300050510 | nmdc:mga06r32_87556_c1 | nmdc:mga06r32_87556_c1_817_1656 | 279 |
| 369 | 3300050511 | nmdc:mga08y16_182378_c1 | nmdc:mga08y16_182378_c1_198_1037 | 279 |
| 370 | 3300050511 | nmdc:mga08y16_198450_c1 | nmdc:mga08y16_198450_c1_340_1179 | 279 |
| 371 | 3300050513 | nmdc:mga0rr50_92098_c1 | nmdc:mga0rr50_92098_c1_687_1526 | 279 |
| 372 | 3300054114 | Ga0501084_0145072 | Ga0501084_0145072_396_1235 | 279 |
| 373 | 3300060353 | Ga0501082_0006793 | Ga0501082_0006793_7953_8792 | 279 |
| 374 | 3300003794 | Ga0055531_10013284 | Ga0055531_100132844 | 280 |
| 375 | 3300005288 | Ga0065714_10021006 | Ga0065714_100210061 | 280 |
| 376 | 3300005293 | Ga0065715_10035465 | Ga0065715_100354652 | 280 |
| 377 | 3300005293 | Ga0065715_10129804 | Ga0065715_101298042 | 280 |
| 378 | 3300005330 | Ga0070690_100011025 | Ga0070690_1000110252 | 280 |
| 379 | 3300005331 | Ga0070670_100280129 | Ga0070670_1002801291 | 280 |
| 380 | 3300005334 | Ga0068869_100002005 | Ga0068869_1000020054 | 280 |
| 381 | 3300005335 | Ga0070666_10000329 | Ga0070666_1000032924 | 280 |
| 382 | 3300005335 | Ga0070666_10023636 | Ga0070666_100236363 | 280 |
| 383 | 3300005340 | Ga0070689_100002277 | Ga0070689_1000022776 | 280 |
| 384 | 3300005343 | Ga0070687_100010303 | Ga0070687_1000103032 | 280 |
| 385 | 3300005344 | Ga0070661_100008429 | Ga0070661_1000084298 | 280 |
| 386 | 3300005345 | Ga0070692_10180210 | Ga0070692_101802102 | 280 |
| 387 | 3300005347 | Ga0070668_100050278 | Ga0070668_1000502782 | 280 |
| 388 | 3300005347 | Ga0070668_100120549 | Ga0070668_1001205492 | 280 |
| 389 | 3300005353 | Ga0070669_100002403 | Ga0070669_1000024039 | 280 |
| 390 | 3300005354 | Ga0070675_100002814 | Ga0070675_10000281414 | 280 |
| 391 | 3300005364 | Ga0070673_100003918 | Ga0070673_1000039187 | 280 |
| 392 | 3300005365 | Ga0070688_100002281 | Ga0070688_1000022819 | 280 |
| 393 | 3300005366 | Ga0070659_100396798 | Ga0070659_1003967981 | 280 |
| 394 | 3300005367 | Ga0070667_100190379 | Ga0070667_1001903792 | 280 |
| 395 | 3300005435 | Ga0070714_100271051 | Ga0070714_1002710512 | 280 |
| 396 | 3300005438 | Ga0070701_10017023 | Ga0070701_100170232 | 280 |
| 397 | 3300005441 | Ga0070700_100043337 | Ga0070700_1000433372 | 280 |
| 398 | 3300005455 | Ga0070663_100084273 | Ga0070663_1000842732 | 280 |
| 399 | 3300005457 | Ga0070662_100010672 | Ga0070662_1000106724 | 280 |
| 400 | 3300005457 | Ga0070662_100063080 | Ga0070662_1000630802 | 280 |
| 401 | 3300005458 | Ga0070681_10057315 | Ga0070681_100573152 | 280 |
| 402 | 3300005466 | Ga0070685_10004628 | Ga0070685_100046287 | 280 |
| 403 | 3300005530 | Ga0070679_100599310 | Ga0070679_1005993101 | 280 |
| 404 | 3300005543 | Ga0070672_100015169 | Ga0070672_1000151694 | 280 |
| 405 | 3300005544 | Ga0070686_100242582 | Ga0070686_1002425822 | 280 |
| 406 | 3300005548 | Ga0070665_100006814 | Ga0070665_1000068142 | 280 |
| 407 | 3300005548 | Ga0070665_100020338 | Ga0070665_1000203384 | 280 |
| 408 | 3300005563 | Ga0068855_100510210 | Ga0068855_1005102102 | 280 |
| 409 | 3300005564 | Ga0070664_100009917 | Ga0070664_1000099174 | 280 |
| 410 | 3300005577 | Ga0068857_100057393 | Ga0068857_1000573932 | 280 |
| 411 | 3300005617 | Ga0068859_100001108 | Ga0068859_1000011089 | 280 |
| 412 | 3300005618 | Ga0068864_100060758 | Ga0068864_1000607582 | 280 |
| 413 | 3300005719 | Ga0068861_100000334 | Ga0068861_10000033413 | 280 |
| 414 | 3300005719 | Ga0068861_100001652 | Ga0068861_1000016523 | 280 |
| 415 | 3300005719 | Ga0068861_100366864 | Ga0068861_1003668641 | 280 |
| 416 | 3300005834 | Ga0068851_10008873 | Ga0068851_100088732 | 280 |
| 417 | 3300005840 | Ga0068870_10127149 | Ga0068870_101271492 | 280 |
| 418 | 3300005841 | Ga0068863_100006641 | Ga0068863_1000066414 | 280 |
| 419 | 3300005841 | Ga0068863_100209109 | Ga0068863_1002091092 | 280 |
| 420 | 3300005842 | Ga0068858_100005611 | Ga0068858_1000056117 | 280 |
| 421 | 3300005842 | Ga0068858_100032425 | Ga0068858_1000324252 | 280 |
| 422 | 3300005843 | Ga0068860_100554925 | Ga0068860_1005549252 | 280 |
| 423 | 3300005844 | Ga0068862_100000393 | Ga0068862_10000039317 | 280 |
| 424 | 3300005844 | Ga0068862_100079400 | Ga0068862_1000794002 | 280 |
| 425 | 3300005844 | Ga0068862_100402457 | Ga0068862_1004024572 | 280 |
| 426 | 3300006844 | Ga0075428_100000833 | Ga0075428_1000008332 | 280 |
| 427 | 3300006844 | Ga0075428_100020477 | Ga0075428_1000204772 | 280 |
| 428 | 3300006844 | Ga0075428_100023245 | Ga0075428_1000232457 | 280 |
| 429 | 3300006844 | Ga0075428_100108365 | Ga0075428_1001083652 | 280 |
| 430 | 3300006846 | Ga0075430_100000390 | Ga0075430_10000039027 | 280 |
| 431 | 3300006846 | Ga0075430_100021054 | Ga0075430_1000210542 | 280 |
| 432 | 3300006847 | Ga0075431_100000034 | Ga0075431_10000003454 | 280 |
| 433 | 3300006847 | Ga0075431_100005741 | Ga0075431_1000057412 | 280 |
| 434 | 3300006847 | Ga0075431_100029897 | Ga0075431_1000298972 | 280 |
| 435 | 3300006847 | Ga0075431_100354000 | Ga0075431_1003540002 | 280 |
| 436 | 3300006871 | Ga0075434_100610419 | Ga0075434_1006104192 | 280 |
| 437 | 3300006880 | Ga0075429_100006961 | Ga0075429_1000069612 | 280 |
| 438 | 3300006880 | Ga0075429_100019403 | Ga0075429_1000194034 | 280 |
| 439 | 3300006881 | Ga0068865_100158339 | Ga0068865_1001583392 | 280 |
| 440 | 3300006931 | Ga0097620_100001108 | Ga0097620_1000011089 | 280 |
| 441 | 3300007076 | Ga0075435_100323858 | Ga0075435_1003238582 | 280 |
| 442 | 3300009094 | Ga0111539_10003634 | Ga0111539_100036343 | 280 |
| 443 | 3300009094 | Ga0111539_10047322 | Ga0111539_100473224 | 280 |
| 444 | 3300009094 | Ga0111539_10556204 | Ga0111539_105562042 | 280 |
| 445 | 3300009098 | Ga0105245_10566177 | Ga0105245_105661772 | 280 |
| 446 | 3300009147 | Ga0114129_10002016 | Ga0114129_1000201613 | 280 |
| 447 | 3300009147 | Ga0114129_10082449 | Ga0114129_100824492 | 280 |
| 448 | 3300009147 | Ga0114129_10184733 | Ga0114129_101847333 | 280 |
| 449 | 3300009148 | Ga0105243_10056333 | Ga0105243_100563332 | 280 |
| 450 | 3300009174 | Ga0105241_10103544 | Ga0105241_101035441 | 280 |
| 451 | 3300009177 | Ga0105248_10000737 | Ga0105248_1000073730 | 280 |
| 452 | 3300009551 | Ga0105238_10043984 | Ga0105238_100439842 | 280 |
| 453 | 3300009553 | Ga0105249_10047251 | Ga0105249_100472514 | 280 |
| 454 | 3300009553 | Ga0105249_10522246 | Ga0105249_105222462 | 280 |
| 455 | 3300010375 | Ga0105239_10420777 | Ga0105239_104207772 | 280 |
| 456 | 3300013296 | Ga0157374_10214705 | Ga0157374_102147053 | 280 |
| 457 | 3300013297 | Ga0157378_10402521 | Ga0157378_104025212 | 280 |
| 458 | 3300013306 | Ga0163162_10009859 | Ga0163162_100098596 | 280 |
| 459 | 3300013308 | Ga0157375_10093775 | Ga0157375_100937752 | 280 |
| 460 | 3300013308 | Ga0157375_10321490 | Ga0157375_103214902 | 280 |
| 461 | 3300014325 | Ga0163163_10007177 | Ga0163163_100071773 | 280 |
| 462 | 3300014326 | Ga0157380_10212372 | Ga0157380_102123722 | 280 |
| 463 | 3300014326 | Ga0157380_10553380 | Ga0157380_105533802 | 280 |
| 464 | 3300014745 | Ga0157377_10120278 | Ga0157377_101202783 | 280 |
| 465 | 3300025304 | Ga0209257_1000320 | Ga0209257_100032092 | 280 |
| 466 | 3300025321 | Ga0207656_10009788 | Ga0207656_100097884 | 280 |
| 467 | 3300025901 | Ga0207688_10014218 | Ga0207688_100142182 | 280 |
| 468 | 3300025903 | Ga0207680_10001143 | Ga0207680_100011433 | 280 |
| 469 | 3300025904 | Ga0207647_10000023 | Ga0207647_1000002327 | 280 |
| 470 | 3300025911 | Ga0207654_10032951 | Ga0207654_100329511 | 280 |
| 471 | 3300025912 | Ga0207707_10155488 | Ga0207707_101554882 | 280 |
| 472 | 3300025913 | Ga0207695_10124934 | Ga0207695_101249342 | 280 |
| 473 | 3300025918 | Ga0207662_10019974 | Ga0207662_100199742 | 280 |
| 474 | 3300025921 | Ga0207652_10298171 | Ga0207652_102981712 | 280 |
| 475 | 3300025923 | Ga0207681_10001838 | Ga0207681_100018388 | 280 |
| 476 | 3300025924 | Ga0207694_10001346 | Ga0207694_1000134617 | 280 |
| 477 | 3300025925 | Ga0207650_10244520 | Ga0207650_102445202 | 280 |
| 478 | 3300025925 | Ga0207650_10294493 | Ga0207650_102944932 | 280 |
| 479 | 3300025926 | Ga0207659_10020124 | Ga0207659_100201244 | 280 |
| 480 | 3300025926 | Ga0207659_10069091 | Ga0207659_100690912 | 280 |
| 481 | 3300025926 | Ga0207659_10070286 | Ga0207659_100702864 | 280 |
| 482 | 3300025932 | Ga0207690_10372913 | Ga0207690_103729131 | 280 |
| 483 | 3300025933 | Ga0207706_10131782 | Ga0207706_101317824 | 280 |
| 484 | 3300025933 | Ga0207706_10308168 | Ga0207706_103081681 | 280 |
| 485 | 3300025935 | Ga0207709_10176742 | Ga0207709_101767422 | 280 |
| 486 | 3300025936 | Ga0207670_10042765 | Ga0207670_100427651 | 280 |
| 487 | 3300025938 | Ga0207704_10121346 | Ga0207704_101213462 | 280 |
| 488 | 3300025940 | Ga0207691_10092581 | Ga0207691_100925812 | 280 |
| 489 | 3300025940 | Ga0207691_10116662 | Ga0207691_101166622 | 280 |
| 490 | 3300025941 | Ga0207711_10006169 | Ga0207711_100061694 | 280 |
| 491 | 3300025942 | Ga0207689_10000420 | Ga0207689_1000042021 | 280 |
| 492 | 3300025945 | Ga0207679_10049986 | Ga0207679_100499862 | 280 |
| 493 | 3300025961 | Ga0207712_10000497 | Ga0207712_100004972 | 280 |
| 494 | 3300025961 | Ga0207712_10009947 | Ga0207712_100099473 | 280 |
| 495 | 3300025961 | Ga0207712_10124647 | Ga0207712_101246472 | 280 |
| 496 | 3300025972 | Ga0207668_10010396 | Ga0207668_100103963 | 280 |
| 497 | 3300025972 | Ga0207668_10039821 | Ga0207668_100398211 | 280 |
| 498 | 3300025986 | Ga0207658_10331814 | Ga0207658_103318142 | 280 |
| 499 | 3300026023 | Ga0207677_10254928 | Ga0207677_102549282 | 280 |
| 500 | 3300026035 | Ga0207703_10003172 | Ga0207703_100031727 | 280 |
| 501 | 3300026035 | Ga0207703_10021796 | Ga0207703_100217964 | 280 |
| 502 | 3300026041 | Ga0207639_10000358 | Ga0207639_1000035812 | 280 |
| 503 | 3300026067 | Ga0207678_10018584 | Ga0207678_100185843 | 280 |
| 504 | 3300026075 | Ga0207708_10048235 | Ga0207708_100482353 | 280 |
| 505 | 3300026075 | Ga0207708_10100968 | Ga0207708_101009682 | 280 |
| 506 | 3300026088 | Ga0207641_10088545 | Ga0207641_100885452 | 280 |
| 507 | 3300026088 | Ga0207641_10340581 | Ga0207641_103405812 | 280 |
| 508 | 3300026089 | Ga0207648_10101818 | Ga0207648_101018182 | 280 |
| 509 | 3300026095 | Ga0207676_10013978 | Ga0207676_100139782 | 280 |
| 510 | 3300026116 | Ga0207674_10028258 | Ga0207674_100282582 | 280 |
| 511 | 3300026116 | Ga0207674_10220162 | Ga0207674_102201622 | 280 |
| 512 | 3300026118 | Ga0207675_100001375 | Ga0207675_1000013753 | 280 |
| 513 | 3300026118 | Ga0207675_100001538 | Ga0207675_10000153818 | 280 |
| 514 | 3300026142 | Ga0207698_10260319 | Ga0207698_102603192 | 280 |
| 515 | 3300027614 | Ga0209970_1002881 | Ga0209970_10028812 | 280 |
| 516 | 3300027682 | Ga0209971_1044146 | Ga0209971_10441462 | 280 |
| 517 | 3300027907 | Ga0207428_10006228 | Ga0207428_100062285 | 280 |
| 518 | 3300027907 | Ga0207428_10040358 | Ga0207428_100403582 | 280 |
| 519 | 3300027907 | Ga0207428_10043466 | Ga0207428_100434662 | 280 |
| 520 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013390 | 280 |
| 521 | 3300028380 | Ga0268265_10000265 | Ga0268265_1000026544 | 280 |
| 522 | 3300028380 | Ga0268265_10004411 | Ga0268265_100044119 | 280 |
| 523 | 3300028381 | Ga0268264_10054196 | Ga0268264_100541963 | 280 |
| 524 | 3300028381 | Ga0268264_10380589 | Ga0268264_103805892 | 280 |
| 525 | 3300028794 | Ga0307515_10000037 | Ga0307515_10000037305 | 280 |
| 526 | 3300028794 | Ga0307515_10001585 | Ga0307515_1000158526 | 280 |
| 527 | 3300028794 | Ga0307515_10034838 | Ga0307515_100348384 | 280 |
| 528 | 3300030731 | Ga0316177_1212585 | Ga0316177_12125852 | 280 |
| 529 | 3300030733 | Ga0314311_1053136 | Ga0314311_10531363 | 280 |
| 530 | 3300030735 | Ga0316178_1144806 | Ga0316178_11448062 | 280 |
| 531 | 3300031456 | Ga0307513_10009095 | Ga0307513_100090953 | 280 |
| 532 | 3300031456 | Ga0307513_10249012 | Ga0307513_102490122 | 280 |
| 533 | 3300031548 | Ga0307408_100044630 | Ga0307408_1000446301 | 280 |
| 534 | 3300031548 | Ga0307408_100064093 | Ga0307408_1000640932 | 280 |
| 535 | 3300031548 | Ga0307408_100285769 | Ga0307408_1002857692 | 280 |
| 536 | 3300031691 | Ga0316579_10077429 | Ga0316579_100774292 | 280 |
| 537 | 3300031727 | Ga0316576_10042024 | Ga0316576_100420242 | 280 |
| 538 | 3300031728 | Ga0316578_10050637 | Ga0316578_100506372 | 280 |
| 539 | 3300031731 | Ga0307405_10010532 | Ga0307405_100105323 | 280 |
| 540 | 3300031824 | Ga0307413_10131216 | Ga0307413_101312162 | 280 |
| 541 | 3300031852 | Ga0307410_10123941 | Ga0307410_101239412 | 280 |
| 542 | 3300031852 | Ga0307410_10266439 | Ga0307410_102664392 | 280 |
| 543 | 3300031901 | Ga0307406_10086940 | Ga0307406_100869403 | 280 |
| 544 | 3300031901 | Ga0307406_10118447 | Ga0307406_101184471 | 280 |
| 545 | 3300031901 | Ga0307406_10185926 | Ga0307406_101859262 | 280 |
| 546 | 3300031901 | Ga0307406_10187950 | Ga0307406_101879502 | 280 |
| 547 | 3300031903 | Ga0307407_10082493 | Ga0307407_100824931 | 280 |
| 548 | 3300031911 | Ga0307412_10090193 | Ga0307412_100901932 | 280 |
| 549 | 3300031911 | Ga0307412_10216181 | Ga0307412_102161812 | 280 |
| 550 | 3300031995 | Ga0307409_100394056 | Ga0307409_1003940562 | 280 |
| 551 | 3300032002 | Ga0307416_100093696 | Ga0307416_1000936964 | 280 |
| 552 | 3300032002 | Ga0307416_100229109 | Ga0307416_1002291092 | 280 |
| 553 | 3300032005 | Ga0307411_10056262 | Ga0307411_100562622 | 280 |
| 554 | 3300032005 | Ga0307411_10126842 | Ga0307411_101268422 | 280 |
| 555 | 3300032126 | Ga0307415_100001747 | Ga0307415_1000017474 | 280 |
| 556 | 3300032126 | Ga0307415_100236682 | Ga0307415_1002366822 | 280 |
| 557 | 3300032137 | Ga0316585_10019900 | Ga0316585_100199002 | 280 |
| 558 | 3300032139 | Ga0316580_10008031 | Ga0316580_100080312 | 280 |
| 559 | 3300035398 | Ga0316574_0027044 | Ga0316574_0027044_2351_3193 | 280 |
| 560 | 3300036647 | Ga0316582_0016320 | Ga0316582_0016320_707_1549 | 280 |
| 561 | 3300036712 | Ga0316584_0052157 | Ga0316584_0052157_1346_2188 | 280 |
| 562 | 3300041404 | Ga0439436_0012024 | Ga0439436_0012024_52_894 | 280 |
| 563 | 3300041406 | Ga0439439_0000514 | Ga0439439_0000514_2122_2964 | 280 |
| 564 | 3300041410 | Ga0439461_0029806 | Ga0439461_0029806_88_930 | 280 |
| 565 | 3300041413 | Ga0439465_0006147 | Ga0439465_0006147_1845_2753 | 280 |
| 566 | 3300041458 | Ga0451798_0667076 | Ga0451798_0667076_277_1119 | 280 |
| 567 | 3300041494 | Ga0451837_0168380 | Ga0451837_0168380_762_1604 | 280 |
| 568 | 3300041494 | Ga0451837_0313789 | Ga0451837_0313789_155_997 | 280 |
| 569 | 3300041509 | Ga0451843_0368400 | Ga0451843_0368400_131_973 | 280 |
| 570 | 3300041509 | Ga0451843_0657080 | Ga0451843_0657080_754_1596 | 280 |
| 571 | 3300042013 | Ga0439456_007190 | Ga0439456_007190_366_1208 | 280 |
| 572 | 3300042015 | Ga0439462_0003159 | Ga0439462_0003159_706_1548 | 280 |
| 573 | 3300042015 | Ga0439462_0024343 | Ga0439462_0024343_223_1065 | 280 |
| 574 | 3300042116 | Ga0450912_004142 | Ga0450912_004142_210_1052 | 280 |
| 575 | 3300042122 | Ga0450920_001070 | Ga0450920_001070_610_1452 | 280 |
| 576 | 3300042125 | Ga0450923_003341 | Ga0450923_003341_1355_2197 | 280 |
| 577 | 3300042131 | Ga0450894_004776 | Ga0450894_004776_129_971 | 280 |
| 578 | 3300042132 | Ga0450895_000886 | Ga0450895_000886_486_1328 | 280 |
| 579 | 3300042133 | Ga0450896_001169 | Ga0450896_001169_785_1627 | 280 |
| 580 | 3300042134 | Ga0450898_030166 | Ga0450898_030166_111_953 | 280 |
| 581 | 3300042135 | Ga0450899_005738 | Ga0450899_005738_248_1090 | 280 |
| 582 | 3300042156 | Ga0439446_0000164 | Ga0439446_0000164_9430_10272 | 280 |
| 583 | 3300042156 | Ga0439446_0001699 | Ga0439446_0001699_2426_3268 | 280 |
| 584 | 3300042184 | Ga0450908_000154 | Ga0450908_000154_4212_5054 | 280 |
| 585 | 3300042184 | Ga0450908_003399 | Ga0450908_003399_79_921 | 280 |
| 586 | 3300042435 | Ga0439434_0007291 | Ga0439434_0007291_2283_3125 | 280 |
| 587 | 3300042435 | Ga0439434_0007927 | Ga0439434_0007927_480_1322 | 280 |
| 588 | 3300042436 | Ga0439435_0001735 | Ga0439435_0001735_787_1629 | 280 |
| 589 | 3300042437 | Ga0439444_0000070 | Ga0439444_0000070_3279_4121 | 280 |
| 590 | 3300042461 | Ga0439460_0066883 | Ga0439460_0066883_65_907 | 280 |
| 591 | 3300045051 | Ga0451576_0072218 | Ga0451576_0072218_1537_2379 | 280 |
| 592 | 3300045051 | Ga0451576_0223220 | Ga0451576_0223220_303_1145 | 280 |
| 593 | 3300046460 | Ga0495638_0033613 | Ga0495638_0033613_1591_2433 | 280 |
| 594 | 3300046501 | Ga0495607_0006481 | Ga0495607_0006481_4940_5782 | 280 |
| 595 | 3300046507 | Ga0495606_0057086 | Ga0495606_0057086_1331_2173 | 280 |
| 596 | 3300046615 | Ga0495656_0003475 | Ga0495656_0003475_2822_3664 | 280 |
| 597 | 3300046660 | Ga0495625_0220610 | Ga0495625_0220610_229_1071 | 280 |
| 598 | 3300047318 | Ga0495636_0012071 | Ga0495636_0012071_1594_2436 | 280 |
| 599 | 3300047470 | Ga0495681_0060317 | Ga0495681_0060317_399_1241 | 280 |
| 600 | 3300047472 | Ga0495686_0005221 | Ga0495686_0005221_6404_7246 | 280 |
| 601 | 3300048911 | Ga0496108_0081456 | Ga0496108_0081456_132_974 | 280 |
| 602 | 3300048912 | Ga0496109_0023299 | Ga0496109_0023299_3801_4643 | 280 |
| 603 | 3300048915 | Ga0496112_0182713 | Ga0496112_0182713_917_1759 | 280 |
| 604 | 3300048916 | Ga0496113_0056328 | Ga0496113_0056328_2044_2886 | 280 |
| 605 | 3300048917 | Ga0496114_0129251 | Ga0496114_0129251_84_926 | 280 |
| 606 | 3300048925 | Ga0496122_0036620 | Ga0496122_0036620_1663_2505 | 280 |
| 607 | 3300048927 | Ga0496124_0000018 | Ga0496124_0000018_108990_109832 | 280 |
| 608 | 3300049568 | Ga0501031_0048098 | Ga0501031_0048098_1009_1851 | 280 |
| 609 | 3300049570 | Ga0501033_0177674 | Ga0501033_0177674_361_1203 | 280 |
| 610 | 3300049572 | Ga0501036_0241845 | Ga0501036_0241845_260_1102 | 280 |
| 611 | 3300049574 | Ga0501038_0094761 | Ga0501038_0094761_963_1805 | 280 |
| 612 | 3300049574 | Ga0501038_0181659 | Ga0501038_0181659_437_1279 | 280 |
| 613 | 3300049575 | Ga0501039_0002777 | Ga0501039_0002777_6061_6903 | 280 |
| 614 | 3300049575 | Ga0501039_0081272 | Ga0501039_0081272_1066_1908 | 280 |
| 615 | 3300049576 | Ga0501040_0015552 | Ga0501040_0015552_2206_3048 | 280 |
| 616 | 3300049576 | Ga0501040_0145313 | Ga0501040_0145313_753_1595 | 280 |
| 617 | 3300049577 | Ga0501041_0003477 | Ga0501041_0003477_5715_6557 | 280 |
| 618 | 3300049577 | Ga0501041_0076763 | Ga0501041_0076763_1020_1862 | 280 |
| 619 | 3300049578 | Ga0501042_0131356 | Ga0501042_0131356_845_1687 | 280 |
| 620 | 3300049578 | Ga0501042_0131567 | Ga0501042_0131567_680_1522 | 280 |
| 621 | 3300049578 | Ga0501042_0154439 | Ga0501042_0154439_614_1456 | 280 |
| 622 | 3300049579 | Ga0501043_0319071 | Ga0501043_0319071_210_1052 | 280 |
| 623 | 3300049580 | Ga0501046_0348846 | Ga0501046_0348846_191_1033 | 280 |
| 624 | 3300049582 | Ga0501048_0066269 | Ga0501048_0066269_281_1123 | 280 |
| 625 | 3300049582 | Ga0501048_0089211 | Ga0501048_0089211_404_1246 | 280 |
| 626 | 3300049584 | Ga0501068_0003148 | Ga0501068_0003148_4645_5487 | 280 |
| 627 | 3300049584 | Ga0501068_0035560 | Ga0501068_0035560_1494_2336 | 280 |
| 628 | 3300049585 | Ga0501069_0014481 | Ga0501069_0014481_2353_3198 | 280 |
| 629 | 3300049587 | Ga0501071_0003130 | Ga0501071_0003130_5000_5842 | 280 |
| 630 | 3300049587 | Ga0501071_0042026 | Ga0501071_0042026_1739_2581 | 280 |
| 631 | 3300049587 | Ga0501071_0071428 | Ga0501071_0071428_1285_2127 | 280 |
| 632 | 3300049588 | Ga0501072_0004971 | Ga0501072_0004971_3951_4793 | 280 |
| 633 | 3300049588 | Ga0501072_0119005 | Ga0501072_0119005_984_1826 | 280 |
| 634 | 3300049589 | Ga0501073_0185122 | Ga0501073_0185122_412_1254 | 280 |
| 635 | 3300049590 | Ga0501074_0086613 | Ga0501074_0086613_856_1698 | 280 |
| 636 | 3300049591 | Ga0501075_0001687 | Ga0501075_0001687_13029_13871 | 280 |
| 637 | 3300049591 | Ga0501075_0205900 | Ga0501075_0205900_423_1265 | 280 |
| 638 | 3300049592 | Ga0501076_0101409 | Ga0501076_0101409_299_1141 | 280 |
| 639 | 3300049592 | Ga0501076_0236033 | Ga0501076_0236033_320_1162 | 280 |
| 640 | 3300049592 | Ga0501076_0322454 | Ga0501076_0322454_103_945 | 280 |
| 641 | 3300049592 | Ga0501076_0354315 | Ga0501076_0354315_208_1050 | 280 |
| 642 | 3300049593 | Ga0501077_0205025 | Ga0501077_0205025_276_1118 | 280 |
| 643 | 3300049593 | Ga0501077_0291335 | Ga0501077_0291335_29_871 | 280 |
| 644 | 3300049741 | Ga0501079_0007430 | Ga0501079_0007430_6575_7417 | 280 |
| 645 | 3300049741 | Ga0501079_0264102 | Ga0501079_0264102_73_915 | 280 |
| 646 | 3300049741 | Ga0501079_0420898 | Ga0501079_0420898_70_912 | 280 |
| 647 | 3300049742 | Ga0501080_0270265 | Ga0501080_0270265_298_1140 | 280 |
| 648 | 3300049742 | Ga0501080_0720171 | Ga0501080_0720171_26_868 | 280 |
| 649 | 3300049743 | Ga0501081_0034252 | Ga0501081_0034252_1869_2711 | 280 |
| 650 | 3300049743 | Ga0501081_0119689 | Ga0501081_0119689_221_1063 | 280 |
| 651 | 3300049744 | Ga0501083_0097188 | Ga0501083_0097188_429_1271 | 280 |
| 652 | 3300049744 | Ga0501083_0190570 | Ga0501083_0190570_379_1221 | 280 |
| 653 | 3300049822 | Ga0501035_0125224 | Ga0501035_0125224_172_1014 | 280 |
| 654 | 3300049822 | Ga0501035_0263903 | Ga0501035_0263903_471_1313 | 280 |
| 655 | 3300049823 | Ga0501044_0213735 | Ga0501044_0213735_825_1667 | 280 |
| 656 | 3300049824 | Ga0501045_0002391 | Ga0501045_0002391_4180_5022 | 280 |
| 657 | 3300049824 | Ga0501045_0104561 | Ga0501045_0104561_935_1777 | 280 |
| 658 | 3300049824 | Ga0501045_0203531 | Ga0501045_0203531_506_1348 | 280 |
| 659 | 3300050507 | nmdc:mga05p37_16313_c1 | nmdc:mga05p37_16313_c1_2540_3382 | 280 |
| 660 | 3300050507 | nmdc:mga05p37_535989_c1 | nmdc:mga05p37_535989_c1_403_1245 | 280 |
| 661 | 3300050508 | nmdc:mga09592_7046_c1 | nmdc:mga09592_7046_c1_3276_4118 | 280 |
| 662 | 3300050509 | nmdc:mga0qj67_15753_c1 | nmdc:mga0qj67_15753_c1_2552_3394 | 280 |
| 663 | 3300050509 | nmdc:mga0qj67_16660_c1 | nmdc:mga0qj67_16660_c1_2218_3060 | 280 |
| 664 | 3300050510 | nmdc:mga06r32_1723_c1 | nmdc:mga06r32_1723_c1_6014_6856 | 280 |
| 665 | 3300050510 | nmdc:mga06r32_2539_c1 | nmdc:mga06r32_2539_c1_11200_12042 | 280 |
| 666 | 3300050511 | nmdc:mga08y16_412149_c1 | nmdc:mga08y16_412149_c1_106_948 | 280 |
| 667 | 3300050511 | nmdc:mga08y16_65821_c1 | nmdc:mga08y16_65821_c1_56_898 | 280 |
| 668 | 3300050512 | nmdc:mga0n895_5285_c1 | nmdc:mga0n895_5285_c1_4410_5252 | 280 |
| 669 | 3300050515 | nmdc:mga0a205_3924_c1 | nmdc:mga0a205_3924_c1_703_1545 | 280 |
| 670 | 3300054114 | Ga0501084_0016881 | Ga0501084_0016881_2811_3653 | 280 |
| 671 | 3300060353 | Ga0501082_0027674 | Ga0501082_0027674_1374_2216 | 280 |
| 672 | 3300060353 | Ga0501082_0044022 | Ga0501082_0044022_2889_3731 | 280 |
| 673 | 3300060353 | Ga0501082_0058242 | Ga0501082_0058242_1614_2456 | 280 |
| 674 | 3300060353 | Ga0501082_0251155 | Ga0501082_0251155_493_1335 | 280 |
| 675 | 3300061734 | Ga0530510_0073659 | Ga0530510_0073659_696_1538 | 280 |
| 676 | 3300061734 | Ga0530510_0180775 | Ga0530510_0180775_451_1293 | 280 |
| 677 | 3300003187 | JGI25151J46595_10000646 | JGI25151J46595_1000064616 | 281 |
| 678 | 3300003214 | JGI25165J46597_1000948 | JGI25165J46597_100094813 | 281 |
| 679 | 3300005353 | Ga0070669_100015089 | Ga0070669_1000150891 | 281 |
| 680 | 3300005367 | Ga0070667_100000150 | Ga0070667_10000015031 | 281 |
| 681 | 3300005455 | Ga0070663_100000029 | Ga0070663_10000002953 | 281 |
| 682 | 3300005539 | Ga0068853_100002157 | Ga0068853_10000215711 | 281 |
| 683 | 3300009177 | Ga0105248_10000246 | Ga0105248_1000024632 | 281 |
| 684 | 3300009545 | Ga0105237_10000231 | Ga0105237_1000023127 | 281 |
| 685 | 3300010375 | Ga0105239_10086491 | Ga0105239_100864912 | 281 |
| 686 | 3300010375 | Ga0105239_10122767 | Ga0105239_101227674 | 281 |
| 687 | 3300013104 | Ga0157370_10087455 | Ga0157370_100874552 | 281 |
| 688 | 3300014969 | Ga0157376_10433034 | Ga0157376_104330341 | 281 |
| 689 | 3300025231 | Ga0207427_100078 | Ga0207427_10007815 | 281 |
| 690 | 3300025233 | Ga0209437_100269 | Ga0209437_1002697 | 281 |
| 691 | 3300025261 | Ga0209233_1000077 | Ga0209233_100007792 | 281 |
| 692 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006455 | 281 |
| 693 | 3300025297 | Ga0209758_1020489 | Ga0209758_10204892 | 281 |
| 694 | 3300025914 | Ga0207671_10059103 | Ga0207671_100591032 | 281 |
| 695 | 3300025941 | Ga0207711_10008374 | Ga0207711_100083746 | 281 |
| 696 | 3300025961 | Ga0207712_10001195 | Ga0207712_1000119515 | 281 |
| 697 | 3300025981 | Ga0207640_10106669 | Ga0207640_101066692 | 281 |
| 698 | 3300025986 | Ga0207658_10000013 | Ga0207658_10000013158 | 281 |
| 699 | 3300025986 | Ga0207658_10319061 | Ga0207658_103190612 | 281 |
| 700 | 3300026041 | Ga0207639_10051992 | Ga0207639_100519923 | 281 |
| 701 | 3300026067 | Ga0207678_10000035 | Ga0207678_1000003583 | 281 |
| 702 | 3300030745 | Ga0316182_1301532 | Ga0316182_13015321 | 281 |
| 703 | 3300032004 | Ga0307414_10001460 | Ga0307414_100014606 | 281 |
| 704 | 3300032004 | Ga0307414_10078205 | Ga0307414_100782052 | 281 |
| 705 | 3300032004 | Ga0307414_10130620 | Ga0307414_101306202 | 281 |
| 706 | 3300041407 | Ga0439447_001277 | Ga0439447_001277_5748_6593 | 281 |
| 707 | 3300041413 | Ga0439465_0000082 | Ga0439465_0000082_7692_8537 | 281 |
| 708 | 3300041441 | Ga0451787_431538 | Ga0451787_431538_939_1787 | 281 |
| 709 | 3300041486 | Ga0451807_1932045 | Ga0451807_1932045_610_1458 | 281 |
| 710 | 3300042004 | Ga0439445_0000501 | Ga0439445_0000501_5760_6605 | 281 |
| 711 | 3300042004 | Ga0439445_0021552 | Ga0439445_0021552_46_891 | 281 |
| 712 | 3300042007 | Ga0439449_0000032 | Ga0439449_0000032_4718_5563 | 281 |
| 713 | 3300046525 | Ga0495663_0001923 | Ga0495663_0001923_5315_6226 | 281 |
| 714 | 3300046525 | Ga0495663_0016887 | Ga0495663_0016887_390_1235 | 281 |
| 715 | 3300046530 | Ga0495654_0040084 | Ga0495654_0040084_254_1165 | 281 |
| 716 | 3300046616 | Ga0495668_0001998 | Ga0495668_0001998_11491_12336 | 281 |
| 717 | 3300046692 | Ga0495671_0010623 | Ga0495671_0010623_334_1245 | 281 |
| 718 | 3300047472 | Ga0495686_0009853 | Ga0495686_0009853_5879_6727 | 281 |
| 719 | 3300048925 | Ga0496122_0000062 | Ga0496122_0000062_212369_213217 | 281 |
| 720 | 3300048926 | Ga0496123_0003624 | Ga0496123_0003624_11891_12739 | 281 |
| 721 | 3300048929 | Ga0496126_0054895 | Ga0496126_0054895_1701_2549 | 281 |
| 722 | 3300049585 | Ga0501069_0019608 | Ga0501069_0019608_2501_3349 | 281 |
| 723 | 3300049586 | Ga0501070_0005780 | Ga0501070_0005780_5690_6538 | 281 |
| 724 | 3300049705 | Ga0501225_0000494 | Ga0501225_0000494_9404_10249 | 281 |
| 725 | 3300053087 | Ga0500643_001459 | Ga0500643_001459_6528_7376 | 281 |
| 726 | 3300053093 | Ga0500651_0000120 | Ga0500651_0000120_21621_22469 | 281 |
| 727 | 3300053120 | Ga0500597_000019 | Ga0500597_000019_7725_8573 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7uqw-assembly1.cif.gz_A | pcc6803 cyanophycinase s132dap covalently bound to cyanophycin dimer | 0.8631 | 12 | 271 |
| 7uqv-assembly1.cif.gz_B | pseudobacteroides cellulosolvens pseudo-cphb | 0.8629 | 13 | 270 |
| 3en0-assembly1.cif.gz_B | the structure of cyanophycinase | 0.8595 | 12 | 271 |
| 7uqv-assembly1.cif.gz_A | pseudobacteroides cellulosolvens pseudo-cphb | 0.858 | 13 | 270 |
| 7uqv-assembly2.cif.gz_C | pseudobacteroides cellulosolvens pseudo-cphb | 0.8561 | 15 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3en0C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8431 | 10 | 271 | 3.40.50.880 |
| 3en0C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8338 | 10 | 271 | 3.40.50.880 |
| 2ywdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.7351 | 45 | 138 | 3.40.50.880 |
| 1um9D02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7238 | 42 | 102 | 3.40.50.920 |
| af_K7KS65_46_105_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7082 | 34 | 76 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N9PGD3-F1-model_v4 | Cyanophycinase | 0.9415 | 11 | 141 |
GO:0006508
GO:0008236 |
| AF-A0A353T2L3-F1-model_v4 | Cyanophycinase (EC 3.4.15.6) | 0.9293 | 8 | 137 |
GO:0006508
GO:0008236 |
| AF-A0A3D5V7F7-F1-model_v4 | Cyanophycinase | 0.9268 | 186 | 271 |
GO:0016787
|
| AF-A0A356ZBV8-F1-model_v4 | Cyanophycinase | 0.914 | 200 | 271 |
GO:0016787
|
| AF-A0A7Y1XUA9-F1-model_v4 | Cyanophycinase | 0.9126 | 194 | 273 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar