F477749

General Info

Members Datasets Scaffolds Average Seq Length
727 357 677 537

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10005517|Ga0209974_100055172
Length 593
Sequence MKRFFAGDLRWINDSLRTAAQGGREKHGGTEIFMQAEAALGRMGLWFAVMLLAIVACAAAADPGFSVQAGIVAVMALGLFMASAARFDPLGHARGFFRMPQGDSRYDDDPIRWATLATLFWGAAGFMAGLFIAAQLAWPQLNFEPYLNFGRVRPLHTSAVIFAFGGNALIGTSFYVVQRTCRTRLAFPALARFVFWGYQVFIVLAATGYLLGISQSKEYAEPQWYADWWLTVVWLAYLAVFVGTILRRHEPHIYVANWFYLAFIITVAMLHVVNNLDMPVSLLGSQAYPLFGGVQGALVQWWYGHNAVGFFLTAGFLAMMYYFVPKQAERPVYSYRLSIIHFWSLIFLYIWAGPHHLLYTALPDWAQTLGMVFSIMLWMPSWGGMINGLMTLNGAWDKVRTDPIIRMMVMALAFYGMSTFEGPMLSIKFFNSLSHYTDWTIGHVHSGALGWNGMITFACLYYLVPRLWNRGRMYSLRMINWHFWLATLGIVFYAASMWVAGITQGLMWREYGADGYLVNSFADTVAAIHPMYVMRAFGGLLYLAGFVVMLWNVGQTLAGKVREEAPMTETPHDPVADRPIPGAAAAVPAVPAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
3 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
4 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
5 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
10 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
11 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
12 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
15 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
16 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
17 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
18 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
19 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
20 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
21 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
22 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
23 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
24 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
25 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
26 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
27 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
28 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
29 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
30 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
31 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
32 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
33 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
34 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
35 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
36 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
37 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
38 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
39 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
40 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
41 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
42 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
43 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
44 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
45 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
46 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
47 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
48 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
49 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
50 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
53 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
54 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
55 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
56 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
57 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
58 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
241 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
288 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
304 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
305 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
306 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
307 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
308 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
309 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
310 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
311 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
312 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
313 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
314 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
315 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
318 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
319 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
320 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
321 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
339 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
340 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
341 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
342 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
343 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
350 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
351 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
356 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
357 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.12
Metatranscriptomes 0
Isolates 6.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.08
Nodule 1.65
Rhizoplane 2.34
Rhizosphere 79.23
Stem 0
Stem Tuber 0.14
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_118179 2162886007 Bacteria 3737
2 JGI24736J21556_1000172 3300001904 Bacteria 11486
3 JGI24736J21556_1000319 3300001904 Bacteria 8934
4 JGI24736J21556_1005870 3300001904 Bacteria 2075
5 JGI24741J21665_1000143 3300001915 Bacteria 19927
6 JGI24740J21852_10001914 3300001979 Bacteria 9554
7 JGI24740J21852_10004740 3300001979 Bacteria 5813
8 JGI24739J22299_10001814 3300001989 Bacteria 8137
9 JGI24739J22299_10003317 3300001989 Bacteria 6140
10 JGI24739J22299_10004003 3300001989 Bacteria 5639
11 JGI24739J22299_10026015 3300001989 Bacteria 2056
12 JGI24737J22298_10003835 3300001990 Bacteria 5286
13 JGI24737J22298_10004097 3300001990 Bacteria 5091
14 JGI24735J21928_10001460 3300002067 Bacteria 8361
15 JGI24735J21928_10005791 3300002067 Bacteria 4088
16 JGI24735J21928_10009849 3300002067 Bacteria 3061
17 JGI24738J21930_10002457 3300002075 Bacteria 4846
18 JGI24738J21930_10004108 3300002075 Bacteria 3596
19 JGI24034J26672_10004435 3300002239 Bacteria 1990
20 JGI24751J29686_10000202 3300002459 Bacteria 25902
21 JGI24751J29686_10001546 3300002459 Bacteria 4769
22 JGI25165J46597_1000138 3300003214 Bacteria 121773
23 Ga0055524_1000038 3300003775 Bacteria 162683
24 Ga0055524_1000221 3300003775 Bacteria 60461
25 Ga0055530_10000518 3300003791 Bacteria 33511
26 Ga0055530_10004799 3300003791 Bacteria 6783
27 Ga0055531_10016199 3300003794 Bacteria 3233
28 Ga0065704_10000306 3300005289 Bacteria 41833
29 Ga0065704_10002284 3300005289 Bacteria 10046
30 Ga0065712_10077285 3300005290 Bacteria 3519
31 Ga0065707_10085409 3300005295 Bacteria 6176
32 Ga0065707_10085887 3300005295 Bacteria 5821
33 Ga0065707_10097586 3300005295 Bacteria 3161
34 Ga0070658_10001136 3300005327 Bacteria 22699
35 Ga0070658_10002177 3300005327 Bacteria 16444
36 Ga0070658_10004633 3300005327 Bacteria 11178
37 Ga0070658_10005829 3300005327 Bacteria 9983
38 Ga0070676_10000079 3300005328 Bacteria 33090
39 Ga0070676_10002350 3300005328 Bacteria 9687
40 Ga0070683_100033052 3300005329 Bacteria 4714
41 Ga0070690_100006640 3300005330 Bacteria 6572
42 Ga0070670_100000339 3300005331 Bacteria 39253
43 Ga0070670_100002660 3300005331 Bacteria 14770
44 Ga0070670_100002673 3300005331 Bacteria 14724
45 Ga0070670_100041478 3300005331 Bacteria 3956
46 Ga0070677_10011502 3300005333 Bacteria 3054
47 Ga0068869_100000492 3300005334 Bacteria 21961
48 Ga0068869_100001745 3300005334 Bacteria 13000
49 Ga0068869_100011811 3300005334 Bacteria 5744
50 Ga0070666_10056526 3300005335 Bacteria 2650
51 Ga0070666_10079009 3300005335 Bacteria 2247
52 Ga0070680_100076925 3300005336 Bacteria 2748
53 Ga0068868_100000154 3300005338 Bacteria 44616
54 Ga0068868_100127800 3300005338 Bacteria 2078
55 Ga0070660_100000544 3300005339 Bacteria 25288
56 Ga0070660_100000581 3300005339 Bacteria 24544
57 Ga0070660_100005066 3300005339 Bacteria 9105
58 Ga0070660_100007495 3300005339 Bacteria 7608
59 Ga0070660_100008064 3300005339 Bacteria 7360
60 Ga0070660_100009163 3300005339 Bacteria 6949
61 Ga0070660_100080017 3300005339 Bacteria 2564
62 Ga0070661_100001045 3300005344 Bacteria 19570
63 Ga0070661_100005599 3300005344 Bacteria 8654
64 Ga0070668_100003324 3300005347 Bacteria 11867
65 Ga0070668_100015604 3300005347 Bacteria 5678
66 Ga0070668_100018696 3300005347 Bacteria 5203
67 Ga0070668_100028638 3300005347 Bacteria 4227
68 Ga0070668_100119687 3300005347 Bacteria 2103
69 Ga0070669_100000345 3300005353 Bacteria 36221
70 Ga0070669_100001184 3300005353 Bacteria 18986
71 Ga0070669_100004097 3300005353 Bacteria 10562
72 Ga0070669_100012646 3300005353 Bacteria 5990
73 Ga0070669_100036074 3300005353 Bacteria 3582
74 Ga0070669_100040950 3300005353 Bacteria 3368
75 Ga0070675_100003762 3300005354 Bacteria 11520
76 Ga0070675_100043868 3300005354 Bacteria 3657
77 Ga0070671_100000007 3300005355 Bacteria 250397
78 Ga0070671_100000027 3300005355 Bacteria 114189
79 Ga0070671_100002453 3300005355 Bacteria 14337
80 Ga0070671_100007531 3300005355 Bacteria 8706
81 Ga0070674_100034190 3300005356 Bacteria 3393
82 Ga0070673_100000023 3300005364 Bacteria 91936
83 Ga0070673_100006904 3300005364 Bacteria 7425
84 Ga0070673_100013295 3300005364 Bacteria 5687
85 Ga0070673_100033483 3300005364 Bacteria 3881
86 Ga0070688_100004092 3300005365 Bacteria 7565
87 Ga0070659_100001886 3300005366 Bacteria 15004
88 Ga0070659_100003357 3300005366 Bacteria 11389
89 Ga0070659_100028147 3300005366 Bacteria 4337
90 Ga0070659_100093282 3300005366 Bacteria 2416
91 Ga0070667_100000004 3300005367 Bacteria 444091
92 Ga0070667_100000300 3300005367 Bacteria 55347
93 Ga0070667_100000390 3300005367 Bacteria 47461
94 Ga0070667_100016634 3300005367 Bacteria 6088
95 Ga0070667_100050679 3300005367 Bacteria 3499
96 Ga0070701_10012016 3300005438 Bacteria 3889
97 Ga0070708_100001167 3300005445 Bacteria 20229
98 Ga0070663_100000791 3300005455 Bacteria 17178
99 Ga0070678_100028584 3300005456 Bacteria 3805
100 Ga0070662_100000078 3300005457 Bacteria 53638
101 Ga0070662_100000100 3300005457 Bacteria 47285
102 Ga0070681_10004190 3300005458 Bacteria 13658
103 Ga0068867_100000007 3300005459 Bacteria 148726
104 Ga0068867_100037937 3300005459 Bacteria 3505
105 Ga0070685_10004485 3300005466 Bacteria 7064
106 Ga0068853_100005601 3300005539 Bacteria 9861
107 Ga0068853_100010552 3300005539 Bacteria 7469
108 Ga0068853_100027833 3300005539 Bacteria 4752
109 Ga0068853_100203241 3300005539 Bacteria 1803
110 Ga0070672_100029364 3300005543 Bacteria 4122
111 Ga0070665_100000129 3300005548 Bacteria 141818
112 Ga0070665_100000169 3300005548 Bacteria 118043
113 Ga0070665_100001656 3300005548 Bacteria 25675
114 Ga0070665_100006197 3300005548 Bacteria 12241
115 Ga0070665_100013687 3300005548 Bacteria 8163
116 Ga0070665_100019755 3300005548 Bacteria 6763
117 Ga0070665_100028940 3300005548 Bacteria 5577
118 Ga0070665_100031714 3300005548 Bacteria 5318
119 Ga0070665_100075497 3300005548 Bacteria 3378
120 Ga0068855_100004942 3300005563 Bacteria 16258
121 Ga0068855_100010294 3300005563 Bacteria 11279
122 Ga0068855_100050081 3300005563 Bacteria 4923
123 Ga0068855_100120775 3300005563 Bacteria 2999
124 Ga0068855_100122583 3300005563 Bacteria 2974
125 Ga0070664_100009168 3300005564 Bacteria 8034
126 Ga0068857_100007911 3300005577 Bacteria 9172
127 Ga0068857_100018857 3300005577 Bacteria 6053
128 Ga0068857_100033275 3300005577 Bacteria 4559
129 Ga0068857_100049951 3300005577 Bacteria 3711
130 Ga0068854_100000255 3300005578 Bacteria 36254
131 Ga0068854_100006050 3300005578 Bacteria 7670
132 Ga0068854_100034900 3300005578 Bacteria 3517
133 Ga0068854_100135501 3300005578 Bacteria 1885
134 Ga0068856_100009851 3300005614 Bacteria 9278
135 Ga0068856_100033854 3300005614 Bacteria 5004
136 Ga0068856_100040766 3300005614 Bacteria 4562
137 Ga0068856_100059205 3300005614 Bacteria 3783
138 Ga0068856_100086466 3300005614 Bacteria 3115
139 Ga0068852_100000208 3300005616 Bacteria 39815
140 Ga0068852_100002270 3300005616 Bacteria 13203
141 Ga0068852_100006502 3300005616 Bacteria 8448
142 Ga0068852_100011473 3300005616 Bacteria 6672
143 Ga0068859_100001637 3300005617 Bacteria 22877
144 Ga0068859_100021839 3300005617 Bacteria 6419
145 Ga0068859_100024271 3300005617 Bacteria 6084
146 Ga0068859_100178631 3300005617 Bacteria 2205
147 Ga0068864_100000233 3300005618 Bacteria 49794
148 Ga0068864_100001909 3300005618 Bacteria 17108
149 Ga0068864_100002699 3300005618 Bacteria 14620
150 Ga0068864_100009652 3300005618 Bacteria 7963
151 Ga0068864_100019221 3300005618 Bacteria 5710
152 Ga0068864_100028820 3300005618 Bacteria 4697
153 Ga0068861_100003970 3300005719 Bacteria 9907
154 Ga0068851_10001881 3300005834 Bacteria 9224
155 Ga0068870_10003032 3300005840 Bacteria 7078
156 Ga0068870_10069615 3300005840 Bacteria 1915
157 Ga0068863_100000081 3300005841 Bacteria 106186
158 Ga0068863_100000169 3300005841 Bacteria 70831
159 Ga0068863_100001079 3300005841 Bacteria 27286
160 Ga0068863_100001536 3300005841 Bacteria 22796
161 Ga0068863_100003624 3300005841 Bacteria 15249
162 Ga0068863_100006692 3300005841 Bacteria 11310
163 Ga0068863_100013152 3300005841 Bacteria 7986
164 Ga0068863_100025902 3300005841 Bacteria 5596
165 Ga0068858_100000506 3300005842 Bacteria 40814
166 Ga0068858_100000587 3300005842 Bacteria 38232
167 Ga0068858_100001600 3300005842 Bacteria 23109
168 Ga0068858_100002847 3300005842 Bacteria 17396
169 Ga0068858_100003843 3300005842 Bacteria 14850
170 Ga0068858_100006571 3300005842 Bacteria 11313
171 Ga0068858_100019496 3300005842 Bacteria 6343
172 Ga0068860_100000002 3300005843 Bacteria 627849
173 Ga0068860_100000023 3300005843 Bacteria 279076
174 Ga0068860_100000108 3300005843 Bacteria 132230
175 Ga0068860_100000224 3300005843 Bacteria 88107
176 Ga0068860_100005575 3300005843 Bacteria 12730
177 Ga0068860_100010596 3300005843 Bacteria 9106
178 Ga0068860_100025709 3300005843 Bacteria 5678
179 Ga0068860_100039245 3300005843 Bacteria 4529
180 Ga0068860_100063837 3300005843 Bacteria 3497
181 Ga0068860_100073083 3300005843 Bacteria 3260
182 Ga0068862_100000288 3300005844 Bacteria 55742
183 Ga0068862_100002573 3300005844 Bacteria 16022
184 Ga0068862_100067336 3300005844 Bacteria 3087
185 Ga0068862_100078946 3300005844 Bacteria 2852
186 Ga0068862_100140492 3300005844 Bacteria 2143
187 Ga0075368_10000377 3300006042 Bacteria 13060
188 Ga0075364_10010857 3300006051 Bacteria 5516
189 Ga0075362_10000015 3300006177 Bacteria 84026
190 Ga0075367_10000570 3300006178 Bacteria 14051
191 Ga0075369_10000186 3300006186 Bacteria 17929
192 Ga0075366_10000153 3300006195 Bacteria 29232
193 Ga0075366_10021020 3300006195 Bacteria 3793
194 Ga0097621_100003378 3300006237 Bacteria 10987
195 Ga0097621_100039906 3300006237 Bacteria 3772
196 Ga0075370_10000005 3300006353 Bacteria 112202
197 Ga0075370_10064874 3300006353 Bacteria 2083
198 Ga0068871_100006581 3300006358 Bacteria 8236
199 Ga0068871_100084964 3300006358 Bacteria 2627
200 Ga0075430_100003721 3300006846 Bacteria 12816
201 Ga0068865_100000010 3300006881 Bacteria 159548
202 Ga0097620_100001637 3300006931 Bacteria 22877
203 Ga0097620_100021839 3300006931 Bacteria 6419
204 Ga0097620_100024271 3300006931 Bacteria 6084
205 Ga0097620_100178636 3300006931 Bacteria 2205
206 Ga0105251_10003202 3300009011 Bacteria 12085
207 Ga0105240_10004622 3300009093 Bacteria 20873
208 Ga0105240_10008082 3300009093 Bacteria 15118
209 Ga0105240_10092234 3300009093 Bacteria 3699
210 Ga0105245_10019720 3300009098 Bacteria 5909
211 Ga0105245_10040363 3300009098 Bacteria 4157
212 Ga0105247_10007289 3300009101 Bacteria 6797
213 Ga0105247_10069554 3300009101 Bacteria 2197
214 Ga0105243_10000950 3300009148 Bacteria 27049
215 Ga0105241_10001752 3300009174 Bacteria 16461
216 Ga0105241_10006964 3300009174 Bacteria 8316
217 Ga0105242_10000210 3300009176 Bacteria 45627
218 Ga0105248_10005948 3300009177 Bacteria 13399
219 Ga0105248_10008636 3300009177 Bacteria 11190
220 Ga0105248_10041655 3300009177 Bacteria 5149
221 Ga0105248_10043765 3300009177 Bacteria 5022
222 Ga0105248_10058733 3300009177 Bacteria 4320
223 Ga0105238_10018659 3300009551 Bacteria 7063
224 Ga0105238_10033163 3300009551 Bacteria 5255
225 Ga0105249_10000053 3300009553 Bacteria 168010
226 Ga0105249_10022128 3300009553 Bacteria 5694
227 Ga0105249_10070001 3300009553 Bacteria 3238
228 Ga0105148_100614 3300009978 Bacteria 2938
229 Ga0105239_10006936 3300010375 Bacteria 13068
230 Ga0105239_10072195 3300010375 Bacteria 3794
231 Ga0105239_10114605 3300010375 Bacteria 2990
232 Ga0105246_10000333 3300011119 Bacteria 25060
233 Ga0105246_10011832 3300011119 Bacteria 5424
234 Ga0157373_10001248 3300013100 Bacteria 19430
235 Ga0157373_10018150 3300013100 Bacteria 5124
236 Ga0157373_10023870 3300013100 Bacteria 4431
237 Ga0157371_10000519 3300013102 Bacteria 46108
238 Ga0157370_10006473 3300013104 Bacteria 12913
239 Ga0157370_10027954 3300013104 Bacteria 5556
240 Ga0157370_10053116 3300013104 Bacteria 3865
241 Ga0157369_10000446 3300013105 Bacteria 54687
242 Ga0157369_10013128 3300013105 Bacteria 9374
243 Ga0157369_10117510 3300013105 Bacteria 2823
244 Ga0157369_10123431 3300013105 Bacteria 2747
245 Ga0157374_10000830 3300013296 Bacteria 27049
246 Ga0157374_10005259 3300013296 Bacteria 10861
247 Ga0157378_10019607 3300013297 Bacteria 5944
248 Ga0157378_10045704 3300013297 Bacteria 3892
249 Ga0163162_10005912 3300013306 Bacteria 11838
250 Ga0157372_10000380 3300013307 Bacteria 49260
251 Ga0157372_10001430 3300013307 Bacteria 25787
252 Ga0157372_10310389 3300013307 Bacteria 1836
253 Ga0157375_10005919 3300013308 Bacteria 10659
254 Ga0157375_10034342 3300013308 Bacteria 4831
255 Ga0163163_10100720 3300014325 Bacteria 2911
256 Ga0157380_10003365 3300014326 Bacteria 10970
257 Ga0157380_10009984 3300014326 Bacteria 6814
258 Ga0157380_10153231 3300014326 Bacteria 1995
259 Ga0157379_10007542 3300014968 Bacteria 9417
260 Ga0157379_10035140 3300014968 Bacteria 4468
261 Ga0157376_10000047 3300014969 Bacteria 107974
262 Ga0157376_10003300 3300014969 Bacteria 11110
263 Ga0163161_10071667 3300017792 Bacteria 2536
264 Ga0213872_10000842 3300021361 Bacteria 22153
265 Ga0213872_10000876 3300021361 Bacteria 21757
266 Ga0213872_10006039 3300021361 Bacteria 6131
267 Ga0213872_10051771 3300021361 Bacteria 1863
268 Ga0209147_101557 3300025229 Bacteria 7842
269 Ga0207427_104089 3300025231 Bacteria 2627
270 Ga0209233_1000182 3300025261 Bacteria 137671
271 Ga0209233_1000713 3300025261 Bacteria 15488
272 Ga0209565_1000010 3300025263 Bacteria 687724
273 Ga0209455_1006444 3300025272 Bacteria 3460
274 Ga0209676_1000132 3300025292 Bacteria 185063
275 Ga0209676_1000155 3300025292 Bacteria 165151
276 Ga0209676_1000311 3300025292 Bacteria 95478
277 Ga0209050_1000139 3300025298 Bacteria 173691
278 Ga0209050_1000375 3300025298 Bacteria 84503
279 Ga0209256_1000012 3300025299 Bacteria 790371
280 Ga0209051_1000966 3300025303 Bacteria 28138
281 Ga0209257_1000164 3300025304 Bacteria 173339
282 Ga0209257_1010140 3300025304 Bacteria 4853
283 Ga0207697_10001788 3300025315 Bacteria 11507
284 Ga0207656_10002966 3300025321 Bacteria 5794
285 Ga0207656_10013321 3300025321 Bacteria 3141
286 Ga0207696_1001974 3300025711 Bacteria 10408
287 Ga0207713_1001813 3300025735 Bacteria 16314
288 Ga0207713_1026935 3300025735 Bacteria 2621
289 Ga0207682_10001492 3300025893 Bacteria 10804
290 Ga0207710_10003665 3300025900 Bacteria 6814
291 Ga0207688_10028868 3300025901 Bacteria 3051
292 Ga0207680_10070228 3300025903 Bacteria 2167
293 Ga0207647_10002484 3300025904 Bacteria 13964
294 Ga0207647_10005479 3300025904 Bacteria 9290
295 Ga0207647_10008107 3300025904 Bacteria 7550
296 Ga0207645_10001300 3300025907 Bacteria 20546
297 Ga0207643_10002157 3300025908 Bacteria 10787
298 Ga0207705_10000037 3300025909 Bacteria 197951
299 Ga0207705_10001772 3300025909 Bacteria 17049
300 Ga0207705_10020526 3300025909 Bacteria 4718
301 Ga0207654_10002334 3300025911 Bacteria 9737
302 Ga0207707_10053011 3300025912 Bacteria 3531
303 Ga0207695_10001391 3300025913 Bacteria 40900
304 Ga0207695_10014635 3300025913 Bacteria 9278
305 Ga0207695_10022001 3300025913 Bacteria 7257
306 Ga0207671_10000841 3300025914 Bacteria 38929
307 Ga0207671_10016046 3300025914 Bacteria 5837
308 Ga0207660_10087790 3300025917 Bacteria 2298
309 Ga0207657_10000411 3300025919 Bacteria 45329
310 Ga0207657_10000420 3300025919 Bacteria 45042
311 Ga0207657_10002193 3300025919 Bacteria 21169
312 Ga0207657_10003249 3300025919 Bacteria 17400
313 Ga0207657_10009446 3300025919 Bacteria 9797
314 Ga0207657_10009801 3300025919 Bacteria 9602
315 Ga0207657_10010428 3300025919 Bacteria 9275
316 Ga0207657_10033891 3300025919 Bacteria 4598
317 Ga0207657_10044982 3300025919 Bacteria 3877
318 Ga0207649_10002157 3300025920 Bacteria 11132
319 Ga0207649_10021387 3300025920 Bacteria 3723
320 Ga0207649_10026496 3300025920 Bacteria 3392
321 Ga0207652_10006580 3300025921 Bacteria 9368
322 Ga0207681_10000086 3300025923 Bacteria 81919
323 Ga0207681_10000852 3300025923 Bacteria 20044
324 Ga0207681_10001199 3300025923 Bacteria 16657
325 Ga0207681_10001437 3300025923 Bacteria 15337
326 Ga0207681_10006062 3300025923 Bacteria 7414
327 Ga0207681_10006088 3300025923 Bacteria 7401
328 Ga0207694_10009370 3300025924 Bacteria 7385
329 Ga0207694_10061446 3300025924 Bacteria 2924
330 Ga0207650_10000008 3300025925 Bacteria 498534
331 Ga0207650_10002924 3300025925 Bacteria 11785
332 Ga0207650_10060896 3300025925 Bacteria 2817
333 Ga0207659_10004068 3300025926 Bacteria 8823
334 Ga0207659_10008529 3300025926 Bacteria 6371
335 Ga0207687_10004556 3300025927 Bacteria 9223
336 Ga0207687_10012191 3300025927 Bacteria 5623
337 Ga0207644_10000002 3300025931 Bacteria 942221
338 Ga0207644_10000022 3300025931 Bacteria 160689
339 Ga0207644_10000064 3300025931 Bacteria 77442
340 Ga0207644_10000519 3300025931 Bacteria 24938
341 Ga0207644_10004497 3300025931 Bacteria 9058
342 Ga0207644_10005466 3300025931 Bacteria 8274
343 Ga0207644_10019920 3300025931 Bacteria 4556
344 Ga0207690_10000043 3300025932 Bacteria 119547
345 Ga0207690_10001598 3300025932 Bacteria 14142
346 Ga0207690_10019935 3300025932 Bacteria 4135
347 Ga0207706_10000008 3300025933 Bacteria 201940
348 Ga0207706_10000468 3300025933 Bacteria 43144
349 Ga0207706_10007150 3300025933 Bacteria 10323
350 Ga0207686_10000332 3300025934 Bacteria 34076
351 Ga0207709_10000050 3300025935 Bacteria 234391
352 Ga0207704_10000020 3300025938 Bacteria 148847
353 Ga0207704_10036911 3300025938 Bacteria 2817
354 Ga0207691_10008219 3300025940 Bacteria 10024
355 Ga0207691_10017270 3300025940 Bacteria 6844
356 Ga0207711_10014352 3300025941 Bacteria 6579
357 Ga0207711_10024546 3300025941 Bacteria 5053
358 Ga0207711_10036124 3300025941 Bacteria 4191
359 Ga0207711_10044496 3300025941 Bacteria 3790
360 Ga0207711_10186484 3300025941 Bacteria 1888
361 Ga0207689_10000320 3300025942 Bacteria 44520
362 Ga0207689_10004290 3300025942 Bacteria 12980
363 Ga0207679_10007633 3300025945 Bacteria 6871
364 Ga0207679_10011729 3300025945 Bacteria 5690
365 Ga0207679_10035026 3300025945 Bacteria 3548
366 Ga0207679_10108454 3300025945 Bacteria 2186
367 Ga0207667_10002837 3300025949 Bacteria 21521
368 Ga0207667_10006744 3300025949 Bacteria 13859
369 Ga0207667_10007432 3300025949 Bacteria 13166
370 Ga0207667_10014312 3300025949 Bacteria 9047
371 Ga0207667_10016198 3300025949 Bacteria 8427
372 Ga0207667_10033936 3300025949 Bacteria 5482
373 Ga0207651_10000005 3300025960 Bacteria 246132
374 Ga0207712_10000045 3300025961 Bacteria 168093
375 Ga0207712_10085225 3300025961 Bacteria 2311
376 Ga0207668_10000024 3300025972 Bacteria 131871
377 Ga0207668_10000265 3300025972 Bacteria 34885
378 Ga0207668_10000477 3300025972 Bacteria 25111
379 Ga0207668_10002663 3300025972 Bacteria 10447
380 Ga0207668_10002922 3300025972 Bacteria 10023
381 Ga0207668_10003827 3300025972 Bacteria 8868
382 Ga0207640_10002020 3300025981 Bacteria 10959
383 Ga0207640_10018413 3300025981 Bacteria 4105
384 Ga0207640_10033847 3300025981 Bacteria 3183
385 Ga0207658_10000002 3300025986 Bacteria 1364188
386 Ga0207658_10000074 3300025986 Bacteria 110470
387 Ga0207658_10000258 3300025986 Bacteria 55336
388 Ga0207658_10001286 3300025986 Bacteria 19856
389 Ga0207658_10062849 3300025986 Bacteria 2780
390 Ga0207658_10067791 3300025986 Bacteria 2689
391 Ga0207677_10000373 3300026023 Bacteria 31103
392 Ga0207703_10000409 3300026035 Bacteria 45646
393 Ga0207703_10004419 3300026035 Bacteria 11551
394 Ga0207703_10004594 3300026035 Bacteria 11298
395 Ga0207703_10007127 3300026035 Bacteria 8894
396 Ga0207703_10008781 3300026035 Bacteria 7969
397 Ga0207703_10009066 3300026035 Bacteria 7832
398 Ga0207703_10128630 3300026035 Bacteria 2184
399 Ga0207639_10000148 3300026041 Bacteria 52602
400 Ga0207639_10004141 3300026041 Bacteria 9762
401 Ga0207639_10009358 3300026041 Bacteria 6755
402 Ga0207639_10016645 3300026041 Bacteria 5206
403 Ga0207639_10033804 3300026041 Bacteria 3775
404 Ga0207639_10035712 3300026041 Bacteria 3679
405 Ga0207678_10000979 3300026067 Bacteria 26012
406 Ga0207678_10010235 3300026067 Bacteria 8233
407 Ga0207678_10038771 3300026067 Bacteria 4138
408 Ga0207708_10027763 3300026075 Bacteria 4286
409 Ga0207702_10001863 3300026078 Bacteria 20726
410 Ga0207702_10002491 3300026078 Bacteria 17390
411 Ga0207702_10003048 3300026078 Bacteria 15571
412 Ga0207702_10003563 3300026078 Bacteria 14163
413 Ga0207702_10009519 3300026078 Bacteria 8158
414 Ga0207641_10000181 3300026088 Bacteria 87655
415 Ga0207641_10000182 3300026088 Bacteria 87316
416 Ga0207641_10000475 3300026088 Bacteria 45483
417 Ga0207641_10000883 3300026088 Bacteria 31302
418 Ga0207641_10001052 3300026088 Bacteria 27867
419 Ga0207641_10001652 3300026088 Bacteria 21776
420 Ga0207641_10003573 3300026088 Bacteria 13744
421 Ga0207641_10005539 3300026088 Bacteria 10768
422 Ga0207641_10006378 3300026088 Bacteria 9956
423 Ga0207641_10014944 3300026088 Bacteria 6364
424 Ga0207641_10089695 3300026088 Bacteria 2687
425 Ga0207648_10000017 3300026089 Bacteria 148699
426 Ga0207648_10017375 3300026089 Bacteria 6546
427 Ga0207648_10021177 3300026089 Bacteria 5845
428 Ga0207648_10047574 3300026089 Bacteria 3759
429 Ga0207676_10000150 3300026095 Bacteria 60517
430 Ga0207676_10000264 3300026095 Bacteria 45636
431 Ga0207676_10000760 3300026095 Bacteria 25233
432 Ga0207676_10001380 3300026095 Bacteria 18070
433 Ga0207676_10001593 3300026095 Bacteria 16712
434 Ga0207676_10003418 3300026095 Bacteria 11228
435 Ga0207676_10005802 3300026095 Bacteria 8728
436 Ga0207676_10090832 3300026095 Bacteria 2507
437 Ga0207674_10025066 3300026116 Bacteria 6365
438 Ga0207674_10029609 3300026116 Bacteria 5764
439 Ga0207674_10039815 3300026116 Bacteria 4870
440 Ga0207674_10081160 3300026116 Bacteria 3245
441 Ga0207675_100000294 3300026118 Bacteria 48163
442 Ga0207675_100016625 3300026118 Bacteria 6872
443 Ga0207698_10000119 3300026142 Bacteria 49217
444 Ga0207698_10000397 3300026142 Bacteria 25102
445 Ga0207698_10001985 3300026142 Bacteria 12034
446 Ga0207698_10047994 3300026142 Bacteria 3239
447 Ga0209813_10000103 3300027866 Bacteria 31517
448 Ga0209974_10000461 3300027876 Bacteria 13511
449 Ga0209974_10005517 3300027876 Bacteria 4446
450 Ga0209974_10025420 3300027876 Bacteria 1960
451 Ga0209974_10029771 3300027876 Bacteria 1809
452 Ga0207428_10030840 3300027907 Bacteria 4429
453 Ga0268266_10000019 3300028379 Bacteria 556465
454 Ga0268266_10003322 3300028379 Bacteria 16142
455 Ga0268266_10009483 3300028379 Bacteria 8565
456 Ga0268266_10017214 3300028379 Bacteria 6172
457 Ga0268266_10018632 3300028379 Bacteria 5915
458 Ga0268265_10000049 3300028380 Bacteria 177242
459 Ga0268265_10000204 3300028380 Bacteria 68890
460 Ga0268265_10005194 3300028380 Bacteria 8921
461 Ga0268264_10000001 3300028381 Bacteria 1221000
462 Ga0268264_10000071 3300028381 Bacteria 267236
463 Ga0268264_10000126 3300028381 Bacteria 186138
464 Ga0268264_10000161 3300028381 Bacteria 150917
465 Ga0268264_10003264 3300028381 Bacteria 14019
466 Ga0268264_10007232 3300028381 Bacteria 9297
467 Ga0268264_10008585 3300028381 Bacteria 8488
468 Ga0268264_10015699 3300028381 Bacteria 6203
469 Ga0268264_10029464 3300028381 Bacteria 4496
470 Ga0265331_10000407 3300031250 Bacteria 44156
471 Ga0265327_10000772 3300031251 Bacteria 49388
472 Ga0307508_10007169 3300031616 Bacteria 10381
473 Ga0307405_10006017 3300031731 Bacteria 5926
474 Ga0307413_10001785 3300031824 Bacteria 8421
475 Ga0307413_10001824 3300031824 Bacteria 8370
476 Ga0307413_10031204 3300031824 Bacteria 3004
477 Ga0307410_10002237 3300031852 Bacteria 9240
478 Ga0307410_10009198 3300031852 Bacteria 5528
479 Ga0307410_10017409 3300031852 Bacteria 4315
480 Ga0307407_10008356 3300031903 Bacteria 4745
481 Ga0307412_10000638 3300031911 Bacteria 20422
482 Ga0307412_10014986 3300031911 Bacteria 4584
483 Ga0307412_10024421 3300031911 Bacteria 3730
484 Ga0307412_10048275 3300031911 Bacteria 2799
485 Ga0307409_100030858 3300031995 Bacteria 3858
486 Ga0307416_100205399 3300032002 Bacteria 1873
487 Ga0307414_10000068 3300032004 Bacteria 100925
488 Ga0307414_10003981 3300032004 Bacteria 7970
489 Ga0307414_10016298 3300032004 Bacteria 4514
490 Ga0307414_10051280 3300032004 Bacteria 2863
491 Ga0307411_10034443 3300032005 Bacteria 3152
492 Ga0307510_10000248 3300033180 Bacteria 48764
493 Ga0373937_0134922 3300036401 Bacteria 2307
494 Ga0316584_0012532 3300036712 Bacteria 5981
495 Ga0316584_0127739 3300036712 Bacteria 1899
496 Ga0373925_0116431 3300037068 Bacteria 2070
497 Ga0395900_0014312 3300037418 Bacteria 8098
498 Ga0395905_0053716 3300037471 Bacteria 3770
499 Ga0395905_0182990 3300037471 Bacteria 1967
500 Ga0395901_0117983 3300038443 Bacteria 2788
501 Ga0237819_00251 3300038705 Bacteria 19599
502 Ga0400483_083742 3300039062 Bacteria 2652
503 Ga0400483_165238 3300039062 Bacteria 3317
504 Ga0400483_211635 3300039062 Bacteria 3498
505 Ga0436365_1306047 3300039437 Bacteria 29268
506 Ga0436360_0172898 3300039438 Bacteria 4819
507 Ga0436361_0034567 3300039447 Bacteria 27864
508 Ga0436361_1111514 3300039447 Bacteria 15305
509 Ga0451576_0000030 3300045051 Bacteria 403352
510 Ga0451576_0000165 3300045051 Bacteria 168085
511 Ga0451576_0002914 3300045051 Bacteria 24364
512 Ga0451576_0090232 3300045051 Bacteria 3188
513 Ga0451576_0119414 3300045051 Bacteria 2745
514 Ga0466967_0129519 3300045976 Bacteria 2341
515 Ga0495627_000110 3300046453 Bacteria 101742
516 Ga0495638_0000073 3300046460 Bacteria 164378
517 Ga0495596_0001207 3300046500 Bacteria 15118
518 Ga0495583_0000087 3300046506 Bacteria 164974
519 Ga0495583_0005996 3300046506 Bacteria 8063
520 Ga0495610_0000303 3300046512 Bacteria 51903
521 Ga0495632_0000271 3300046519 Bacteria 51334
522 Ga0495632_0001911 3300046519 Bacteria 16665
523 Ga0495637_0000124 3300046520 Bacteria 57259
524 Ga0495643_0000031 3300046522 Bacteria 257820
525 Ga0495643_0000341 3300046522 Bacteria 63337
526 Ga0495643_0022274 3300046522 Bacteria 3618
527 Ga0495643_0026083 3300046522 Bacteria 3301
528 Ga0495648_0000049 3300046524 Bacteria 164366
529 Ga0495648_0004359 3300046524 Bacteria 12118
530 Ga0495663_0000057 3300046525 Bacteria 51334
531 Ga0495609_0004437 3300046538 Bacteria 7673
532 Ga0495597_0005777 3300046542 Bacteria 6493
533 Ga0495633_0000136 3300046558 Bacteria 97314
534 Ga0495633_0003341 3300046558 Bacteria 10772
535 Ga0495625_0000223 3300046660 Bacteria 89528
536 Ga0495625_0027078 3300046660 Bacteria 4321
537 Ga0495625_0030398 3300046660 Bacteria 4031
538 Ga0495671_0000021 3300046692 Bacteria 257820
539 Ga0495671_0000042 3300046692 Bacteria 165201
540 Ga0495673_0000111 3300047469 Bacteria 164974
541 Ga0495673_0029254 3300047469 Bacteria 2602
542 Ga0495681_0023806 3300047470 Bacteria 3241
543 Ga0495686_0002043 3300047472 Bacteria 19878
544 Ga0495615_0000272 3300048090 Bacteria 9629
545 Ga0496101_0010420 3300048904 Bacteria 6138
546 Ga0496102_0000377 3300048905 Bacteria 53437
547 Ga0496102_0000472 3300048905 Bacteria 44602
548 Ga0496102_0055787 3300048905 Bacteria 3603
549 Ga0496103_0000128 3300048906 Bacteria 81657
550 Ga0496103_0000318 3300048906 Bacteria 44504
551 Ga0496104_0000205 3300048907 Bacteria 52752
552 Ga0496105_0000817 3300048908 Bacteria 21106
553 Ga0496105_0001478 3300048908 Bacteria 16579
554 Ga0496106_0003228 3300048909 Bacteria 12206
555 Ga0496108_0008916 3300048911 Bacteria 8129
556 Ga0496110_0004898 3300048913 Bacteria 10446
557 Ga0496110_0023687 3300048913 Bacteria 5223
558 Ga0496113_0006055 3300048916 Bacteria 7622
559 Ga0496113_0007493 3300048916 Bacteria 7029
560 Ga0496114_0013350 3300048917 Bacteria 6585
561 Ga0496116_0001661 3300048919 Bacteria 24466
562 Ga0496116_0036219 3300048919 Bacteria 3456
563 Ga0496117_0000946 3300048920 Bacteria 44400
564 Ga0496117_0001317 3300048920 Bacteria 36512
565 Ga0496117_0006093 3300048920 Bacteria 12350
566 Ga0496118_0000122 3300048921 Bacteria 137396
567 Ga0496118_0000133 3300048921 Bacteria 131319
568 Ga0496118_0043238 3300048921 Bacteria 3543
569 Ga0496118_0049609 3300048921 Bacteria 3231
570 Ga0496119_0002177 3300048922 Bacteria 21974
571 Ga0496119_0030059 3300048922 Bacteria 3669
572 Ga0496120_0001695 3300048923 Bacteria 25248
573 Ga0496121_0000070 3300048924 Bacteria 249187
574 Ga0496121_0000274 3300048924 Bacteria 107140
575 Ga0496121_0006631 3300048924 Bacteria 14254
576 Ga0496121_0034147 3300048924 Bacteria 4583
577 Ga0496122_0001014 3300048925 Bacteria 49714
578 Ga0496123_0000212 3300048926 Bacteria 118628
579 Ga0496123_0001685 3300048926 Bacteria 29584
580 Ga0496123_0023585 3300048926 Bacteria 4705
581 Ga0496124_0000359 3300048927 Bacteria 83092
582 Ga0496124_0000417 3300048927 Bacteria 76104
583 Ga0496124_0016020 3300048927 Bacteria 7155
584 Ga0496125_0006733 3300048928 Bacteria 12350
585 Ga0496125_0012254 3300048928 Bacteria 8525
586 Ga0496126_0000493 3300048929 Bacteria 77742
587 Ga0496126_0002202 3300048929 Bacteria 27029
588 Ga0501297_000522 3300049520 Bacteria 3465
589 Ga0501301_000368 3300049524 Bacteria 2659
590 Ga0501032_0000520 3300049569 Bacteria 31263
591 Ga0501032_0018313 3300049569 Bacteria 4907
592 Ga0501033_0002279 3300049570 Bacteria 16402
593 Ga0501034_0002321 3300049571 Bacteria 23230
594 Ga0501034_0007640 3300049571 Bacteria 11500
595 Ga0501034_0029689 3300049571 Bacteria 5558
596 Ga0501034_0142595 3300049571 Bacteria 2374
597 Ga0501034_0153285 3300049571 Bacteria 2280
598 Ga0501034_0263072 3300049571 Bacteria 1667
599 Ga0501036_0000152 3300049572 Bacteria 45346
600 Ga0501037_0000029 3300049573 Bacteria 139680
601 Ga0501037_0018342 3300049573 Bacteria 5157
602 Ga0501038_0000263 3300049574 Bacteria 44382
603 Ga0501039_0000043 3300049575 Bacteria 109462
604 Ga0501041_0056358 3300049577 Bacteria 2401
605 Ga0501043_0000260 3300049579 Bacteria 48057
606 Ga0501047_0102959 3300049581 Bacteria 2735
607 Ga0501048_0032878 3300049582 Bacteria 3748
608 Ga0501071_0018169 3300049587 Bacteria 4863
609 Ga0501075_0036168 3300049591 Bacteria 3685
610 Ga0501077_0018628 3300049593 Bacteria 4390
611 Ga0501223_000060 3300049663 Bacteria 35869
612 Ga0501223_000124 3300049663 Bacteria 22060
613 Ga0501224_000003 3300049664 Bacteria 189031
614 Ga0501224_000724 3300049664 Bacteria 4136
615 Ga0501227_001028 3300049665 Bacteria 6189
616 Ga0501233_001151 3300049668 Bacteria 4499
617 Ga0501233_001401 3300049668 Bacteria 4120
618 Ga0501235_000862 3300049669 Bacteria 6208
619 Ga0501236_000422 3300049670 Bacteria 4774
620 Ga0501246_000266 3300049676 Bacteria 3577
621 Ga0501257_002742 3300049686 Bacteria 3724
622 Ga0501259_001664 3300049688 Bacteria 3704
623 Ga0501261_000053 3300049690 Bacteria 22071
624 Ga0501225_0000001 3300049705 Bacteria 185804
625 Ga0501225_0000021 3300049705 Bacteria 57397
626 Ga0501234_000627 3300049707 Bacteria 5434
627 Ga0501245_000181 3300049708 Bacteria 6954
628 Ga0501081_0124080 3300049743 Bacteria 1841
629 Ga0501279_000005 3300049775 Bacteria 153858
630 Ga0501280_000012 3300049776 Bacteria 60067
631 Ga0501281_00005 3300049777 Bacteria 36194
632 Ga0501282_000420 3300049778 Bacteria 5006
633 Ga0501283_000558 3300049779 Bacteria 4889
634 Ga0501035_0000057 3300049822 Bacteria 135297
635 Ga0501035_0048671 3300049822 Bacteria 3801
636 Ga0501226_000013 3300049853 Bacteria 175177
637 nmdc:mga03683_35_c1 3300050489 Bacteria 65966
638 nmdc:mga03683_8140_c1 3300050489 Bacteria 3672
639 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
640 nmdc:mga0k408_45325_c1 3300050493 Bacteria 2537
641 nmdc:mga06z11_342_c1 3300050494 Bacteria 17626
642 nmdc:mga04h51_239_c1 3300050495 Bacteria 14433
643 nmdc:mga07m45_18364_c1 3300050496 Bacteria 3773
644 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
645 nmdc:mga0qj67_107065_c1 3300050509 Bacteria 2255
646 nmdc:mga0qj67_24755_c1 3300050509 Bacteria 4631
647 nmdc:mga0qj67_3082_c1 3300050509 Bacteria 11978
648 nmdc:mga0sz30_261_c1 3300050516 Bacteria 20355
649 Ga0500643_000637 3300053087 Bacteria 23631
650 Ga0500643_001993 3300053087 Bacteria 11040
651 Ga0500643_004215 3300053087 Bacteria 6587
652 Ga0500651_0004436 3300053093 Bacteria 7858
653 Ga0500566_0004023 3300053094 Bacteria 8769
654 Ga0500641_0007464 3300053096 Bacteria 3901
655 Ga0500556_0000031 3300053104 Bacteria 156000
656 Ga0500592_001795 3300053116 Bacteria 3469
657 Ga0500595_005197 3300053119 Bacteria 5709
658 Ga0500595_005315 3300053119 Bacteria 5638
659 Ga0500607_069886 3300053121 Bacteria 1816
660 Ga0500608_000988 3300053122 Bacteria 10224
661 Ga0500618_000553 3300053125 Bacteria 23228
662 Ga0500618_003126 3300053125 Bacteria 5828
663 Ga0500642_0003588 3300053130 Bacteria 4715
664 Ga0500655_000039 3300053133 Bacteria 36929
665 Ga0500559_0000006 3300053136 Bacteria 229895
666 Ga0500568_0000312 3300053139 Bacteria 38588
667 Ga0500590_023710 3300053148 Bacteria 3184
668 Ga0500604_0000009 3300053151 Bacteria 112387
669 Ga0500616_0000119 3300053153 Bacteria 143264
670 Ga0500616_0026039 3300053153 Bacteria 3242
671 Ga0500622_0002897 3300053156 Bacteria 11966
672 Ga0500627_0000020 3300053158 Bacteria 109977
673 Ga0500570_000154 3300053724 Bacteria 21218
674 Ga0500625_000030 3300053729 Bacteria 51482
675 Ga0501084_0046920 3300054114 Bacteria 3618
676 Ga0501082_0038754 3300060353 Bacteria 4110
677 Ga0530510_0073584 3300061734 Bacteria 2480

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003775 Ga0055524_1000038 Ga0055524_100003885 458
2 iso_pu_bacteria 8019597564 8019599016 458
3 3300036712 Ga0316584_0127739 Ga0316584_0127739_98_1543 461
4 3300026089 Ga0207648_10017375 Ga0207648_100173758 464
5 3300031250 Ga0265331_10000407 Ga0265331_1000040734 464
6 3300037418 Ga0395900_0014312 Ga0395900_0014312_650_2089 464
7 3300053119 Ga0500595_005315 Ga0500595_005315_2680_4119 464
8 3300053121 Ga0500607_069886 Ga0500607_069886_227_1675 464
9 3300037471 Ga0395905_0182990 Ga0395905_0182990_61_1512 465
10 3300005331 Ga0070670_100002673 Ga0070670_10000267311 467
11 3300005354 Ga0070675_100003762 Ga0070675_10000376211 467
12 3300005618 Ga0068864_100001909 Ga0068864_10000190914 467
13 3300005841 Ga0068863_100003624 Ga0068863_1000036247 467
14 3300026088 Ga0207641_10003573 Ga0207641_1000357313 467
15 3300026095 Ga0207676_10001593 Ga0207676_100015939 467
16 3300025940 Ga0207691_10008219 Ga0207691_100082195 468
17 3300037068 Ga0373925_0116431 Ga0373925_0116431_295_1746 468
18 iso_pu_bacteria 2883291878 2883292559 468
19 iso_pu_bacteria 2922130491 2922135954 468
20 3300021361 Ga0213872_10006039 Ga0213872_100060392 469
21 3300039447 Ga0436361_1111514 Ga0436361_1111514_9346_10785 469
22 3300005445 Ga0070708_100001167 Ga0070708_10000116720 470
23 3300005548 Ga0070665_100075497 Ga0070665_1000754972 470
24 3300025941 Ga0207711_10044496 Ga0207711_100444965 470
25 3300021361 Ga0213872_10000842 Ga0213872_100008424 471
26 3300021361 Ga0213872_10000876 Ga0213872_100008766 471
27 3300021361 Ga0213872_10051771 Ga0213872_100517711 471
28 3300039447 Ga0436361_0034567 Ga0436361_0034567_22494_23939 471
29 3300039438 Ga0436360_0172898 Ga0436360_0172898_2741_4201 472
30 iso_pu_bacteria 2513237103 2513714395 472
31 iso_pu_bacteria 2960693952 2960696484 472
32 3300005339 Ga0070660_100080017 Ga0070660_1000800173 473
33 3300013104 Ga0157370_10053116 Ga0157370_100531164 473
34 3300013307 Ga0157372_10310389 Ga0157372_103103891 473
35 3300025919 Ga0207657_10009446 Ga0207657_100094462 473
36 3300049577 Ga0501041_0056358 Ga0501041_0056358_809_2266 474
37 3300049582 Ga0501048_0032878 Ga0501048_0032878_1054_2511 474
38 3300049587 Ga0501071_0018169 Ga0501071_0018169_2726_4183 474
39 3300049591 Ga0501075_0036168 Ga0501075_0036168_240_1697 474
40 3300049593 Ga0501077_0018628 Ga0501077_0018628_1603_3060 474
41 3300049743 Ga0501081_0124080 Ga0501081_0124080_143_1600 474
42 3300054114 Ga0501084_0046920 Ga0501084_0046920_1328_2785 474
43 3300060353 Ga0501082_0038754 Ga0501082_0038754_1408_2865 474
44 3300061734 Ga0530510_0073584 Ga0530510_0073584_900_2357 474
45 3300005335 Ga0070666_10079009 Ga0070666_100790092 475
46 3300005334 Ga0068869_100000492 Ga0068869_10000049213 476
47 3300005336 Ga0070680_100076925 Ga0070680_1000769254 476
48 3300005548 Ga0070665_100028940 Ga0070665_1000289403 476
49 3300005840 Ga0068870_10069615 Ga0068870_100696151 476
50 3300005842 Ga0068858_100019496 Ga0068858_1000194963 476
51 3300005843 Ga0068860_100073083 Ga0068860_1000730832 476
52 3300005844 Ga0068862_100140492 Ga0068862_1001404922 476
53 3300006237 Ga0097621_100003378 Ga0097621_1000033786 476
54 3300006358 Ga0068871_100084964 Ga0068871_1000849642 476
55 3300009098 Ga0105245_10040363 Ga0105245_100403634 476
56 3300009177 Ga0105248_10005948 Ga0105248_1000594810 476
57 3300013308 Ga0157375_10005919 Ga0157375_1000591910 476
58 3300014969 Ga0157376_10003300 Ga0157376_100033007 476
59 3300025938 Ga0207704_10036911 Ga0207704_100369114 476
60 3300025941 Ga0207711_10024546 Ga0207711_100245463 476
61 3300025942 Ga0207689_10000320 Ga0207689_1000032022 476
62 3300026035 Ga0207703_10128630 Ga0207703_101286301 476
63 3300027876 Ga0209974_10000461 Ga0209974_1000046114 476
64 3300005339 Ga0070660_100000581 Ga0070660_1000005813 478
65 3300005344 Ga0070661_100005599 Ga0070661_1000055995 478
66 3300005355 Ga0070671_100002453 Ga0070671_1000024534 478
67 3300005364 Ga0070673_100013295 Ga0070673_1000132956 478
68 3300005366 Ga0070659_100001886 Ga0070659_1000018863 478
69 3300005457 Ga0070662_100000078 Ga0070662_10000007838 478
70 3300005563 Ga0068855_100004942 Ga0068855_1000049425 478
71 3300005564 Ga0070664_100009168 Ga0070664_1000091682 478
72 3300005578 Ga0068854_100135501 Ga0068854_1001355013 478
73 3300005614 Ga0068856_100009851 Ga0068856_10000985111 478
74 3300013100 Ga0157373_10001248 Ga0157373_1000124826 478
75 3300013307 Ga0157372_10000380 Ga0157372_1000038019 478
76 3300025919 Ga0207657_10000411 Ga0207657_1000041119 478
77 3300025920 Ga0207649_10021387 Ga0207649_100213873 478
78 3300025926 Ga0207659_10008529 Ga0207659_100085296 478
79 3300025931 Ga0207644_10004497 Ga0207644_1000449710 478
80 3300025932 Ga0207690_10001598 Ga0207690_100015983 478
81 3300025933 Ga0207706_10000008 Ga0207706_10000008167 478
82 3300025945 Ga0207679_10007633 Ga0207679_100076338 478
83 3300025949 Ga0207667_10002837 Ga0207667_100028373 478
84 3300026041 Ga0207639_10004141 Ga0207639_100041419 478
85 3300026067 Ga0207678_10010235 Ga0207678_100102352 478
86 3300026078 Ga0207702_10003563 Ga0207702_100035634 478
87 3300027876 Ga0209974_10029771 Ga0209974_100297712 478
88 3300045051 Ga0451576_0000030 Ga0451576_0000030_213372_214838 478
89 3300045051 Ga0451576_0090232 Ga0451576_0090232_99_1580 478
90 3300046522 Ga0495643_0026083 Ga0495643_0026083_25_1500 479
91 3300050509 nmdc:mga0qj67_24755_c1 nmdc:mga0qj67_24755_c1_388_1860 479
92 3300005290 Ga0065712_10077285 Ga0065712_100772853 481
93 3300005328 Ga0070676_10002350 Ga0070676_100023506 481
94 3300005330 Ga0070690_100006640 Ga0070690_1000066403 481
95 3300005333 Ga0070677_10011502 Ga0070677_100115024 481
96 3300005334 Ga0068869_100011811 Ga0068869_1000118116 481
97 3300005347 Ga0070668_100119687 Ga0070668_1001196873 481
98 3300005353 Ga0070669_100012646 Ga0070669_1000126463 481
99 3300005354 Ga0070675_100043868 Ga0070675_1000438682 481
100 3300005364 Ga0070673_100006904 Ga0070673_1000069043 481
101 3300005365 Ga0070688_100004092 Ga0070688_1000040927 481
102 3300005438 Ga0070701_10012016 Ga0070701_100120163 481
103 3300005459 Ga0068867_100037937 Ga0068867_1000379374 481
104 3300005466 Ga0070685_10004485 Ga0070685_100044857 481
105 3300005539 Ga0068853_100027833 Ga0068853_1000278333 481
106 3300005543 Ga0070672_100029364 Ga0070672_1000293643 481
107 3300005548 Ga0070665_100013687 Ga0070665_1000136878 481
108 3300005577 Ga0068857_100018857 Ga0068857_1000188576 481
109 3300005616 Ga0068852_100002270 Ga0068852_1000022708 481
110 3300005617 Ga0068859_100021839 Ga0068859_1000218394 481
111 3300005618 Ga0068864_100019221 Ga0068864_1000192216 481
112 3300005840 Ga0068870_10003032 Ga0068870_100030328 481
113 3300005842 Ga0068858_100006571 Ga0068858_1000065714 481
114 3300005843 Ga0068860_100063837 Ga0068860_1000638371 481
115 3300006237 Ga0097621_100039906 Ga0097621_1000399063 481
116 3300006358 Ga0068871_100006581 Ga0068871_1000065815 481
117 3300006931 Ga0097620_100021839 Ga0097620_1000218394 481
118 3300013105 Ga0157369_10117510 Ga0157369_101175101 481
119 3300013296 Ga0157374_10005259 Ga0157374_100052594 481
120 3300014325 Ga0163163_10100720 Ga0163163_101007202 481
121 3300014326 Ga0157380_10153231 Ga0157380_101532313 481
122 3300014968 Ga0157379_10035140 Ga0157379_100351405 481
123 3300025315 Ga0207697_10001788 Ga0207697_1000178810 481
124 3300025893 Ga0207682_10001492 Ga0207682_100014924 481
125 3300025901 Ga0207688_10028868 Ga0207688_100288684 481
126 3300025908 Ga0207643_10002157 Ga0207643_1000215710 481
127 3300025925 Ga0207650_10060896 Ga0207650_100608961 481
128 3300025926 Ga0207659_10004068 Ga0207659_100040688 481
129 3300025933 Ga0207706_10007150 Ga0207706_100071509 481
130 3300025940 Ga0207691_10017270 Ga0207691_100172704 481
131 3300025945 Ga0207679_10108454 Ga0207679_101084541 481
132 3300025949 Ga0207667_10033936 Ga0207667_100339363 481
133 3300025981 Ga0207640_10018413 Ga0207640_100184133 481
134 3300026041 Ga0207639_10016645 Ga0207639_100166454 481
135 3300026075 Ga0207708_10027763 Ga0207708_100277632 481
136 3300026088 Ga0207641_10089695 Ga0207641_100896953 481
137 3300026089 Ga0207648_10021177 Ga0207648_100211774 481
138 3300026095 Ga0207676_10005802 Ga0207676_100058025 481
139 3300026116 Ga0207674_10025066 Ga0207674_100250668 481
140 3300026118 Ga0207675_100016625 Ga0207675_1000166258 481
141 3300036401 Ga0373937_0134922 Ga0373937_0134922_251_1744 481
142 3300048911 Ga0496108_0008916 Ga0496108_0008916_3871_5364 481
143 3300048913 Ga0496110_0004898 Ga0496110_0004898_141_1634 481
144 3300045976 Ga0466967_0129519 Ga0466967_0129519_302_1789 482
145 3300036712 Ga0316584_0012532 Ga0316584_0012532_2964_4451 483
146 iso_pu_bacteria 2842333319 2842338371 483
147 3300048922 Ga0496119_0030059 Ga0496119_0030059_220_1707 484
148 3300039437 Ga0436365_1306047 Ga0436365_1306047_22970_24472 489
149 iso_pu_bacteria 2513237305 2514423330 489
150 iso_pu_bacteria 2970136068 2970140363 489
151 iso_pu_bacteria 2844002411 2844006589 490
152 iso_pu_bacteria 2871466892 2871469906 490
153 iso_pu_bacteria 2924710171 2924715103 490
154 3300025941 Ga0207711_10186484 Ga0207711_101864841 501
155 3300049571 Ga0501034_0263072 Ga0501034_0263072_89_1648 508
156 3300049688 Ga0501259_001664 Ga0501259_001664_32_1612 508
157 3300031995 Ga0307409_100030858 Ga0307409_1000308582 509
158 3300006846 Ga0075430_100003721 Ga0075430_1000037215 510
159 3300031824 Ga0307413_10001785 Ga0307413_100017859 511
160 3300031852 Ga0307410_10002237 Ga0307410_1000223711 511
161 3300031903 Ga0307407_10008356 Ga0307407_100083563 511
162 iso_pu_bacteria 2899275550 2899279376 511
163 3300005618 Ga0068864_100028820 Ga0068864_1000288203 513
164 3300046660 Ga0495625_0000223 Ga0495625_0000223_49128_50834 513
165 3300025931 Ga0207644_10005466 Ga0207644_100054665 514
166 3300026095 Ga0207676_10001380 Ga0207676_1000138019 514
167 3300045051 Ga0451576_0002914 Ga0451576_0002914_13063_14661 515
168 3300046660 Ga0495625_0030398 Ga0495625_0030398_1975_3636 515
169 3300049569 Ga0501032_0000520 Ga0501032_0000520_24585_26225 515
170 3300049570 Ga0501033_0002279 Ga0501033_0002279_2840_4480 515
171 3300049571 Ga0501034_0002321 Ga0501034_0002321_16552_18192 515
172 3300049572 Ga0501036_0000152 Ga0501036_0000152_5748_7388 515
173 3300049573 Ga0501037_0000029 Ga0501037_0000029_96101_97741 515
174 3300049574 Ga0501038_0000263 Ga0501038_0000263_24457_26097 515
175 3300049575 Ga0501039_0000043 Ga0501039_0000043_96089_97729 515
176 3300049579 Ga0501043_0000260 Ga0501043_0000260_11322_12962 515
177 3300049822 Ga0501035_0000057 Ga0501035_0000057_96081_97721 515
178 3300050509 nmdc:mga0qj67_3082_c1 nmdc:mga0qj67_3082_c1_2989_4683 515
179 3300053087 Ga0500643_004215 Ga0500643_004215_3633_5294 515
180 3300053104 Ga0500556_0000031 Ga0500556_0000031_96981_98642 515
181 iso_pu_bacteria 2855020534 2855023013 515
182 iso_pu_bacteria 2919679072 2919679229 515
183 3300039062 Ga0400483_083742 Ga0400483_083742_811_2415 516
184 3300039062 Ga0400483_165238 Ga0400483_165238_569_2173 516
185 3300039062 Ga0400483_211635 Ga0400483_211635_437_2041 516
186 iso_pu_bacteria 2840878972 2840881430 516
187 3300009093 Ga0105240_10008082 Ga0105240_100080825 517
188 3300010375 Ga0105239_10114605 Ga0105239_101146052 517
189 3300005327 Ga0070658_10005829 Ga0070658_100058298 518
190 3300005335 Ga0070666_10056526 Ga0070666_100565262 518
191 3300005339 Ga0070660_100009163 Ga0070660_1000091634 518
192 3300005366 Ga0070659_100003357 Ga0070659_1000033576 518
193 3300005577 Ga0068857_100007911 Ga0068857_1000079116 518
194 3300010375 Ga0105239_10006936 Ga0105239_1000693612 518
195 3300025913 Ga0207695_10022001 Ga0207695_100220014 518
196 3300025919 Ga0207657_10009801 Ga0207657_100098016 518
197 iso_pu_bacteria 2834578030 2834579506 518
198 3300003775 Ga0055524_1000221 Ga0055524_10002214 519
199 3300025263 Ga0209565_1000010 Ga0209565_10000102 519
200 3300025299 Ga0209256_1000012 Ga0209256_1000012145 519
201 iso_pu_bacteria 2713897090 2715498869 519
202 3300005338 Ga0068868_100127800 Ga0068868_1001278002 520
203 3300025231 Ga0207427_104089 Ga0207427_1040892 521
204 3300025261 Ga0209233_1000713 Ga0209233_100071317 521
205 3300031251 Ga0265327_10000772 Ga0265327_100007729 521
206 3300005331 Ga0070670_100041478 Ga0070670_1000414783 522
207 3300005347 Ga0070668_100018696 Ga0070668_1000186962 522
208 3300005353 Ga0070669_100001184 Ga0070669_10000118410 522
209 3300005355 Ga0070671_100007531 Ga0070671_1000075319 522
210 3300005548 Ga0070665_100000129 Ga0070665_10000012986 522
211 3300005548 Ga0070665_100000169 Ga0070665_10000016953 522
212 3300005841 Ga0068863_100025902 Ga0068863_1000259024 522
213 3300009011 Ga0105251_10003202 Ga0105251_100032027 522
214 3300025735 Ga0207713_1001813 Ga0207713_100181310 522
215 3300025923 Ga0207681_10001199 Ga0207681_100011997 522
216 3300025931 Ga0207644_10000519 Ga0207644_1000051911 522
217 3300026088 Ga0207641_10005539 Ga0207641_100055397 522
218 3300027876 Ga0209974_10025420 Ga0209974_100254201 522
219 3300028379 Ga0268266_10000019 Ga0268266_10000019409 522
220 3300028379 Ga0268266_10003322 Ga0268266_100033222 522
221 3300028381 Ga0268264_10015699 Ga0268264_100156992 522
222 3300048919 Ga0496116_0036219 Ga0496116_0036219_855_2510 522
223 3300048921 Ga0496118_0049609 Ga0496118_0049609_288_1943 522
224 3300048924 Ga0496121_0034147 Ga0496121_0034147_1989_3644 522
225 3300048928 Ga0496125_0012254 Ga0496125_0012254_5767_7422 522
226 3300049571 Ga0501034_0142595 Ga0501034_0142595_537_2141 522
227 3300049571 Ga0501034_0153285 Ga0501034_0153285_382_1986 522
228 3300053094 Ga0500566_0004023 Ga0500566_0004023_274_1980 522
229 3300053139 Ga0500568_0000312 Ga0500568_0000312_30700_32367 522
230 3300053151 Ga0500604_0000009 Ga0500604_0000009_110372_112039 522
231 3300053153 Ga0500616_0000119 Ga0500616_0000119_59010_60677 522
232 3300003791 Ga0055530_10004799 Ga0055530_100047991 523
233 3300025292 Ga0209676_1000311 Ga0209676_100031153 523
234 3300025298 Ga0209050_1000375 Ga0209050_100037553 523
235 3300025303 Ga0209051_1000966 Ga0209051_100096614 523
236 3300025304 Ga0209257_1010140 Ga0209257_10101401 523
237 3300053136 Ga0500559_0000006 Ga0500559_0000006_84357_86015 523
238 3300002459 JGI24751J29686_10000202 JGI24751J29686_100002023 524
239 3300005331 Ga0070670_100000339 Ga0070670_10000033927 524
240 3300005367 Ga0070667_100000390 Ga0070667_10000039025 525
241 3300005841 Ga0068863_100001079 Ga0068863_1000010798 525
242 3300025913 Ga0207695_10001391 Ga0207695_1000139139 525
243 3300025931 Ga0207644_10019920 Ga0207644_100199202 525
244 3300025986 Ga0207658_10001286 Ga0207658_1000128614 525
245 3300026088 Ga0207641_10014944 Ga0207641_100149446 525
246 3300048924 Ga0496121_0000274 Ga0496121_0000274_64532_66181 526
247 iso_pu_bacteria 2919138771 2919139459 526
248 iso_pu_bacteria 2960624210 2960626118 526
249 3300005548 Ga0070665_100006197 Ga0070665_1000061975 527
250 3300025941 Ga0207711_10036124 Ga0207711_100361245 527
251 3300025986 Ga0207658_10067791 Ga0207658_100677912 527
252 3300049571 Ga0501034_0029689 Ga0501034_0029689_2321_3961 527
253 3300049571 Ga0501034_0007640 Ga0501034_0007640_2698_4353 528
254 3300050489 nmdc:mga03683_8140_c1 nmdc:mga03683_8140_c1_181_1797 528
255 iso_pu_bacteria 8005695170 8005699763 528
256 3300005295 Ga0065707_10097586 Ga0065707_100975862 529
257 3300005353 Ga0070669_100000345 Ga0070669_10000034518 529
258 3300005367 Ga0070667_100016634 Ga0070667_1000166347 529
259 3300014326 Ga0157380_10003365 Ga0157380_100033658 529
260 3300025923 Ga0207681_10000086 Ga0207681_1000008665 529
261 3300025925 Ga0207650_10000008 Ga0207650_10000008434 529
262 3300026095 Ga0207676_10000264 Ga0207676_1000026430 529
263 3300053087 Ga0500643_000637 Ga0500643_000637_8040_9785 529
264 3300005843 Ga0068860_100000023 Ga0068860_100000023215 530
265 3300046522 Ga0495643_0022274 Ga0495643_0022274_538_2244 530
266 3300046542 Ga0495597_0005777 Ga0495597_0005777_3116_4822 530
267 3300049670 Ga0501236_000422 Ga0501236_000422_406_2082 530
268 3300053093 Ga0500651_0004436 Ga0500651_0004436_5115_6821 530
269 3300053096 Ga0500641_0007464 Ga0500641_0007464_2064_3770 530
270 3300053125 Ga0500618_003126 Ga0500618_003126_3949_5655 530
271 3300053130 Ga0500642_0003588 Ga0500642_0003588_2468_4174 530
272 3300053133 Ga0500655_000039 Ga0500655_000039_34933_36639 530
273 3300053148 Ga0500590_023710 Ga0500590_023710_905_2611 530
274 3300053156 Ga0500622_0002897 Ga0500622_0002897_2910_4616 530
275 3300053724 Ga0500570_000154 Ga0500570_000154_15739_17445 530
276 iso_pu_bacteria 2558860983 2561466568 530
277 iso_pu_bacteria 2739367664 2739650328 530
278 iso_pu_bacteria 2739367865 2740028801 530
279 3300005578 Ga0068854_100000255 Ga0068854_10000025535 531
280 3300005616 Ga0068852_100000208 Ga0068852_10000020822 531
281 3300025981 Ga0207640_10002020 Ga0207640_100020205 531
282 3300026142 Ga0207698_10000119 Ga0207698_1000011922 531
283 3300005843 Ga0068860_100039245 Ga0068860_1000392452 532
284 3300013105 Ga0157369_10013128 Ga0157369_100131287 532
285 3300026041 Ga0207639_10033804 Ga0207639_100338042 532
286 3300005548 Ga0070665_100031714 Ga0070665_1000317142 533
287 3300005618 Ga0068864_100002699 Ga0068864_1000026997 533
288 3300005841 Ga0068863_100000081 Ga0068863_10000008156 533
289 3300005841 Ga0068863_100013152 Ga0068863_1000131526 533
290 3300005842 Ga0068858_100002847 Ga0068858_10000284721 533
291 3300005843 Ga0068860_100000108 Ga0068860_100000108109 533
292 3300026035 Ga0207703_10004419 Ga0207703_100044193 533
293 3300026088 Ga0207641_10000182 Ga0207641_1000018258 533
294 3300026088 Ga0207641_10006378 Ga0207641_100063782 533
295 3300026095 Ga0207676_10000760 Ga0207676_1000076024 533
296 3300028379 Ga0268266_10018632 Ga0268266_100186323 533
297 3300028381 Ga0268264_10000126 Ga0268264_10000126109 533
298 3300028381 Ga0268264_10008585 Ga0268264_100085857 533
299 iso_pu_bacteria 2852653556 2852656900 533
300 3300005842 Ga0068858_100000506 Ga0068858_10000050619 534
301 3300009177 Ga0105248_10058733 Ga0105248_100587333 534
302 3300025920 Ga0207649_10026496 Ga0207649_100264964 534
303 3300026035 Ga0207703_10007127 Ga0207703_100071275 534
304 3300048908 Ga0496105_0000817 Ga0496105_0000817_8769_10418 534
305 3300048917 Ga0496114_0013350 Ga0496114_0013350_2604_4286 534
306 3300048929 Ga0496126_0002202 Ga0496126_0002202_16065_17747 534
307 3300005329 Ga0070683_100033052 Ga0070683_1000330524 535
308 3300005344 Ga0070661_100001045 Ga0070661_1000010458 535
309 3300005366 Ga0070659_100028147 Ga0070659_1000281471 535
310 3300005457 Ga0070662_100000100 Ga0070662_10000010032 535
311 3300005458 Ga0070681_10004190 Ga0070681_1000419012 535
312 3300005539 Ga0068853_100005601 Ga0068853_1000056012 535
313 3300005563 Ga0068855_100010294 Ga0068855_1000102941 535
314 3300005614 Ga0068856_100040766 Ga0068856_1000407664 535
315 3300013100 Ga0157373_10018150 Ga0157373_100181505 535
316 3300013102 Ga0157371_10000519 Ga0157371_1000051919 535
317 3300013105 Ga0157369_10000446 Ga0157369_1000044632 535
318 3300013307 Ga0157372_10001430 Ga0157372_1000143025 535
319 3300025912 Ga0207707_10053011 Ga0207707_100530112 535
320 3300025917 Ga0207660_10087790 Ga0207660_100877902 535
321 3300025919 Ga0207657_10000420 Ga0207657_1000042030 535
322 3300025920 Ga0207649_10002157 Ga0207649_100021577 535
323 3300025932 Ga0207690_10000043 Ga0207690_1000004336 535
324 3300025933 Ga0207706_10000468 Ga0207706_1000046846 535
325 3300025945 Ga0207679_10011729 Ga0207679_100117295 535
326 3300025949 Ga0207667_10016198 Ga0207667_100161987 535
327 3300026041 Ga0207639_10000148 Ga0207639_1000014816 535
328 3300026116 Ga0207674_10039815 Ga0207674_100398153 535
329 3300048913 Ga0496110_0023687 Ga0496110_0023687_1211_2869 535
330 3300009177 Ga0105248_10008636 Ga0105248_1000863610 536
331 3300025945 Ga0207679_10035026 Ga0207679_100350264 536
332 3300031852 Ga0307410_10017409 Ga0307410_100174093 536
333 3300031911 Ga0307412_10048275 Ga0307412_100482753 536
334 3300032002 Ga0307416_100205399 Ga0307416_1002053991 536
335 3300050509 nmdc:mga0qj67_107065_c1 nmdc:mga0qj67_107065_c1_149_1822 536
336 3300053122 Ga0500608_000988 Ga0500608_000988_1029_2681 536
337 3300053729 Ga0500625_000030 Ga0500625_000030_42837_44489 536
338 iso_pu_bacteria 2896429255 2896431480 536
339 iso_pu_bacteria 8054302542 8054306667 536
340 3300001904 JGI24736J21556_1005870 JGI24736J21556_10058702 537
341 3300001989 JGI24739J22299_10026015 JGI24739J22299_100260152 537
342 3300006051 Ga0075364_10010857 Ga0075364_100108575 537
343 3300006177 Ga0075362_10000015 Ga0075362_1000001568 537
344 3300006186 Ga0075369_10000186 Ga0075369_100001867 537
345 3300006195 Ga0075366_10000153 Ga0075366_100001539 537
346 3300025904 Ga0207647_10002484 Ga0207647_1000248413 537
347 3300048920 Ga0496117_0001317 Ga0496117_0001317_4972_6615 537
348 3300048921 Ga0496118_0000122 Ga0496118_0000122_33133_34776 537
349 3300050489 nmdc:mga03683_35_c1 nmdc:mga03683_35_c1_53456_55114 537
350 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_252762_254420 537
351 3300050516 nmdc:mga0sz30_261_c1 nmdc:mga0sz30_261_c1_18166_19824 537
352 iso_pu_bacteria 2643221563 2643832618 537
353 iso_pu_bacteria 2643221608 2644053587 537
354 3300005327 Ga0070658_10002177 Ga0070658_1000217713 538
355 3300005339 Ga0070660_100005066 Ga0070660_1000050669 538
356 3300005366 Ga0070659_100093282 Ga0070659_1000932821 538
357 3300025919 Ga0207657_10002193 Ga0207657_1000219325 538
358 3300025921 Ga0207652_10006580 Ga0207652_100065804 538
359 3300025932 Ga0207690_10019935 Ga0207690_100199352 538
360 3300026067 Ga0207678_10038771 Ga0207678_100387715 538
361 3300033180 Ga0307510_10000248 Ga0307510_1000024849 538
362 3300045051 Ga0451576_0119414 Ga0451576_0119414_307_1950 538
363 iso_pu_bacteria 2582581305 2585263413 538
364 iso_pu_bacteria 2643221560 2643821626 538
365 iso_pu_bacteria 2643221588 2643950587 538
366 iso_pu_bacteria 2643221605 2644039718 538
367 iso_pu_bacteria 2775507255 2778126910 538
368 iso_pu_bacteria 2895880812 2895881281 538
369 iso_pu_bacteria 2919709256 2919709549 538
370 3300005327 Ga0070658_10001136 Ga0070658_1000113621 539
371 3300005618 Ga0068864_100000233 Ga0068864_10000023329 539
372 3300005842 Ga0068858_100001600 Ga0068858_10000160021 539
373 3300009551 Ga0105238_10033163 Ga0105238_100331634 539
374 3300013306 Ga0163162_10005912 Ga0163162_100059127 539
375 3300025909 Ga0207705_10000037 Ga0207705_10000037176 539
376 3300025924 Ga0207694_10061446 Ga0207694_100614464 539
377 3300026035 Ga0207703_10000409 Ga0207703_1000040931 539
378 3300026095 Ga0207676_10000150 Ga0207676_1000015043 539
379 3300047472 Ga0495686_0002043 Ga0495686_0002043_17661_19328 539
380 3300002459 JGI24751J29686_10001546 JGI24751J29686_100015465 540
381 3300005347 Ga0070668_100015604 Ga0070668_1000156042 540
382 3300005355 Ga0070671_100000007 Ga0070671_10000000717 540
383 3300005367 Ga0070667_100050679 Ga0070667_1000506792 540
384 3300005617 Ga0068859_100001637 Ga0068859_10000163722 540
385 3300005618 Ga0068864_100009652 Ga0068864_1000096527 540
386 3300005719 Ga0068861_100003970 Ga0068861_10000397013 540
387 3300005841 Ga0068863_100001536 Ga0068863_10000153614 540
388 3300005843 Ga0068860_100025709 Ga0068860_1000257092 540
389 3300005844 Ga0068862_100000288 Ga0068862_10000028840 540
390 3300006931 Ga0097620_100001637 Ga0097620_10000163722 540
391 3300009177 Ga0105248_10041655 Ga0105248_100416551 540
392 3300009553 Ga0105249_10070001 Ga0105249_100700012 540
393 3300014968 Ga0157379_10007542 Ga0157379_100075428 540
394 3300025931 Ga0207644_10000002 Ga0207644_10000002692 540
395 3300025972 Ga0207668_10000477 Ga0207668_100004779 540
396 3300026035 Ga0207703_10008781 Ga0207703_100087815 540
397 3300026088 Ga0207641_10001652 Ga0207641_1000165217 540
398 3300026095 Ga0207676_10003418 Ga0207676_100034184 540
399 3300026118 Ga0207675_100000294 Ga0207675_10000029451 540
400 3300028380 Ga0268265_10000049 Ga0268265_1000004918 540
401 3300028381 Ga0268264_10000071 Ga0268264_10000071230 540
402 3300031824 Ga0307413_10031204 Ga0307413_100312042 540
403 3300046500 Ga0495596_0001207 Ga0495596_0001207_12134_13777 540
404 3300046506 Ga0495583_0005996 Ga0495583_0005996_4116_5759 540
405 3300048090 Ga0495615_0000272 Ga0495615_0000272_7852_9495 540
406 3300048926 Ga0496123_0001685 Ga0496123_0001685_20598_22256 540
407 3300053119 Ga0500595_005197 Ga0500595_005197_3746_5401 540
408 iso_pu_bacteria 2643221541 2643729526 540
409 iso_pu_bacteria 2643221606 2644043883 540
410 iso_pu_bacteria 2643221671 2644392354 540
411 iso_pu_bacteria 2738541275 2738710968 540
412 iso_pu_bacteria 2738541301 2738849393 540
413 iso_pu_bacteria 2738541304 2738865122 540
414 iso_pu_bacteria 2738543022 2739297640 540
415 iso_pu_bacteria 2738543033 2739359318 540
416 iso_pu_bacteria 2896184354 2896185837 540
417 iso_pu_bacteria 2928100450 2928101076 540
418 iso_pu_bacteria 2928959182 2928960514 540
419 3300003791 Ga0055530_10000518 Ga0055530_1000051826 541
420 3300003794 Ga0055531_10016199 Ga0055531_100161992 541
421 3300005295 Ga0065707_10085887 Ga0065707_100858875 541
422 3300005356 Ga0070674_100034190 Ga0070674_1000341904 541
423 3300005364 Ga0070673_100033483 Ga0070673_1000334834 541
424 3300005456 Ga0070678_100028584 Ga0070678_1000285842 541
425 3300005548 Ga0070665_100019755 Ga0070665_1000197552 541
426 3300005843 Ga0068860_100005575 Ga0068860_1000055757 541
427 3300009093 Ga0105240_10004622 Ga0105240_100046225 541
428 3300009101 Ga0105247_10007289 Ga0105247_100072894 541
429 3300009553 Ga0105249_10000053 Ga0105249_100000538 541
430 3300014326 Ga0157380_10009984 Ga0157380_100099847 541
431 3300017792 Ga0163161_10071667 Ga0163161_100716672 541
432 3300025292 Ga0209676_1000132 Ga0209676_1000132141 541
433 3300025292 Ga0209676_1000155 Ga0209676_1000155106 541
434 3300025298 Ga0209050_1000139 Ga0209050_1000139142 541
435 3300025304 Ga0209257_1000164 Ga0209257_100016444 541
436 3300025900 Ga0207710_10003665 Ga0207710_100036657 541
437 3300025941 Ga0207711_10014352 Ga0207711_100143522 541
438 3300025961 Ga0207712_10000045 Ga0207712_10000045166 541
439 3300025972 Ga0207668_10003827 Ga0207668_100038277 541
440 3300026088 Ga0207641_10001052 Ga0207641_100010524 541
441 3300026089 Ga0207648_10047574 Ga0207648_100475742 541
442 3300028379 Ga0268266_10009483 Ga0268266_100094837 541
443 3300028381 Ga0268264_10007232 Ga0268264_100072327 541
444 3300031616 Ga0307508_10007169 Ga0307508_1000716910 541
445 3300032004 Ga0307414_10000068 Ga0307414_100000682 541
446 3300032005 Ga0307411_10034443 Ga0307411_100344433 541
447 3300038705 Ga0237819_00251 Ga0237819_00251_13843_15510 541
448 3300046453 Ga0495627_000110 Ga0495627_000110_8784_10436 541
449 3300046460 Ga0495638_0000073 Ga0495638_0000073_55489_57147 541
450 3300046506 Ga0495583_0000087 Ga0495583_0000087_55482_57140 541
451 3300046512 Ga0495610_0000303 Ga0495610_0000303_7024_8670 541
452 3300046519 Ga0495632_0000271 Ga0495632_0000271_47894_49555 541
453 3300046519 Ga0495632_0001911 Ga0495632_0001911_3401_5059 541
454 3300046520 Ga0495637_0000124 Ga0495637_0000124_40094_41749 541
455 3300046522 Ga0495643_0000031 Ga0495643_0000031_208274_209929 541
456 3300046522 Ga0495643_0000341 Ga0495643_0000341_48889_50535 541
457 3300046524 Ga0495648_0000049 Ga0495648_0000049_55489_57147 541
458 3300046524 Ga0495648_0004359 Ga0495648_0004359_2088_3740 541
459 3300046525 Ga0495663_0000057 Ga0495663_0000057_1780_3441 541
460 3300046538 Ga0495609_0004437 Ga0495609_0004437_4678_6324 541
461 3300046558 Ga0495633_0003341 Ga0495633_0003341_7332_8993 541
462 3300046660 Ga0495625_0027078 Ga0495625_0027078_1239_2885 541
463 3300046692 Ga0495671_0000021 Ga0495671_0000021_47892_49547 541
464 3300046692 Ga0495671_0000042 Ga0495671_0000042_55709_57367 541
465 3300047469 Ga0495673_0000111 Ga0495673_0000111_107835_109493 541
466 3300047469 Ga0495673_0029254 Ga0495673_0029254_340_2052 541
467 3300047470 Ga0495681_0023806 Ga0495681_0023806_1354_3009 541
468 3300048925 Ga0496122_0001014 Ga0496122_0001014_13450_15114 541
469 3300048926 Ga0496123_0000212 Ga0496123_0000212_76934_78598 541
470 3300049520 Ga0501297_000522 Ga0501297_000522_408_2117 541
471 3300049524 Ga0501301_000368 Ga0501301_000368_447_2156 541
472 3300049569 Ga0501032_0018313 Ga0501032_0018313_3196_4854 541
473 3300049573 Ga0501037_0018342 Ga0501037_0018342_721_2379 541
474 3300049663 Ga0501223_000124 Ga0501223_000124_16665_18323 541
475 3300049664 Ga0501224_000003 Ga0501224_000003_26900_28558 541
476 3300049664 Ga0501224_000724 Ga0501224_000724_1223_2932 541
477 3300049665 Ga0501227_001028 Ga0501227_001028_1693_3402 541
478 3300049668 Ga0501233_001151 Ga0501233_001151_1099_2808 541
479 3300049668 Ga0501233_001401 Ga0501233_001401_799_2457 541
480 3300049669 Ga0501235_000862 Ga0501235_000862_1283_2992 541
481 3300049686 Ga0501257_002742 Ga0501257_002742_569_2278 541
482 3300049690 Ga0501261_000053 Ga0501261_000053_18002_19711 541
483 3300049705 Ga0501225_0000001 Ga0501225_0000001_160488_162146 541
484 3300049707 Ga0501234_000627 Ga0501234_000627_1036_2694 541
485 3300049708 Ga0501245_000181 Ga0501245_000181_604_2313 541
486 3300049775 Ga0501279_000005 Ga0501279_000005_124731_126440 541
487 3300049776 Ga0501280_000012 Ga0501280_000012_49270_50979 541
488 3300049777 Ga0501281_00005 Ga0501281_00005_27422_29131 541
489 3300049778 Ga0501282_000420 Ga0501282_000420_556_2265 541
490 3300049779 Ga0501283_000558 Ga0501283_000558_1497_3206 541
491 3300049822 Ga0501035_0048671 Ga0501035_0048671_1983_3641 541
492 3300049853 Ga0501226_000013 Ga0501226_000013_13081_14739 541
493 3300053158 Ga0500627_0000020 Ga0500627_0000020_51328_52986 541
494 iso_pu_bacteria 2808606401 2809064717 541
495 iso_pu_bacteria 2808606404 2809080614 541
496 iso_pu_bacteria 2808606405 2809084979 541
497 iso_pu_bacteria 2880518877 2880519611 541
498 3300001904 JGI24736J21556_1000172 JGI24736J21556_10001725 542
499 3300001904 JGI24736J21556_1000319 JGI24736J21556_10003197 542
500 3300001915 JGI24741J21665_1000143 JGI24741J21665_10001438 542
501 3300001979 JGI24740J21852_10001914 JGI24740J21852_100019149 542
502 3300001979 JGI24740J21852_10004740 JGI24740J21852_100047405 542
503 3300001989 JGI24739J22299_10001814 JGI24739J22299_100018145 542
504 3300001989 JGI24739J22299_10003317 JGI24739J22299_100033173 542
505 3300001989 JGI24739J22299_10004003 JGI24739J22299_100040035 542
506 3300001990 JGI24737J22298_10003835 JGI24737J22298_100038353 542
507 3300001990 JGI24737J22298_10004097 JGI24737J22298_100040975 542
508 3300002067 JGI24735J21928_10001460 JGI24735J21928_100014608 542
509 3300002067 JGI24735J21928_10005791 JGI24735J21928_100057915 542
510 3300002067 JGI24735J21928_10009849 JGI24735J21928_100098492 542
511 3300002075 JGI24738J21930_10002457 JGI24738J21930_100024573 542
512 3300002075 JGI24738J21930_10004108 JGI24738J21930_100041082 542
513 3300003214 JGI25165J46597_1000138 JGI25165J46597_100013849 542
514 3300005289 Ga0065704_10000306 Ga0065704_100003064 542
515 3300005295 Ga0065707_10085409 Ga0065707_100854096 542
516 3300005327 Ga0070658_10004633 Ga0070658_1000463310 542
517 3300005328 Ga0070676_10000079 Ga0070676_1000007913 542
518 3300005331 Ga0070670_100002660 Ga0070670_1000026607 542
519 3300005334 Ga0068869_100001745 Ga0068869_10000174513 542
520 3300005338 Ga0068868_100000154 Ga0068868_10000015442 542
521 3300005339 Ga0070660_100000544 Ga0070660_10000054423 542
522 3300005339 Ga0070660_100007495 Ga0070660_1000074952 542
523 3300005339 Ga0070660_100008064 Ga0070660_1000080647 542
524 3300005347 Ga0070668_100028638 Ga0070668_1000286383 542
525 3300005353 Ga0070669_100036074 Ga0070669_1000360742 542
526 3300005353 Ga0070669_100040950 Ga0070669_1000409502 542
527 3300005355 Ga0070671_100000027 Ga0070671_100000027114 542
528 3300005364 Ga0070673_100000023 Ga0070673_100000023104 542
529 3300005367 Ga0070667_100000004 Ga0070667_10000000445 542
530 3300005367 Ga0070667_100000300 Ga0070667_10000030055 542
531 3300005455 Ga0070663_100000791 Ga0070663_1000007913 542
532 3300005459 Ga0068867_100000007 Ga0068867_1000000072 542
533 3300005539 Ga0068853_100010552 Ga0068853_1000105527 542
534 3300005539 Ga0068853_100203241 Ga0068853_1002032411 542
535 3300005563 Ga0068855_100120775 Ga0068855_1001207752 542
536 3300005563 Ga0068855_100122583 Ga0068855_1001225832 542
537 3300005577 Ga0068857_100033275 Ga0068857_1000332755 542
538 3300005577 Ga0068857_100049951 Ga0068857_1000499512 542
539 3300005578 Ga0068854_100006050 Ga0068854_1000060507 542
540 3300005578 Ga0068854_100034900 Ga0068854_1000349004 542
541 3300005614 Ga0068856_100033854 Ga0068856_1000338545 542
542 3300005614 Ga0068856_100059205 Ga0068856_1000592054 542
543 3300005614 Ga0068856_100086466 Ga0068856_1000864662 542
544 3300005616 Ga0068852_100006502 Ga0068852_10000650210 542
545 3300005616 Ga0068852_100011473 Ga0068852_1000114731 542
546 3300005617 Ga0068859_100024271 Ga0068859_1000242713 542
547 3300005617 Ga0068859_100178631 Ga0068859_1001786312 542
548 3300005834 Ga0068851_10001881 Ga0068851_100018814 542
549 3300005841 Ga0068863_100000169 Ga0068863_10000016920 542
550 3300005841 Ga0068863_100006692 Ga0068863_1000066923 542
551 3300005842 Ga0068858_100000587 Ga0068858_10000058714 542
552 3300005842 Ga0068858_100003843 Ga0068858_10000384315 542
553 3300005843 Ga0068860_100000002 Ga0068860_10000000230 542
554 3300005843 Ga0068860_100000224 Ga0068860_10000022461 542
555 3300005844 Ga0068862_100002573 Ga0068862_1000025735 542
556 3300005844 Ga0068862_100078946 Ga0068862_1000789462 542
557 3300006042 Ga0075368_10000377 Ga0075368_100003778 542
558 3300006178 Ga0075367_10000570 Ga0075367_100005709 542
559 3300006195 Ga0075366_10021020 Ga0075366_100210202 542
560 3300006353 Ga0075370_10064874 Ga0075370_100648742 542
561 3300006881 Ga0068865_100000010 Ga0068865_100000010178 542
562 3300006931 Ga0097620_100024271 Ga0097620_1000242713 542
563 3300006931 Ga0097620_100178636 Ga0097620_1001786362 542
564 3300009093 Ga0105240_10092234 Ga0105240_100922344 542
565 3300009098 Ga0105245_10019720 Ga0105245_100197202 542
566 3300009101 Ga0105247_10069554 Ga0105247_100695542 542
567 3300009148 Ga0105243_10000950 Ga0105243_100009502 542
568 3300009174 Ga0105241_10001752 Ga0105241_100017527 542
569 3300009174 Ga0105241_10006964 Ga0105241_100069647 542
570 3300009176 Ga0105242_10000210 Ga0105242_100002102 542
571 3300009551 Ga0105238_10018659 Ga0105238_100186593 542
572 3300009553 Ga0105249_10022128 Ga0105249_100221286 542
573 3300009978 Ga0105148_100614 Ga0105148_1006144 542
574 3300010375 Ga0105239_10072195 Ga0105239_100721953 542
575 3300011119 Ga0105246_10000333 Ga0105246_100003339 542
576 3300011119 Ga0105246_10011832 Ga0105246_100118323 542
577 3300013100 Ga0157373_10023870 Ga0157373_100238705 542
578 3300013104 Ga0157370_10006473 Ga0157370_1000647310 542
579 3300013104 Ga0157370_10027954 Ga0157370_100279542 542
580 3300013105 Ga0157369_10123431 Ga0157369_101234313 542
581 3300013296 Ga0157374_10000830 Ga0157374_100008302 542
582 3300013297 Ga0157378_10019607 Ga0157378_100196072 542
583 3300013297 Ga0157378_10045704 Ga0157378_100457042 542
584 3300013308 Ga0157375_10034342 Ga0157375_100343422 542
585 3300014969 Ga0157376_10000047 Ga0157376_100000472 542
586 3300025229 Ga0209147_101557 Ga0209147_1015576 542
587 3300025261 Ga0209233_1000182 Ga0209233_100018259 542
588 3300025272 Ga0209455_1006444 Ga0209455_10064444 542
589 3300025321 Ga0207656_10002966 Ga0207656_100029664 542
590 3300025321 Ga0207656_10013321 Ga0207656_100133212 542
591 3300025903 Ga0207680_10070228 Ga0207680_100702282 542
592 3300025904 Ga0207647_10005479 Ga0207647_100054799 542
593 3300025904 Ga0207647_10008107 Ga0207647_100081072 542
594 3300025907 Ga0207645_10001300 Ga0207645_1000130018 542
595 3300025909 Ga0207705_10001772 Ga0207705_100017722 542
596 3300025909 Ga0207705_10020526 Ga0207705_100205264 542
597 3300025911 Ga0207654_10002334 Ga0207654_100023349 542
598 3300025913 Ga0207695_10014635 Ga0207695_100146357 542
599 3300025914 Ga0207671_10000841 Ga0207671_1000084125 542
600 3300025914 Ga0207671_10016046 Ga0207671_100160466 542
601 3300025919 Ga0207657_10003249 Ga0207657_1000324917 542
602 3300025919 Ga0207657_10010428 Ga0207657_100104284 542
603 3300025919 Ga0207657_10033891 Ga0207657_100338912 542
604 3300025919 Ga0207657_10044982 Ga0207657_100449825 542
605 3300025923 Ga0207681_10006062 Ga0207681_100060625 542
606 3300025923 Ga0207681_10006088 Ga0207681_100060885 542
607 3300025924 Ga0207694_10009370 Ga0207694_100093703 542
608 3300025925 Ga0207650_10002924 Ga0207650_1000292410 542
609 3300025927 Ga0207687_10004556 Ga0207687_100045566 542
610 3300025927 Ga0207687_10012191 Ga0207687_100121912 542
611 3300025931 Ga0207644_10000064 Ga0207644_1000006430 542
612 3300025934 Ga0207686_10000332 Ga0207686_1000033215 542
613 3300025935 Ga0207709_10000050 Ga0207709_10000050249 542
614 3300025938 Ga0207704_10000020 Ga0207704_10000020159 542
615 3300025942 Ga0207689_10004290 Ga0207689_100042902 542
616 3300025949 Ga0207667_10006744 Ga0207667_100067449 542
617 3300025949 Ga0207667_10007432 Ga0207667_100074327 542
618 3300025960 Ga0207651_10000005 Ga0207651_100000052 542
619 3300025961 Ga0207712_10085225 Ga0207712_100852252 542
620 3300025972 Ga0207668_10000024 Ga0207668_10000024115 542
621 3300025972 Ga0207668_10000265 Ga0207668_1000026515 542
622 3300025972 Ga0207668_10002663 Ga0207668_1000266310 542
623 3300025981 Ga0207640_10033847 Ga0207640_100338473 542
624 3300025986 Ga0207658_10000002 Ga0207658_10000002337 542
625 3300025986 Ga0207658_10000074 Ga0207658_1000007478 542
626 3300025986 Ga0207658_10000258 Ga0207658_100002583 542
627 3300026023 Ga0207677_10000373 Ga0207677_1000037326 542
628 3300026035 Ga0207703_10004594 Ga0207703_100045948 542
629 3300026035 Ga0207703_10009066 Ga0207703_100090667 542
630 3300026041 Ga0207639_10009358 Ga0207639_100093587 542
631 3300026041 Ga0207639_10035712 Ga0207639_100357122 542
632 3300026067 Ga0207678_10000979 Ga0207678_1000097913 542
633 3300026078 Ga0207702_10001863 Ga0207702_1000186312 542
634 3300026078 Ga0207702_10002491 Ga0207702_1000249115 542
635 3300026078 Ga0207702_10003048 Ga0207702_1000304811 542
636 3300026078 Ga0207702_10009519 Ga0207702_100095195 542
637 3300026088 Ga0207641_10000181 Ga0207641_1000018117 542
638 3300026088 Ga0207641_10000475 Ga0207641_1000047544 542
639 3300026088 Ga0207641_10000883 Ga0207641_100008837 542
640 3300026089 Ga0207648_10000017 Ga0207648_10000017159 542
641 3300026116 Ga0207674_10029609 Ga0207674_100296092 542
642 3300026116 Ga0207674_10081160 Ga0207674_100811604 542
643 3300026142 Ga0207698_10000397 Ga0207698_100003972 542
644 3300026142 Ga0207698_10001985 Ga0207698_1000198510 542
645 3300026142 Ga0207698_10047994 Ga0207698_100479942 542
646 3300027866 Ga0209813_10000103 Ga0209813_1000010331 542
647 3300027876 Ga0209974_10005517 Ga0209974_100055172 542
648 3300028380 Ga0268265_10000204 Ga0268265_1000020433 542
649 3300028380 Ga0268265_10005194 Ga0268265_100051947 542
650 3300028381 Ga0268264_10000001 Ga0268264_10000001662 542
651 3300028381 Ga0268264_10000161 Ga0268264_1000016128 542
652 3300028381 Ga0268264_10003264 Ga0268264_100032645 542
653 3300031731 Ga0307405_10006017 Ga0307405_100060172 542
654 3300031911 Ga0307412_10014986 Ga0307412_100149865 542
655 3300031911 Ga0307412_10024421 Ga0307412_100244214 542
656 3300032004 Ga0307414_10051280 Ga0307414_100512803 542
657 3300037471 Ga0395905_0053716 Ga0395905_0053716_462_2174 542
658 3300038443 Ga0395901_0117983 Ga0395901_0117983_202_1914 542
659 3300045051 Ga0451576_0000165 Ga0451576_0000165_140774_142441 542
660 3300046558 Ga0495633_0000136 Ga0495633_0000136_25364_27022 542
661 3300048905 Ga0496102_0000472 Ga0496102_0000472_12955_14631 542
662 3300048905 Ga0496102_0055787 Ga0496102_0055787_819_2477 542
663 3300048906 Ga0496103_0000318 Ga0496103_0000318_29948_31624 542
664 3300048919 Ga0496116_0001661 Ga0496116_0001661_2475_4151 542
665 3300048920 Ga0496117_0000946 Ga0496117_0000946_29889_31565 542
666 3300048921 Ga0496118_0000133 Ga0496118_0000133_78079_79755 542
667 3300048927 Ga0496124_0000359 Ga0496124_0000359_29911_31587 542
668 3300048927 Ga0496124_0016020 Ga0496124_0016020_2168_3817 542
669 3300049581 Ga0501047_0102959 Ga0501047_0102959_507_2162 542
670 3300049663 Ga0501223_000060 Ga0501223_000060_17559_19217 542
671 3300049676 Ga0501246_000266 Ga0501246_000266_240_1898 542
672 3300049705 Ga0501225_0000021 Ga0501225_0000021_17559_19217 542
673 3300050494 nmdc:mga06z11_342_c1 nmdc:mga06z11_342_c1_6598_8259 542
674 3300050495 nmdc:mga04h51_239_c1 nmdc:mga04h51_239_c1_6965_8626 542
675 3300050496 nmdc:mga07m45_18364_c1 nmdc:mga07m45_18364_c1_295_1956 542
676 3300053116 Ga0500592_001795 Ga0500592_001795_124_1779 542
677 3300053153 Ga0500616_0026039 Ga0500616_0026039_671_2335 542
678 3300006353 Ga0075370_10000005 Ga0075370_1000000517 543
679 3300027907 Ga0207428_10030840 Ga0207428_100308402 543
680 3300031824 Ga0307413_10001824 Ga0307413_100018247 543
681 3300031852 Ga0307410_10009198 Ga0307410_100091982 543
682 3300031911 Ga0307412_10000638 Ga0307412_1000063810 543
683 3300032004 Ga0307414_10003981 Ga0307414_100039816 543
684 3300032004 Ga0307414_10016298 Ga0307414_100162985 543
685 3300048924 Ga0496121_0000070 Ga0496121_0000070_21258_22919 543
686 3300050493 nmdc:mga0k408_45325_c1 nmdc:mga0k408_45325_c1_47_1705 543
687 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_396848_398506 543
688 3300053087 Ga0500643_001993 Ga0500643_001993_7264_8943 543
689 3300053125 Ga0500618_000553 Ga0500618_000553_8225_9883 543
690 2162886007 SwRhRL2b_contig_118179 SwRhRL2b_0380.00001290 544
691 3300002239 JGI24034J26672_10004435 JGI24034J26672_100044351 544
692 3300005289 Ga0065704_10002284 Ga0065704_100022847 544
693 3300005347 Ga0070668_100003324 Ga0070668_1000033245 544
694 3300005353 Ga0070669_100004097 Ga0070669_1000040976 544
695 3300005548 Ga0070665_100001656 Ga0070665_10000165616 544
696 3300005563 Ga0068855_100050081 Ga0068855_1000500814 544
697 3300005843 Ga0068860_100010596 Ga0068860_10001059610 544
698 3300005844 Ga0068862_100067336 Ga0068862_1000673362 544
699 3300009177 Ga0105248_10043765 Ga0105248_100437654 544
700 3300025711 Ga0207696_1001974 Ga0207696_10019744 544
701 3300025735 Ga0207713_1026935 Ga0207713_10269352 544
702 3300025923 Ga0207681_10000852 Ga0207681_100008522 544
703 3300025923 Ga0207681_10001437 Ga0207681_100014376 544
704 3300025931 Ga0207644_10000022 Ga0207644_1000002218 544
705 3300025949 Ga0207667_10014312 Ga0207667_100143124 544
706 3300025972 Ga0207668_10002922 Ga0207668_100029227 544
707 3300025986 Ga0207658_10062849 Ga0207658_100628492 544
708 3300026095 Ga0207676_10090832 Ga0207676_100908322 544
709 3300028379 Ga0268266_10017214 Ga0268266_100172147 544
710 3300028381 Ga0268264_10029464 Ga0268264_100294642 544
711 3300048904 Ga0496101_0010420 Ga0496101_0010420_1397_3079 544
712 3300048905 Ga0496102_0000377 Ga0496102_0000377_44138_45790 544
713 3300048906 Ga0496103_0000128 Ga0496103_0000128_35165_36817 544
714 3300048907 Ga0496104_0000205 Ga0496104_0000205_21675_23327 544
715 3300048908 Ga0496105_0001478 Ga0496105_0001478_14500_16152 544
716 3300048909 Ga0496106_0003228 Ga0496106_0003228_10078_11760 544
717 3300048916 Ga0496113_0006055 Ga0496113_0006055_5273_6925 544
718 3300048916 Ga0496113_0007493 Ga0496113_0007493_3353_5035 544
719 3300048920 Ga0496117_0006093 Ga0496117_0006093_9926_11578 544
720 3300048921 Ga0496118_0043238 Ga0496118_0043238_1119_2771 544
721 3300048922 Ga0496119_0002177 Ga0496119_0002177_19678_21330 544
722 3300048923 Ga0496120_0001695 Ga0496120_0001695_9424_11076 544
723 3300048924 Ga0496121_0006631 Ga0496121_0006631_9288_10940 544
724 3300048926 Ga0496123_0023585 Ga0496123_0023585_2748_4400 544
725 3300048927 Ga0496124_0000417 Ga0496124_0000417_55639_57291 544
726 3300048928 Ga0496125_0006733 Ga0496125_0006733_9926_11578 544
727 3300048929 Ga0496126_0000493 Ga0496126_0000493_45712_47364 544

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

109

541

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8snh-assembly1.cif.gz_E cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.9546 68 521
6xkw-assembly1.cif.gz_n r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy 0.9487 69 521
3mk7-assembly4.cif.gz_K the structure of cbb3 cytochrome oxidase 0.9419 67 527
3mk7-assembly4.cif.gz_K the structure of cbb3 cytochrome oxidase 0.932 67 527
8snh-assembly1.cif.gz_E cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.9246 68 521
ID Description Score Start End Superfamily
5djqA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9353 69 530 1.20.210.10
5djqA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9255 69 530 1.20.210.10
4xydA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8275 68 524 1.20.210.10
4xydA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.824 68 524 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.7781 73 526 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A4S4I9D0-F1-model_v4 deleted 0.994 398 517
AF-A0A2Z5ZPJ1-F1-model_v4 Nitric oxide reductase 0.9923 413 515 GO:0004129
GO:0009060
GO:0016020
GO:0020037
AF-A0A7Z1SA03-F1-model_v4 Cytochrome C oxidase Cbb3 0.9912 368 511 GO:0004129
GO:0005886
GO:0009060
GO:0015990
GO:0020037
GO:0022904
AF-A0A259K6V1-F1-model_v4 deleted 0.9908 366 517
AF-A0A485EQ03-F1-model_v4 deleted 0.9906 345 517

Feature Viewer

pLDDT pTM Quality
86.71 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map