F477749
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 357 | 677 | 537 |
Family's Representative Sequence
| Representative Sequence | 3300027876|Ga0209974_10005517|Ga0209974_100055172 |
| Length | 593 |
| Sequence | MKRFFAGDLRWINDSLRTAAQGGREKHGGTEIFMQAEAALGRMGLWFAVMLLAIVACAAAADPGFSVQAGIVAVMALGLFMASAARFDPLGHARGFFRMPQGDSRYDDDPIRWATLATLFWGAAGFMAGLFIAAQLAWPQLNFEPYLNFGRVRPLHTSAVIFAFGGNALIGTSFYVVQRTCRTRLAFPALARFVFWGYQVFIVLAATGYLLGISQSKEYAEPQWYADWWLTVVWLAYLAVFVGTILRRHEPHIYVANWFYLAFIITVAMLHVVNNLDMPVSLLGSQAYPLFGGVQGALVQWWYGHNAVGFFLTAGFLAMMYYFVPKQAERPVYSYRLSIIHFWSLIFLYIWAGPHHLLYTALPDWAQTLGMVFSIMLWMPSWGGMINGLMTLNGAWDKVRTDPIIRMMVMALAFYGMSTFEGPMLSIKFFNSLSHYTDWTIGHVHSGALGWNGMITFACLYYLVPRLWNRGRMYSLRMINWHFWLATLGIVFYAASMWVAGITQGLMWREYGADGYLVNSFADTVAAIHPMYVMRAFGGLLYLAGFVVMLWNVGQTLAGKVREEAPMTETPHDPVADRPIPGAAAAVPAVPAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 3 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 4 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 5 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 8 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 9 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 10 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 11 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 12 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 13 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 14 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 15 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 16 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 17 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 18 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 19 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 20 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 21 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 22 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 23 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 24 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 25 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 26 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 27 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 28 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 29 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 30 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 31 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 32 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 33 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 34 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 35 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 36 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 37 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 38 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 39 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 40 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 41 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 42 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 43 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 44 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 45 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 46 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 47 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 48 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 49 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 50 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 51 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 52 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 53 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 54 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 55 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 56 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 57 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 58 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 64 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 95 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 241 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 288 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 310 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 311 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 313 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 320 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 321 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 333 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 337 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 338 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 339 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 342 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 343 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 346 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 349 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 351 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 355 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 356 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 357 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.12 |
| Metatranscriptomes | 0 |
| Isolates | 6.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.08 |
| Nodule | 1.65 |
| Rhizoplane | 2.34 |
| Rhizosphere | 79.23 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 7.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_118179 | 2162886007 | Bacteria | 3737 |
| 2 | JGI24736J21556_1000172 | 3300001904 | Bacteria | 11486 |
| 3 | JGI24736J21556_1000319 | 3300001904 | Bacteria | 8934 |
| 4 | JGI24736J21556_1005870 | 3300001904 | Bacteria | 2075 |
| 5 | JGI24741J21665_1000143 | 3300001915 | Bacteria | 19927 |
| 6 | JGI24740J21852_10001914 | 3300001979 | Bacteria | 9554 |
| 7 | JGI24740J21852_10004740 | 3300001979 | Bacteria | 5813 |
| 8 | JGI24739J22299_10001814 | 3300001989 | Bacteria | 8137 |
| 9 | JGI24739J22299_10003317 | 3300001989 | Bacteria | 6140 |
| 10 | JGI24739J22299_10004003 | 3300001989 | Bacteria | 5639 |
| 11 | JGI24739J22299_10026015 | 3300001989 | Bacteria | 2056 |
| 12 | JGI24737J22298_10003835 | 3300001990 | Bacteria | 5286 |
| 13 | JGI24737J22298_10004097 | 3300001990 | Bacteria | 5091 |
| 14 | JGI24735J21928_10001460 | 3300002067 | Bacteria | 8361 |
| 15 | JGI24735J21928_10005791 | 3300002067 | Bacteria | 4088 |
| 16 | JGI24735J21928_10009849 | 3300002067 | Bacteria | 3061 |
| 17 | JGI24738J21930_10002457 | 3300002075 | Bacteria | 4846 |
| 18 | JGI24738J21930_10004108 | 3300002075 | Bacteria | 3596 |
| 19 | JGI24034J26672_10004435 | 3300002239 | Bacteria | 1990 |
| 20 | JGI24751J29686_10000202 | 3300002459 | Bacteria | 25902 |
| 21 | JGI24751J29686_10001546 | 3300002459 | Bacteria | 4769 |
| 22 | JGI25165J46597_1000138 | 3300003214 | Bacteria | 121773 |
| 23 | Ga0055524_1000038 | 3300003775 | Bacteria | 162683 |
| 24 | Ga0055524_1000221 | 3300003775 | Bacteria | 60461 |
| 25 | Ga0055530_10000518 | 3300003791 | Bacteria | 33511 |
| 26 | Ga0055530_10004799 | 3300003791 | Bacteria | 6783 |
| 27 | Ga0055531_10016199 | 3300003794 | Bacteria | 3233 |
| 28 | Ga0065704_10000306 | 3300005289 | Bacteria | 41833 |
| 29 | Ga0065704_10002284 | 3300005289 | Bacteria | 10046 |
| 30 | Ga0065712_10077285 | 3300005290 | Bacteria | 3519 |
| 31 | Ga0065707_10085409 | 3300005295 | Bacteria | 6176 |
| 32 | Ga0065707_10085887 | 3300005295 | Bacteria | 5821 |
| 33 | Ga0065707_10097586 | 3300005295 | Bacteria | 3161 |
| 34 | Ga0070658_10001136 | 3300005327 | Bacteria | 22699 |
| 35 | Ga0070658_10002177 | 3300005327 | Bacteria | 16444 |
| 36 | Ga0070658_10004633 | 3300005327 | Bacteria | 11178 |
| 37 | Ga0070658_10005829 | 3300005327 | Bacteria | 9983 |
| 38 | Ga0070676_10000079 | 3300005328 | Bacteria | 33090 |
| 39 | Ga0070676_10002350 | 3300005328 | Bacteria | 9687 |
| 40 | Ga0070683_100033052 | 3300005329 | Bacteria | 4714 |
| 41 | Ga0070690_100006640 | 3300005330 | Bacteria | 6572 |
| 42 | Ga0070670_100000339 | 3300005331 | Bacteria | 39253 |
| 43 | Ga0070670_100002660 | 3300005331 | Bacteria | 14770 |
| 44 | Ga0070670_100002673 | 3300005331 | Bacteria | 14724 |
| 45 | Ga0070670_100041478 | 3300005331 | Bacteria | 3956 |
| 46 | Ga0070677_10011502 | 3300005333 | Bacteria | 3054 |
| 47 | Ga0068869_100000492 | 3300005334 | Bacteria | 21961 |
| 48 | Ga0068869_100001745 | 3300005334 | Bacteria | 13000 |
| 49 | Ga0068869_100011811 | 3300005334 | Bacteria | 5744 |
| 50 | Ga0070666_10056526 | 3300005335 | Bacteria | 2650 |
| 51 | Ga0070666_10079009 | 3300005335 | Bacteria | 2247 |
| 52 | Ga0070680_100076925 | 3300005336 | Bacteria | 2748 |
| 53 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 54 | Ga0068868_100127800 | 3300005338 | Bacteria | 2078 |
| 55 | Ga0070660_100000544 | 3300005339 | Bacteria | 25288 |
| 56 | Ga0070660_100000581 | 3300005339 | Bacteria | 24544 |
| 57 | Ga0070660_100005066 | 3300005339 | Bacteria | 9105 |
| 58 | Ga0070660_100007495 | 3300005339 | Bacteria | 7608 |
| 59 | Ga0070660_100008064 | 3300005339 | Bacteria | 7360 |
| 60 | Ga0070660_100009163 | 3300005339 | Bacteria | 6949 |
| 61 | Ga0070660_100080017 | 3300005339 | Bacteria | 2564 |
| 62 | Ga0070661_100001045 | 3300005344 | Bacteria | 19570 |
| 63 | Ga0070661_100005599 | 3300005344 | Bacteria | 8654 |
| 64 | Ga0070668_100003324 | 3300005347 | Bacteria | 11867 |
| 65 | Ga0070668_100015604 | 3300005347 | Bacteria | 5678 |
| 66 | Ga0070668_100018696 | 3300005347 | Bacteria | 5203 |
| 67 | Ga0070668_100028638 | 3300005347 | Bacteria | 4227 |
| 68 | Ga0070668_100119687 | 3300005347 | Bacteria | 2103 |
| 69 | Ga0070669_100000345 | 3300005353 | Bacteria | 36221 |
| 70 | Ga0070669_100001184 | 3300005353 | Bacteria | 18986 |
| 71 | Ga0070669_100004097 | 3300005353 | Bacteria | 10562 |
| 72 | Ga0070669_100012646 | 3300005353 | Bacteria | 5990 |
| 73 | Ga0070669_100036074 | 3300005353 | Bacteria | 3582 |
| 74 | Ga0070669_100040950 | 3300005353 | Bacteria | 3368 |
| 75 | Ga0070675_100003762 | 3300005354 | Bacteria | 11520 |
| 76 | Ga0070675_100043868 | 3300005354 | Bacteria | 3657 |
| 77 | Ga0070671_100000007 | 3300005355 | Bacteria | 250397 |
| 78 | Ga0070671_100000027 | 3300005355 | Bacteria | 114189 |
| 79 | Ga0070671_100002453 | 3300005355 | Bacteria | 14337 |
| 80 | Ga0070671_100007531 | 3300005355 | Bacteria | 8706 |
| 81 | Ga0070674_100034190 | 3300005356 | Bacteria | 3393 |
| 82 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 83 | Ga0070673_100006904 | 3300005364 | Bacteria | 7425 |
| 84 | Ga0070673_100013295 | 3300005364 | Bacteria | 5687 |
| 85 | Ga0070673_100033483 | 3300005364 | Bacteria | 3881 |
| 86 | Ga0070688_100004092 | 3300005365 | Bacteria | 7565 |
| 87 | Ga0070659_100001886 | 3300005366 | Bacteria | 15004 |
| 88 | Ga0070659_100003357 | 3300005366 | Bacteria | 11389 |
| 89 | Ga0070659_100028147 | 3300005366 | Bacteria | 4337 |
| 90 | Ga0070659_100093282 | 3300005366 | Bacteria | 2416 |
| 91 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 92 | Ga0070667_100000300 | 3300005367 | Bacteria | 55347 |
| 93 | Ga0070667_100000390 | 3300005367 | Bacteria | 47461 |
| 94 | Ga0070667_100016634 | 3300005367 | Bacteria | 6088 |
| 95 | Ga0070667_100050679 | 3300005367 | Bacteria | 3499 |
| 96 | Ga0070701_10012016 | 3300005438 | Bacteria | 3889 |
| 97 | Ga0070708_100001167 | 3300005445 | Bacteria | 20229 |
| 98 | Ga0070663_100000791 | 3300005455 | Bacteria | 17178 |
| 99 | Ga0070678_100028584 | 3300005456 | Bacteria | 3805 |
| 100 | Ga0070662_100000078 | 3300005457 | Bacteria | 53638 |
| 101 | Ga0070662_100000100 | 3300005457 | Bacteria | 47285 |
| 102 | Ga0070681_10004190 | 3300005458 | Bacteria | 13658 |
| 103 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 104 | Ga0068867_100037937 | 3300005459 | Bacteria | 3505 |
| 105 | Ga0070685_10004485 | 3300005466 | Bacteria | 7064 |
| 106 | Ga0068853_100005601 | 3300005539 | Bacteria | 9861 |
| 107 | Ga0068853_100010552 | 3300005539 | Bacteria | 7469 |
| 108 | Ga0068853_100027833 | 3300005539 | Bacteria | 4752 |
| 109 | Ga0068853_100203241 | 3300005539 | Bacteria | 1803 |
| 110 | Ga0070672_100029364 | 3300005543 | Bacteria | 4122 |
| 111 | Ga0070665_100000129 | 3300005548 | Bacteria | 141818 |
| 112 | Ga0070665_100000169 | 3300005548 | Bacteria | 118043 |
| 113 | Ga0070665_100001656 | 3300005548 | Bacteria | 25675 |
| 114 | Ga0070665_100006197 | 3300005548 | Bacteria | 12241 |
| 115 | Ga0070665_100013687 | 3300005548 | Bacteria | 8163 |
| 116 | Ga0070665_100019755 | 3300005548 | Bacteria | 6763 |
| 117 | Ga0070665_100028940 | 3300005548 | Bacteria | 5577 |
| 118 | Ga0070665_100031714 | 3300005548 | Bacteria | 5318 |
| 119 | Ga0070665_100075497 | 3300005548 | Bacteria | 3378 |
| 120 | Ga0068855_100004942 | 3300005563 | Bacteria | 16258 |
| 121 | Ga0068855_100010294 | 3300005563 | Bacteria | 11279 |
| 122 | Ga0068855_100050081 | 3300005563 | Bacteria | 4923 |
| 123 | Ga0068855_100120775 | 3300005563 | Bacteria | 2999 |
| 124 | Ga0068855_100122583 | 3300005563 | Bacteria | 2974 |
| 125 | Ga0070664_100009168 | 3300005564 | Bacteria | 8034 |
| 126 | Ga0068857_100007911 | 3300005577 | Bacteria | 9172 |
| 127 | Ga0068857_100018857 | 3300005577 | Bacteria | 6053 |
| 128 | Ga0068857_100033275 | 3300005577 | Bacteria | 4559 |
| 129 | Ga0068857_100049951 | 3300005577 | Bacteria | 3711 |
| 130 | Ga0068854_100000255 | 3300005578 | Bacteria | 36254 |
| 131 | Ga0068854_100006050 | 3300005578 | Bacteria | 7670 |
| 132 | Ga0068854_100034900 | 3300005578 | Bacteria | 3517 |
| 133 | Ga0068854_100135501 | 3300005578 | Bacteria | 1885 |
| 134 | Ga0068856_100009851 | 3300005614 | Bacteria | 9278 |
| 135 | Ga0068856_100033854 | 3300005614 | Bacteria | 5004 |
| 136 | Ga0068856_100040766 | 3300005614 | Bacteria | 4562 |
| 137 | Ga0068856_100059205 | 3300005614 | Bacteria | 3783 |
| 138 | Ga0068856_100086466 | 3300005614 | Bacteria | 3115 |
| 139 | Ga0068852_100000208 | 3300005616 | Bacteria | 39815 |
| 140 | Ga0068852_100002270 | 3300005616 | Bacteria | 13203 |
| 141 | Ga0068852_100006502 | 3300005616 | Bacteria | 8448 |
| 142 | Ga0068852_100011473 | 3300005616 | Bacteria | 6672 |
| 143 | Ga0068859_100001637 | 3300005617 | Bacteria | 22877 |
| 144 | Ga0068859_100021839 | 3300005617 | Bacteria | 6419 |
| 145 | Ga0068859_100024271 | 3300005617 | Bacteria | 6084 |
| 146 | Ga0068859_100178631 | 3300005617 | Bacteria | 2205 |
| 147 | Ga0068864_100000233 | 3300005618 | Bacteria | 49794 |
| 148 | Ga0068864_100001909 | 3300005618 | Bacteria | 17108 |
| 149 | Ga0068864_100002699 | 3300005618 | Bacteria | 14620 |
| 150 | Ga0068864_100009652 | 3300005618 | Bacteria | 7963 |
| 151 | Ga0068864_100019221 | 3300005618 | Bacteria | 5710 |
| 152 | Ga0068864_100028820 | 3300005618 | Bacteria | 4697 |
| 153 | Ga0068861_100003970 | 3300005719 | Bacteria | 9907 |
| 154 | Ga0068851_10001881 | 3300005834 | Bacteria | 9224 |
| 155 | Ga0068870_10003032 | 3300005840 | Bacteria | 7078 |
| 156 | Ga0068870_10069615 | 3300005840 | Bacteria | 1915 |
| 157 | Ga0068863_100000081 | 3300005841 | Bacteria | 106186 |
| 158 | Ga0068863_100000169 | 3300005841 | Bacteria | 70831 |
| 159 | Ga0068863_100001079 | 3300005841 | Bacteria | 27286 |
| 160 | Ga0068863_100001536 | 3300005841 | Bacteria | 22796 |
| 161 | Ga0068863_100003624 | 3300005841 | Bacteria | 15249 |
| 162 | Ga0068863_100006692 | 3300005841 | Bacteria | 11310 |
| 163 | Ga0068863_100013152 | 3300005841 | Bacteria | 7986 |
| 164 | Ga0068863_100025902 | 3300005841 | Bacteria | 5596 |
| 165 | Ga0068858_100000506 | 3300005842 | Bacteria | 40814 |
| 166 | Ga0068858_100000587 | 3300005842 | Bacteria | 38232 |
| 167 | Ga0068858_100001600 | 3300005842 | Bacteria | 23109 |
| 168 | Ga0068858_100002847 | 3300005842 | Bacteria | 17396 |
| 169 | Ga0068858_100003843 | 3300005842 | Bacteria | 14850 |
| 170 | Ga0068858_100006571 | 3300005842 | Bacteria | 11313 |
| 171 | Ga0068858_100019496 | 3300005842 | Bacteria | 6343 |
| 172 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 173 | Ga0068860_100000023 | 3300005843 | Bacteria | 279076 |
| 174 | Ga0068860_100000108 | 3300005843 | Bacteria | 132230 |
| 175 | Ga0068860_100000224 | 3300005843 | Bacteria | 88107 |
| 176 | Ga0068860_100005575 | 3300005843 | Bacteria | 12730 |
| 177 | Ga0068860_100010596 | 3300005843 | Bacteria | 9106 |
| 178 | Ga0068860_100025709 | 3300005843 | Bacteria | 5678 |
| 179 | Ga0068860_100039245 | 3300005843 | Bacteria | 4529 |
| 180 | Ga0068860_100063837 | 3300005843 | Bacteria | 3497 |
| 181 | Ga0068860_100073083 | 3300005843 | Bacteria | 3260 |
| 182 | Ga0068862_100000288 | 3300005844 | Bacteria | 55742 |
| 183 | Ga0068862_100002573 | 3300005844 | Bacteria | 16022 |
| 184 | Ga0068862_100067336 | 3300005844 | Bacteria | 3087 |
| 185 | Ga0068862_100078946 | 3300005844 | Bacteria | 2852 |
| 186 | Ga0068862_100140492 | 3300005844 | Bacteria | 2143 |
| 187 | Ga0075368_10000377 | 3300006042 | Bacteria | 13060 |
| 188 | Ga0075364_10010857 | 3300006051 | Bacteria | 5516 |
| 189 | Ga0075362_10000015 | 3300006177 | Bacteria | 84026 |
| 190 | Ga0075367_10000570 | 3300006178 | Bacteria | 14051 |
| 191 | Ga0075369_10000186 | 3300006186 | Bacteria | 17929 |
| 192 | Ga0075366_10000153 | 3300006195 | Bacteria | 29232 |
| 193 | Ga0075366_10021020 | 3300006195 | Bacteria | 3793 |
| 194 | Ga0097621_100003378 | 3300006237 | Bacteria | 10987 |
| 195 | Ga0097621_100039906 | 3300006237 | Bacteria | 3772 |
| 196 | Ga0075370_10000005 | 3300006353 | Bacteria | 112202 |
| 197 | Ga0075370_10064874 | 3300006353 | Bacteria | 2083 |
| 198 | Ga0068871_100006581 | 3300006358 | Bacteria | 8236 |
| 199 | Ga0068871_100084964 | 3300006358 | Bacteria | 2627 |
| 200 | Ga0075430_100003721 | 3300006846 | Bacteria | 12816 |
| 201 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 202 | Ga0097620_100001637 | 3300006931 | Bacteria | 22877 |
| 203 | Ga0097620_100021839 | 3300006931 | Bacteria | 6419 |
| 204 | Ga0097620_100024271 | 3300006931 | Bacteria | 6084 |
| 205 | Ga0097620_100178636 | 3300006931 | Bacteria | 2205 |
| 206 | Ga0105251_10003202 | 3300009011 | Bacteria | 12085 |
| 207 | Ga0105240_10004622 | 3300009093 | Bacteria | 20873 |
| 208 | Ga0105240_10008082 | 3300009093 | Bacteria | 15118 |
| 209 | Ga0105240_10092234 | 3300009093 | Bacteria | 3699 |
| 210 | Ga0105245_10019720 | 3300009098 | Bacteria | 5909 |
| 211 | Ga0105245_10040363 | 3300009098 | Bacteria | 4157 |
| 212 | Ga0105247_10007289 | 3300009101 | Bacteria | 6797 |
| 213 | Ga0105247_10069554 | 3300009101 | Bacteria | 2197 |
| 214 | Ga0105243_10000950 | 3300009148 | Bacteria | 27049 |
| 215 | Ga0105241_10001752 | 3300009174 | Bacteria | 16461 |
| 216 | Ga0105241_10006964 | 3300009174 | Bacteria | 8316 |
| 217 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 218 | Ga0105248_10005948 | 3300009177 | Bacteria | 13399 |
| 219 | Ga0105248_10008636 | 3300009177 | Bacteria | 11190 |
| 220 | Ga0105248_10041655 | 3300009177 | Bacteria | 5149 |
| 221 | Ga0105248_10043765 | 3300009177 | Bacteria | 5022 |
| 222 | Ga0105248_10058733 | 3300009177 | Bacteria | 4320 |
| 223 | Ga0105238_10018659 | 3300009551 | Bacteria | 7063 |
| 224 | Ga0105238_10033163 | 3300009551 | Bacteria | 5255 |
| 225 | Ga0105249_10000053 | 3300009553 | Bacteria | 168010 |
| 226 | Ga0105249_10022128 | 3300009553 | Bacteria | 5694 |
| 227 | Ga0105249_10070001 | 3300009553 | Bacteria | 3238 |
| 228 | Ga0105148_100614 | 3300009978 | Bacteria | 2938 |
| 229 | Ga0105239_10006936 | 3300010375 | Bacteria | 13068 |
| 230 | Ga0105239_10072195 | 3300010375 | Bacteria | 3794 |
| 231 | Ga0105239_10114605 | 3300010375 | Bacteria | 2990 |
| 232 | Ga0105246_10000333 | 3300011119 | Bacteria | 25060 |
| 233 | Ga0105246_10011832 | 3300011119 | Bacteria | 5424 |
| 234 | Ga0157373_10001248 | 3300013100 | Bacteria | 19430 |
| 235 | Ga0157373_10018150 | 3300013100 | Bacteria | 5124 |
| 236 | Ga0157373_10023870 | 3300013100 | Bacteria | 4431 |
| 237 | Ga0157371_10000519 | 3300013102 | Bacteria | 46108 |
| 238 | Ga0157370_10006473 | 3300013104 | Bacteria | 12913 |
| 239 | Ga0157370_10027954 | 3300013104 | Bacteria | 5556 |
| 240 | Ga0157370_10053116 | 3300013104 | Bacteria | 3865 |
| 241 | Ga0157369_10000446 | 3300013105 | Bacteria | 54687 |
| 242 | Ga0157369_10013128 | 3300013105 | Bacteria | 9374 |
| 243 | Ga0157369_10117510 | 3300013105 | Bacteria | 2823 |
| 244 | Ga0157369_10123431 | 3300013105 | Bacteria | 2747 |
| 245 | Ga0157374_10000830 | 3300013296 | Bacteria | 27049 |
| 246 | Ga0157374_10005259 | 3300013296 | Bacteria | 10861 |
| 247 | Ga0157378_10019607 | 3300013297 | Bacteria | 5944 |
| 248 | Ga0157378_10045704 | 3300013297 | Bacteria | 3892 |
| 249 | Ga0163162_10005912 | 3300013306 | Bacteria | 11838 |
| 250 | Ga0157372_10000380 | 3300013307 | Bacteria | 49260 |
| 251 | Ga0157372_10001430 | 3300013307 | Bacteria | 25787 |
| 252 | Ga0157372_10310389 | 3300013307 | Bacteria | 1836 |
| 253 | Ga0157375_10005919 | 3300013308 | Bacteria | 10659 |
| 254 | Ga0157375_10034342 | 3300013308 | Bacteria | 4831 |
| 255 | Ga0163163_10100720 | 3300014325 | Bacteria | 2911 |
| 256 | Ga0157380_10003365 | 3300014326 | Bacteria | 10970 |
| 257 | Ga0157380_10009984 | 3300014326 | Bacteria | 6814 |
| 258 | Ga0157380_10153231 | 3300014326 | Bacteria | 1995 |
| 259 | Ga0157379_10007542 | 3300014968 | Bacteria | 9417 |
| 260 | Ga0157379_10035140 | 3300014968 | Bacteria | 4468 |
| 261 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 262 | Ga0157376_10003300 | 3300014969 | Bacteria | 11110 |
| 263 | Ga0163161_10071667 | 3300017792 | Bacteria | 2536 |
| 264 | Ga0213872_10000842 | 3300021361 | Bacteria | 22153 |
| 265 | Ga0213872_10000876 | 3300021361 | Bacteria | 21757 |
| 266 | Ga0213872_10006039 | 3300021361 | Bacteria | 6131 |
| 267 | Ga0213872_10051771 | 3300021361 | Bacteria | 1863 |
| 268 | Ga0209147_101557 | 3300025229 | Bacteria | 7842 |
| 269 | Ga0207427_104089 | 3300025231 | Bacteria | 2627 |
| 270 | Ga0209233_1000182 | 3300025261 | Bacteria | 137671 |
| 271 | Ga0209233_1000713 | 3300025261 | Bacteria | 15488 |
| 272 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 273 | Ga0209455_1006444 | 3300025272 | Bacteria | 3460 |
| 274 | Ga0209676_1000132 | 3300025292 | Bacteria | 185063 |
| 275 | Ga0209676_1000155 | 3300025292 | Bacteria | 165151 |
| 276 | Ga0209676_1000311 | 3300025292 | Bacteria | 95478 |
| 277 | Ga0209050_1000139 | 3300025298 | Bacteria | 173691 |
| 278 | Ga0209050_1000375 | 3300025298 | Bacteria | 84503 |
| 279 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 280 | Ga0209051_1000966 | 3300025303 | Bacteria | 28138 |
| 281 | Ga0209257_1000164 | 3300025304 | Bacteria | 173339 |
| 282 | Ga0209257_1010140 | 3300025304 | Bacteria | 4853 |
| 283 | Ga0207697_10001788 | 3300025315 | Bacteria | 11507 |
| 284 | Ga0207656_10002966 | 3300025321 | Bacteria | 5794 |
| 285 | Ga0207656_10013321 | 3300025321 | Bacteria | 3141 |
| 286 | Ga0207696_1001974 | 3300025711 | Bacteria | 10408 |
| 287 | Ga0207713_1001813 | 3300025735 | Bacteria | 16314 |
| 288 | Ga0207713_1026935 | 3300025735 | Bacteria | 2621 |
| 289 | Ga0207682_10001492 | 3300025893 | Bacteria | 10804 |
| 290 | Ga0207710_10003665 | 3300025900 | Bacteria | 6814 |
| 291 | Ga0207688_10028868 | 3300025901 | Bacteria | 3051 |
| 292 | Ga0207680_10070228 | 3300025903 | Bacteria | 2167 |
| 293 | Ga0207647_10002484 | 3300025904 | Bacteria | 13964 |
| 294 | Ga0207647_10005479 | 3300025904 | Bacteria | 9290 |
| 295 | Ga0207647_10008107 | 3300025904 | Bacteria | 7550 |
| 296 | Ga0207645_10001300 | 3300025907 | Bacteria | 20546 |
| 297 | Ga0207643_10002157 | 3300025908 | Bacteria | 10787 |
| 298 | Ga0207705_10000037 | 3300025909 | Bacteria | 197951 |
| 299 | Ga0207705_10001772 | 3300025909 | Bacteria | 17049 |
| 300 | Ga0207705_10020526 | 3300025909 | Bacteria | 4718 |
| 301 | Ga0207654_10002334 | 3300025911 | Bacteria | 9737 |
| 302 | Ga0207707_10053011 | 3300025912 | Bacteria | 3531 |
| 303 | Ga0207695_10001391 | 3300025913 | Bacteria | 40900 |
| 304 | Ga0207695_10014635 | 3300025913 | Bacteria | 9278 |
| 305 | Ga0207695_10022001 | 3300025913 | Bacteria | 7257 |
| 306 | Ga0207671_10000841 | 3300025914 | Bacteria | 38929 |
| 307 | Ga0207671_10016046 | 3300025914 | Bacteria | 5837 |
| 308 | Ga0207660_10087790 | 3300025917 | Bacteria | 2298 |
| 309 | Ga0207657_10000411 | 3300025919 | Bacteria | 45329 |
| 310 | Ga0207657_10000420 | 3300025919 | Bacteria | 45042 |
| 311 | Ga0207657_10002193 | 3300025919 | Bacteria | 21169 |
| 312 | Ga0207657_10003249 | 3300025919 | Bacteria | 17400 |
| 313 | Ga0207657_10009446 | 3300025919 | Bacteria | 9797 |
| 314 | Ga0207657_10009801 | 3300025919 | Bacteria | 9602 |
| 315 | Ga0207657_10010428 | 3300025919 | Bacteria | 9275 |
| 316 | Ga0207657_10033891 | 3300025919 | Bacteria | 4598 |
| 317 | Ga0207657_10044982 | 3300025919 | Bacteria | 3877 |
| 318 | Ga0207649_10002157 | 3300025920 | Bacteria | 11132 |
| 319 | Ga0207649_10021387 | 3300025920 | Bacteria | 3723 |
| 320 | Ga0207649_10026496 | 3300025920 | Bacteria | 3392 |
| 321 | Ga0207652_10006580 | 3300025921 | Bacteria | 9368 |
| 322 | Ga0207681_10000086 | 3300025923 | Bacteria | 81919 |
| 323 | Ga0207681_10000852 | 3300025923 | Bacteria | 20044 |
| 324 | Ga0207681_10001199 | 3300025923 | Bacteria | 16657 |
| 325 | Ga0207681_10001437 | 3300025923 | Bacteria | 15337 |
| 326 | Ga0207681_10006062 | 3300025923 | Bacteria | 7414 |
| 327 | Ga0207681_10006088 | 3300025923 | Bacteria | 7401 |
| 328 | Ga0207694_10009370 | 3300025924 | Bacteria | 7385 |
| 329 | Ga0207694_10061446 | 3300025924 | Bacteria | 2924 |
| 330 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 331 | Ga0207650_10002924 | 3300025925 | Bacteria | 11785 |
| 332 | Ga0207650_10060896 | 3300025925 | Bacteria | 2817 |
| 333 | Ga0207659_10004068 | 3300025926 | Bacteria | 8823 |
| 334 | Ga0207659_10008529 | 3300025926 | Bacteria | 6371 |
| 335 | Ga0207687_10004556 | 3300025927 | Bacteria | 9223 |
| 336 | Ga0207687_10012191 | 3300025927 | Bacteria | 5623 |
| 337 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 338 | Ga0207644_10000022 | 3300025931 | Bacteria | 160689 |
| 339 | Ga0207644_10000064 | 3300025931 | Bacteria | 77442 |
| 340 | Ga0207644_10000519 | 3300025931 | Bacteria | 24938 |
| 341 | Ga0207644_10004497 | 3300025931 | Bacteria | 9058 |
| 342 | Ga0207644_10005466 | 3300025931 | Bacteria | 8274 |
| 343 | Ga0207644_10019920 | 3300025931 | Bacteria | 4556 |
| 344 | Ga0207690_10000043 | 3300025932 | Bacteria | 119547 |
| 345 | Ga0207690_10001598 | 3300025932 | Bacteria | 14142 |
| 346 | Ga0207690_10019935 | 3300025932 | Bacteria | 4135 |
| 347 | Ga0207706_10000008 | 3300025933 | Bacteria | 201940 |
| 348 | Ga0207706_10000468 | 3300025933 | Bacteria | 43144 |
| 349 | Ga0207706_10007150 | 3300025933 | Bacteria | 10323 |
| 350 | Ga0207686_10000332 | 3300025934 | Bacteria | 34076 |
| 351 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 352 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 353 | Ga0207704_10036911 | 3300025938 | Bacteria | 2817 |
| 354 | Ga0207691_10008219 | 3300025940 | Bacteria | 10024 |
| 355 | Ga0207691_10017270 | 3300025940 | Bacteria | 6844 |
| 356 | Ga0207711_10014352 | 3300025941 | Bacteria | 6579 |
| 357 | Ga0207711_10024546 | 3300025941 | Bacteria | 5053 |
| 358 | Ga0207711_10036124 | 3300025941 | Bacteria | 4191 |
| 359 | Ga0207711_10044496 | 3300025941 | Bacteria | 3790 |
| 360 | Ga0207711_10186484 | 3300025941 | Bacteria | 1888 |
| 361 | Ga0207689_10000320 | 3300025942 | Bacteria | 44520 |
| 362 | Ga0207689_10004290 | 3300025942 | Bacteria | 12980 |
| 363 | Ga0207679_10007633 | 3300025945 | Bacteria | 6871 |
| 364 | Ga0207679_10011729 | 3300025945 | Bacteria | 5690 |
| 365 | Ga0207679_10035026 | 3300025945 | Bacteria | 3548 |
| 366 | Ga0207679_10108454 | 3300025945 | Bacteria | 2186 |
| 367 | Ga0207667_10002837 | 3300025949 | Bacteria | 21521 |
| 368 | Ga0207667_10006744 | 3300025949 | Bacteria | 13859 |
| 369 | Ga0207667_10007432 | 3300025949 | Bacteria | 13166 |
| 370 | Ga0207667_10014312 | 3300025949 | Bacteria | 9047 |
| 371 | Ga0207667_10016198 | 3300025949 | Bacteria | 8427 |
| 372 | Ga0207667_10033936 | 3300025949 | Bacteria | 5482 |
| 373 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 374 | Ga0207712_10000045 | 3300025961 | Bacteria | 168093 |
| 375 | Ga0207712_10085225 | 3300025961 | Bacteria | 2311 |
| 376 | Ga0207668_10000024 | 3300025972 | Bacteria | 131871 |
| 377 | Ga0207668_10000265 | 3300025972 | Bacteria | 34885 |
| 378 | Ga0207668_10000477 | 3300025972 | Bacteria | 25111 |
| 379 | Ga0207668_10002663 | 3300025972 | Bacteria | 10447 |
| 380 | Ga0207668_10002922 | 3300025972 | Bacteria | 10023 |
| 381 | Ga0207668_10003827 | 3300025972 | Bacteria | 8868 |
| 382 | Ga0207640_10002020 | 3300025981 | Bacteria | 10959 |
| 383 | Ga0207640_10018413 | 3300025981 | Bacteria | 4105 |
| 384 | Ga0207640_10033847 | 3300025981 | Bacteria | 3183 |
| 385 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 386 | Ga0207658_10000074 | 3300025986 | Bacteria | 110470 |
| 387 | Ga0207658_10000258 | 3300025986 | Bacteria | 55336 |
| 388 | Ga0207658_10001286 | 3300025986 | Bacteria | 19856 |
| 389 | Ga0207658_10062849 | 3300025986 | Bacteria | 2780 |
| 390 | Ga0207658_10067791 | 3300025986 | Bacteria | 2689 |
| 391 | Ga0207677_10000373 | 3300026023 | Bacteria | 31103 |
| 392 | Ga0207703_10000409 | 3300026035 | Bacteria | 45646 |
| 393 | Ga0207703_10004419 | 3300026035 | Bacteria | 11551 |
| 394 | Ga0207703_10004594 | 3300026035 | Bacteria | 11298 |
| 395 | Ga0207703_10007127 | 3300026035 | Bacteria | 8894 |
| 396 | Ga0207703_10008781 | 3300026035 | Bacteria | 7969 |
| 397 | Ga0207703_10009066 | 3300026035 | Bacteria | 7832 |
| 398 | Ga0207703_10128630 | 3300026035 | Bacteria | 2184 |
| 399 | Ga0207639_10000148 | 3300026041 | Bacteria | 52602 |
| 400 | Ga0207639_10004141 | 3300026041 | Bacteria | 9762 |
| 401 | Ga0207639_10009358 | 3300026041 | Bacteria | 6755 |
| 402 | Ga0207639_10016645 | 3300026041 | Bacteria | 5206 |
| 403 | Ga0207639_10033804 | 3300026041 | Bacteria | 3775 |
| 404 | Ga0207639_10035712 | 3300026041 | Bacteria | 3679 |
| 405 | Ga0207678_10000979 | 3300026067 | Bacteria | 26012 |
| 406 | Ga0207678_10010235 | 3300026067 | Bacteria | 8233 |
| 407 | Ga0207678_10038771 | 3300026067 | Bacteria | 4138 |
| 408 | Ga0207708_10027763 | 3300026075 | Bacteria | 4286 |
| 409 | Ga0207702_10001863 | 3300026078 | Bacteria | 20726 |
| 410 | Ga0207702_10002491 | 3300026078 | Bacteria | 17390 |
| 411 | Ga0207702_10003048 | 3300026078 | Bacteria | 15571 |
| 412 | Ga0207702_10003563 | 3300026078 | Bacteria | 14163 |
| 413 | Ga0207702_10009519 | 3300026078 | Bacteria | 8158 |
| 414 | Ga0207641_10000181 | 3300026088 | Bacteria | 87655 |
| 415 | Ga0207641_10000182 | 3300026088 | Bacteria | 87316 |
| 416 | Ga0207641_10000475 | 3300026088 | Bacteria | 45483 |
| 417 | Ga0207641_10000883 | 3300026088 | Bacteria | 31302 |
| 418 | Ga0207641_10001052 | 3300026088 | Bacteria | 27867 |
| 419 | Ga0207641_10001652 | 3300026088 | Bacteria | 21776 |
| 420 | Ga0207641_10003573 | 3300026088 | Bacteria | 13744 |
| 421 | Ga0207641_10005539 | 3300026088 | Bacteria | 10768 |
| 422 | Ga0207641_10006378 | 3300026088 | Bacteria | 9956 |
| 423 | Ga0207641_10014944 | 3300026088 | Bacteria | 6364 |
| 424 | Ga0207641_10089695 | 3300026088 | Bacteria | 2687 |
| 425 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 426 | Ga0207648_10017375 | 3300026089 | Bacteria | 6546 |
| 427 | Ga0207648_10021177 | 3300026089 | Bacteria | 5845 |
| 428 | Ga0207648_10047574 | 3300026089 | Bacteria | 3759 |
| 429 | Ga0207676_10000150 | 3300026095 | Bacteria | 60517 |
| 430 | Ga0207676_10000264 | 3300026095 | Bacteria | 45636 |
| 431 | Ga0207676_10000760 | 3300026095 | Bacteria | 25233 |
| 432 | Ga0207676_10001380 | 3300026095 | Bacteria | 18070 |
| 433 | Ga0207676_10001593 | 3300026095 | Bacteria | 16712 |
| 434 | Ga0207676_10003418 | 3300026095 | Bacteria | 11228 |
| 435 | Ga0207676_10005802 | 3300026095 | Bacteria | 8728 |
| 436 | Ga0207676_10090832 | 3300026095 | Bacteria | 2507 |
| 437 | Ga0207674_10025066 | 3300026116 | Bacteria | 6365 |
| 438 | Ga0207674_10029609 | 3300026116 | Bacteria | 5764 |
| 439 | Ga0207674_10039815 | 3300026116 | Bacteria | 4870 |
| 440 | Ga0207674_10081160 | 3300026116 | Bacteria | 3245 |
| 441 | Ga0207675_100000294 | 3300026118 | Bacteria | 48163 |
| 442 | Ga0207675_100016625 | 3300026118 | Bacteria | 6872 |
| 443 | Ga0207698_10000119 | 3300026142 | Bacteria | 49217 |
| 444 | Ga0207698_10000397 | 3300026142 | Bacteria | 25102 |
| 445 | Ga0207698_10001985 | 3300026142 | Bacteria | 12034 |
| 446 | Ga0207698_10047994 | 3300026142 | Bacteria | 3239 |
| 447 | Ga0209813_10000103 | 3300027866 | Bacteria | 31517 |
| 448 | Ga0209974_10000461 | 3300027876 | Bacteria | 13511 |
| 449 | Ga0209974_10005517 | 3300027876 | Bacteria | 4446 |
| 450 | Ga0209974_10025420 | 3300027876 | Bacteria | 1960 |
| 451 | Ga0209974_10029771 | 3300027876 | Bacteria | 1809 |
| 452 | Ga0207428_10030840 | 3300027907 | Bacteria | 4429 |
| 453 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 454 | Ga0268266_10003322 | 3300028379 | Bacteria | 16142 |
| 455 | Ga0268266_10009483 | 3300028379 | Bacteria | 8565 |
| 456 | Ga0268266_10017214 | 3300028379 | Bacteria | 6172 |
| 457 | Ga0268266_10018632 | 3300028379 | Bacteria | 5915 |
| 458 | Ga0268265_10000049 | 3300028380 | Bacteria | 177242 |
| 459 | Ga0268265_10000204 | 3300028380 | Bacteria | 68890 |
| 460 | Ga0268265_10005194 | 3300028380 | Bacteria | 8921 |
| 461 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 462 | Ga0268264_10000071 | 3300028381 | Bacteria | 267236 |
| 463 | Ga0268264_10000126 | 3300028381 | Bacteria | 186138 |
| 464 | Ga0268264_10000161 | 3300028381 | Bacteria | 150917 |
| 465 | Ga0268264_10003264 | 3300028381 | Bacteria | 14019 |
| 466 | Ga0268264_10007232 | 3300028381 | Bacteria | 9297 |
| 467 | Ga0268264_10008585 | 3300028381 | Bacteria | 8488 |
| 468 | Ga0268264_10015699 | 3300028381 | Bacteria | 6203 |
| 469 | Ga0268264_10029464 | 3300028381 | Bacteria | 4496 |
| 470 | Ga0265331_10000407 | 3300031250 | Bacteria | 44156 |
| 471 | Ga0265327_10000772 | 3300031251 | Bacteria | 49388 |
| 472 | Ga0307508_10007169 | 3300031616 | Bacteria | 10381 |
| 473 | Ga0307405_10006017 | 3300031731 | Bacteria | 5926 |
| 474 | Ga0307413_10001785 | 3300031824 | Bacteria | 8421 |
| 475 | Ga0307413_10001824 | 3300031824 | Bacteria | 8370 |
| 476 | Ga0307413_10031204 | 3300031824 | Bacteria | 3004 |
| 477 | Ga0307410_10002237 | 3300031852 | Bacteria | 9240 |
| 478 | Ga0307410_10009198 | 3300031852 | Bacteria | 5528 |
| 479 | Ga0307410_10017409 | 3300031852 | Bacteria | 4315 |
| 480 | Ga0307407_10008356 | 3300031903 | Bacteria | 4745 |
| 481 | Ga0307412_10000638 | 3300031911 | Bacteria | 20422 |
| 482 | Ga0307412_10014986 | 3300031911 | Bacteria | 4584 |
| 483 | Ga0307412_10024421 | 3300031911 | Bacteria | 3730 |
| 484 | Ga0307412_10048275 | 3300031911 | Bacteria | 2799 |
| 485 | Ga0307409_100030858 | 3300031995 | Bacteria | 3858 |
| 486 | Ga0307416_100205399 | 3300032002 | Bacteria | 1873 |
| 487 | Ga0307414_10000068 | 3300032004 | Bacteria | 100925 |
| 488 | Ga0307414_10003981 | 3300032004 | Bacteria | 7970 |
| 489 | Ga0307414_10016298 | 3300032004 | Bacteria | 4514 |
| 490 | Ga0307414_10051280 | 3300032004 | Bacteria | 2863 |
| 491 | Ga0307411_10034443 | 3300032005 | Bacteria | 3152 |
| 492 | Ga0307510_10000248 | 3300033180 | Bacteria | 48764 |
| 493 | Ga0373937_0134922 | 3300036401 | Bacteria | 2307 |
| 494 | Ga0316584_0012532 | 3300036712 | Bacteria | 5981 |
| 495 | Ga0316584_0127739 | 3300036712 | Bacteria | 1899 |
| 496 | Ga0373925_0116431 | 3300037068 | Bacteria | 2070 |
| 497 | Ga0395900_0014312 | 3300037418 | Bacteria | 8098 |
| 498 | Ga0395905_0053716 | 3300037471 | Bacteria | 3770 |
| 499 | Ga0395905_0182990 | 3300037471 | Bacteria | 1967 |
| 500 | Ga0395901_0117983 | 3300038443 | Bacteria | 2788 |
| 501 | Ga0237819_00251 | 3300038705 | Bacteria | 19599 |
| 502 | Ga0400483_083742 | 3300039062 | Bacteria | 2652 |
| 503 | Ga0400483_165238 | 3300039062 | Bacteria | 3317 |
| 504 | Ga0400483_211635 | 3300039062 | Bacteria | 3498 |
| 505 | Ga0436365_1306047 | 3300039437 | Bacteria | 29268 |
| 506 | Ga0436360_0172898 | 3300039438 | Bacteria | 4819 |
| 507 | Ga0436361_0034567 | 3300039447 | Bacteria | 27864 |
| 508 | Ga0436361_1111514 | 3300039447 | Bacteria | 15305 |
| 509 | Ga0451576_0000030 | 3300045051 | Bacteria | 403352 |
| 510 | Ga0451576_0000165 | 3300045051 | Bacteria | 168085 |
| 511 | Ga0451576_0002914 | 3300045051 | Bacteria | 24364 |
| 512 | Ga0451576_0090232 | 3300045051 | Bacteria | 3188 |
| 513 | Ga0451576_0119414 | 3300045051 | Bacteria | 2745 |
| 514 | Ga0466967_0129519 | 3300045976 | Bacteria | 2341 |
| 515 | Ga0495627_000110 | 3300046453 | Bacteria | 101742 |
| 516 | Ga0495638_0000073 | 3300046460 | Bacteria | 164378 |
| 517 | Ga0495596_0001207 | 3300046500 | Bacteria | 15118 |
| 518 | Ga0495583_0000087 | 3300046506 | Bacteria | 164974 |
| 519 | Ga0495583_0005996 | 3300046506 | Bacteria | 8063 |
| 520 | Ga0495610_0000303 | 3300046512 | Bacteria | 51903 |
| 521 | Ga0495632_0000271 | 3300046519 | Bacteria | 51334 |
| 522 | Ga0495632_0001911 | 3300046519 | Bacteria | 16665 |
| 523 | Ga0495637_0000124 | 3300046520 | Bacteria | 57259 |
| 524 | Ga0495643_0000031 | 3300046522 | Bacteria | 257820 |
| 525 | Ga0495643_0000341 | 3300046522 | Bacteria | 63337 |
| 526 | Ga0495643_0022274 | 3300046522 | Bacteria | 3618 |
| 527 | Ga0495643_0026083 | 3300046522 | Bacteria | 3301 |
| 528 | Ga0495648_0000049 | 3300046524 | Bacteria | 164366 |
| 529 | Ga0495648_0004359 | 3300046524 | Bacteria | 12118 |
| 530 | Ga0495663_0000057 | 3300046525 | Bacteria | 51334 |
| 531 | Ga0495609_0004437 | 3300046538 | Bacteria | 7673 |
| 532 | Ga0495597_0005777 | 3300046542 | Bacteria | 6493 |
| 533 | Ga0495633_0000136 | 3300046558 | Bacteria | 97314 |
| 534 | Ga0495633_0003341 | 3300046558 | Bacteria | 10772 |
| 535 | Ga0495625_0000223 | 3300046660 | Bacteria | 89528 |
| 536 | Ga0495625_0027078 | 3300046660 | Bacteria | 4321 |
| 537 | Ga0495625_0030398 | 3300046660 | Bacteria | 4031 |
| 538 | Ga0495671_0000021 | 3300046692 | Bacteria | 257820 |
| 539 | Ga0495671_0000042 | 3300046692 | Bacteria | 165201 |
| 540 | Ga0495673_0000111 | 3300047469 | Bacteria | 164974 |
| 541 | Ga0495673_0029254 | 3300047469 | Bacteria | 2602 |
| 542 | Ga0495681_0023806 | 3300047470 | Bacteria | 3241 |
| 543 | Ga0495686_0002043 | 3300047472 | Bacteria | 19878 |
| 544 | Ga0495615_0000272 | 3300048090 | Bacteria | 9629 |
| 545 | Ga0496101_0010420 | 3300048904 | Bacteria | 6138 |
| 546 | Ga0496102_0000377 | 3300048905 | Bacteria | 53437 |
| 547 | Ga0496102_0000472 | 3300048905 | Bacteria | 44602 |
| 548 | Ga0496102_0055787 | 3300048905 | Bacteria | 3603 |
| 549 | Ga0496103_0000128 | 3300048906 | Bacteria | 81657 |
| 550 | Ga0496103_0000318 | 3300048906 | Bacteria | 44504 |
| 551 | Ga0496104_0000205 | 3300048907 | Bacteria | 52752 |
| 552 | Ga0496105_0000817 | 3300048908 | Bacteria | 21106 |
| 553 | Ga0496105_0001478 | 3300048908 | Bacteria | 16579 |
| 554 | Ga0496106_0003228 | 3300048909 | Bacteria | 12206 |
| 555 | Ga0496108_0008916 | 3300048911 | Bacteria | 8129 |
| 556 | Ga0496110_0004898 | 3300048913 | Bacteria | 10446 |
| 557 | Ga0496110_0023687 | 3300048913 | Bacteria | 5223 |
| 558 | Ga0496113_0006055 | 3300048916 | Bacteria | 7622 |
| 559 | Ga0496113_0007493 | 3300048916 | Bacteria | 7029 |
| 560 | Ga0496114_0013350 | 3300048917 | Bacteria | 6585 |
| 561 | Ga0496116_0001661 | 3300048919 | Bacteria | 24466 |
| 562 | Ga0496116_0036219 | 3300048919 | Bacteria | 3456 |
| 563 | Ga0496117_0000946 | 3300048920 | Bacteria | 44400 |
| 564 | Ga0496117_0001317 | 3300048920 | Bacteria | 36512 |
| 565 | Ga0496117_0006093 | 3300048920 | Bacteria | 12350 |
| 566 | Ga0496118_0000122 | 3300048921 | Bacteria | 137396 |
| 567 | Ga0496118_0000133 | 3300048921 | Bacteria | 131319 |
| 568 | Ga0496118_0043238 | 3300048921 | Bacteria | 3543 |
| 569 | Ga0496118_0049609 | 3300048921 | Bacteria | 3231 |
| 570 | Ga0496119_0002177 | 3300048922 | Bacteria | 21974 |
| 571 | Ga0496119_0030059 | 3300048922 | Bacteria | 3669 |
| 572 | Ga0496120_0001695 | 3300048923 | Bacteria | 25248 |
| 573 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 574 | Ga0496121_0000274 | 3300048924 | Bacteria | 107140 |
| 575 | Ga0496121_0006631 | 3300048924 | Bacteria | 14254 |
| 576 | Ga0496121_0034147 | 3300048924 | Bacteria | 4583 |
| 577 | Ga0496122_0001014 | 3300048925 | Bacteria | 49714 |
| 578 | Ga0496123_0000212 | 3300048926 | Bacteria | 118628 |
| 579 | Ga0496123_0001685 | 3300048926 | Bacteria | 29584 |
| 580 | Ga0496123_0023585 | 3300048926 | Bacteria | 4705 |
| 581 | Ga0496124_0000359 | 3300048927 | Bacteria | 83092 |
| 582 | Ga0496124_0000417 | 3300048927 | Bacteria | 76104 |
| 583 | Ga0496124_0016020 | 3300048927 | Bacteria | 7155 |
| 584 | Ga0496125_0006733 | 3300048928 | Bacteria | 12350 |
| 585 | Ga0496125_0012254 | 3300048928 | Bacteria | 8525 |
| 586 | Ga0496126_0000493 | 3300048929 | Bacteria | 77742 |
| 587 | Ga0496126_0002202 | 3300048929 | Bacteria | 27029 |
| 588 | Ga0501297_000522 | 3300049520 | Bacteria | 3465 |
| 589 | Ga0501301_000368 | 3300049524 | Bacteria | 2659 |
| 590 | Ga0501032_0000520 | 3300049569 | Bacteria | 31263 |
| 591 | Ga0501032_0018313 | 3300049569 | Bacteria | 4907 |
| 592 | Ga0501033_0002279 | 3300049570 | Bacteria | 16402 |
| 593 | Ga0501034_0002321 | 3300049571 | Bacteria | 23230 |
| 594 | Ga0501034_0007640 | 3300049571 | Bacteria | 11500 |
| 595 | Ga0501034_0029689 | 3300049571 | Bacteria | 5558 |
| 596 | Ga0501034_0142595 | 3300049571 | Bacteria | 2374 |
| 597 | Ga0501034_0153285 | 3300049571 | Bacteria | 2280 |
| 598 | Ga0501034_0263072 | 3300049571 | Bacteria | 1667 |
| 599 | Ga0501036_0000152 | 3300049572 | Bacteria | 45346 |
| 600 | Ga0501037_0000029 | 3300049573 | Bacteria | 139680 |
| 601 | Ga0501037_0018342 | 3300049573 | Bacteria | 5157 |
| 602 | Ga0501038_0000263 | 3300049574 | Bacteria | 44382 |
| 603 | Ga0501039_0000043 | 3300049575 | Bacteria | 109462 |
| 604 | Ga0501041_0056358 | 3300049577 | Bacteria | 2401 |
| 605 | Ga0501043_0000260 | 3300049579 | Bacteria | 48057 |
| 606 | Ga0501047_0102959 | 3300049581 | Bacteria | 2735 |
| 607 | Ga0501048_0032878 | 3300049582 | Bacteria | 3748 |
| 608 | Ga0501071_0018169 | 3300049587 | Bacteria | 4863 |
| 609 | Ga0501075_0036168 | 3300049591 | Bacteria | 3685 |
| 610 | Ga0501077_0018628 | 3300049593 | Bacteria | 4390 |
| 611 | Ga0501223_000060 | 3300049663 | Bacteria | 35869 |
| 612 | Ga0501223_000124 | 3300049663 | Bacteria | 22060 |
| 613 | Ga0501224_000003 | 3300049664 | Bacteria | 189031 |
| 614 | Ga0501224_000724 | 3300049664 | Bacteria | 4136 |
| 615 | Ga0501227_001028 | 3300049665 | Bacteria | 6189 |
| 616 | Ga0501233_001151 | 3300049668 | Bacteria | 4499 |
| 617 | Ga0501233_001401 | 3300049668 | Bacteria | 4120 |
| 618 | Ga0501235_000862 | 3300049669 | Bacteria | 6208 |
| 619 | Ga0501236_000422 | 3300049670 | Bacteria | 4774 |
| 620 | Ga0501246_000266 | 3300049676 | Bacteria | 3577 |
| 621 | Ga0501257_002742 | 3300049686 | Bacteria | 3724 |
| 622 | Ga0501259_001664 | 3300049688 | Bacteria | 3704 |
| 623 | Ga0501261_000053 | 3300049690 | Bacteria | 22071 |
| 624 | Ga0501225_0000001 | 3300049705 | Bacteria | 185804 |
| 625 | Ga0501225_0000021 | 3300049705 | Bacteria | 57397 |
| 626 | Ga0501234_000627 | 3300049707 | Bacteria | 5434 |
| 627 | Ga0501245_000181 | 3300049708 | Bacteria | 6954 |
| 628 | Ga0501081_0124080 | 3300049743 | Bacteria | 1841 |
| 629 | Ga0501279_000005 | 3300049775 | Bacteria | 153858 |
| 630 | Ga0501280_000012 | 3300049776 | Bacteria | 60067 |
| 631 | Ga0501281_00005 | 3300049777 | Bacteria | 36194 |
| 632 | Ga0501282_000420 | 3300049778 | Bacteria | 5006 |
| 633 | Ga0501283_000558 | 3300049779 | Bacteria | 4889 |
| 634 | Ga0501035_0000057 | 3300049822 | Bacteria | 135297 |
| 635 | Ga0501035_0048671 | 3300049822 | Bacteria | 3801 |
| 636 | Ga0501226_000013 | 3300049853 | Bacteria | 175177 |
| 637 | nmdc:mga03683_35_c1 | 3300050489 | Bacteria | 65966 |
| 638 | nmdc:mga03683_8140_c1 | 3300050489 | Bacteria | 3672 |
| 639 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 640 | nmdc:mga0k408_45325_c1 | 3300050493 | Bacteria | 2537 |
| 641 | nmdc:mga06z11_342_c1 | 3300050494 | Bacteria | 17626 |
| 642 | nmdc:mga04h51_239_c1 | 3300050495 | Bacteria | 14433 |
| 643 | nmdc:mga07m45_18364_c1 | 3300050496 | Bacteria | 3773 |
| 644 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 645 | nmdc:mga0qj67_107065_c1 | 3300050509 | Bacteria | 2255 |
| 646 | nmdc:mga0qj67_24755_c1 | 3300050509 | Bacteria | 4631 |
| 647 | nmdc:mga0qj67_3082_c1 | 3300050509 | Bacteria | 11978 |
| 648 | nmdc:mga0sz30_261_c1 | 3300050516 | Bacteria | 20355 |
| 649 | Ga0500643_000637 | 3300053087 | Bacteria | 23631 |
| 650 | Ga0500643_001993 | 3300053087 | Bacteria | 11040 |
| 651 | Ga0500643_004215 | 3300053087 | Bacteria | 6587 |
| 652 | Ga0500651_0004436 | 3300053093 | Bacteria | 7858 |
| 653 | Ga0500566_0004023 | 3300053094 | Bacteria | 8769 |
| 654 | Ga0500641_0007464 | 3300053096 | Bacteria | 3901 |
| 655 | Ga0500556_0000031 | 3300053104 | Bacteria | 156000 |
| 656 | Ga0500592_001795 | 3300053116 | Bacteria | 3469 |
| 657 | Ga0500595_005197 | 3300053119 | Bacteria | 5709 |
| 658 | Ga0500595_005315 | 3300053119 | Bacteria | 5638 |
| 659 | Ga0500607_069886 | 3300053121 | Bacteria | 1816 |
| 660 | Ga0500608_000988 | 3300053122 | Bacteria | 10224 |
| 661 | Ga0500618_000553 | 3300053125 | Bacteria | 23228 |
| 662 | Ga0500618_003126 | 3300053125 | Bacteria | 5828 |
| 663 | Ga0500642_0003588 | 3300053130 | Bacteria | 4715 |
| 664 | Ga0500655_000039 | 3300053133 | Bacteria | 36929 |
| 665 | Ga0500559_0000006 | 3300053136 | Bacteria | 229895 |
| 666 | Ga0500568_0000312 | 3300053139 | Bacteria | 38588 |
| 667 | Ga0500590_023710 | 3300053148 | Bacteria | 3184 |
| 668 | Ga0500604_0000009 | 3300053151 | Bacteria | 112387 |
| 669 | Ga0500616_0000119 | 3300053153 | Bacteria | 143264 |
| 670 | Ga0500616_0026039 | 3300053153 | Bacteria | 3242 |
| 671 | Ga0500622_0002897 | 3300053156 | Bacteria | 11966 |
| 672 | Ga0500627_0000020 | 3300053158 | Bacteria | 109977 |
| 673 | Ga0500570_000154 | 3300053724 | Bacteria | 21218 |
| 674 | Ga0500625_000030 | 3300053729 | Bacteria | 51482 |
| 675 | Ga0501084_0046920 | 3300054114 | Bacteria | 3618 |
| 676 | Ga0501082_0038754 | 3300060353 | Bacteria | 4110 |
| 677 | Ga0530510_0073584 | 3300061734 | Bacteria | 2480 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003775 | Ga0055524_1000038 | Ga0055524_100003885 | 458 |
| 2 | iso_pu_bacteria | 8019597564 | 8019599016 | 458 |
| 3 | 3300036712 | Ga0316584_0127739 | Ga0316584_0127739_98_1543 | 461 |
| 4 | 3300026089 | Ga0207648_10017375 | Ga0207648_100173758 | 464 |
| 5 | 3300031250 | Ga0265331_10000407 | Ga0265331_1000040734 | 464 |
| 6 | 3300037418 | Ga0395900_0014312 | Ga0395900_0014312_650_2089 | 464 |
| 7 | 3300053119 | Ga0500595_005315 | Ga0500595_005315_2680_4119 | 464 |
| 8 | 3300053121 | Ga0500607_069886 | Ga0500607_069886_227_1675 | 464 |
| 9 | 3300037471 | Ga0395905_0182990 | Ga0395905_0182990_61_1512 | 465 |
| 10 | 3300005331 | Ga0070670_100002673 | Ga0070670_10000267311 | 467 |
| 11 | 3300005354 | Ga0070675_100003762 | Ga0070675_10000376211 | 467 |
| 12 | 3300005618 | Ga0068864_100001909 | Ga0068864_10000190914 | 467 |
| 13 | 3300005841 | Ga0068863_100003624 | Ga0068863_1000036247 | 467 |
| 14 | 3300026088 | Ga0207641_10003573 | Ga0207641_1000357313 | 467 |
| 15 | 3300026095 | Ga0207676_10001593 | Ga0207676_100015939 | 467 |
| 16 | 3300025940 | Ga0207691_10008219 | Ga0207691_100082195 | 468 |
| 17 | 3300037068 | Ga0373925_0116431 | Ga0373925_0116431_295_1746 | 468 |
| 18 | iso_pu_bacteria | 2883291878 | 2883292559 | 468 |
| 19 | iso_pu_bacteria | 2922130491 | 2922135954 | 468 |
| 20 | 3300021361 | Ga0213872_10006039 | Ga0213872_100060392 | 469 |
| 21 | 3300039447 | Ga0436361_1111514 | Ga0436361_1111514_9346_10785 | 469 |
| 22 | 3300005445 | Ga0070708_100001167 | Ga0070708_10000116720 | 470 |
| 23 | 3300005548 | Ga0070665_100075497 | Ga0070665_1000754972 | 470 |
| 24 | 3300025941 | Ga0207711_10044496 | Ga0207711_100444965 | 470 |
| 25 | 3300021361 | Ga0213872_10000842 | Ga0213872_100008424 | 471 |
| 26 | 3300021361 | Ga0213872_10000876 | Ga0213872_100008766 | 471 |
| 27 | 3300021361 | Ga0213872_10051771 | Ga0213872_100517711 | 471 |
| 28 | 3300039447 | Ga0436361_0034567 | Ga0436361_0034567_22494_23939 | 471 |
| 29 | 3300039438 | Ga0436360_0172898 | Ga0436360_0172898_2741_4201 | 472 |
| 30 | iso_pu_bacteria | 2513237103 | 2513714395 | 472 |
| 31 | iso_pu_bacteria | 2960693952 | 2960696484 | 472 |
| 32 | 3300005339 | Ga0070660_100080017 | Ga0070660_1000800173 | 473 |
| 33 | 3300013104 | Ga0157370_10053116 | Ga0157370_100531164 | 473 |
| 34 | 3300013307 | Ga0157372_10310389 | Ga0157372_103103891 | 473 |
| 35 | 3300025919 | Ga0207657_10009446 | Ga0207657_100094462 | 473 |
| 36 | 3300049577 | Ga0501041_0056358 | Ga0501041_0056358_809_2266 | 474 |
| 37 | 3300049582 | Ga0501048_0032878 | Ga0501048_0032878_1054_2511 | 474 |
| 38 | 3300049587 | Ga0501071_0018169 | Ga0501071_0018169_2726_4183 | 474 |
| 39 | 3300049591 | Ga0501075_0036168 | Ga0501075_0036168_240_1697 | 474 |
| 40 | 3300049593 | Ga0501077_0018628 | Ga0501077_0018628_1603_3060 | 474 |
| 41 | 3300049743 | Ga0501081_0124080 | Ga0501081_0124080_143_1600 | 474 |
| 42 | 3300054114 | Ga0501084_0046920 | Ga0501084_0046920_1328_2785 | 474 |
| 43 | 3300060353 | Ga0501082_0038754 | Ga0501082_0038754_1408_2865 | 474 |
| 44 | 3300061734 | Ga0530510_0073584 | Ga0530510_0073584_900_2357 | 474 |
| 45 | 3300005335 | Ga0070666_10079009 | Ga0070666_100790092 | 475 |
| 46 | 3300005334 | Ga0068869_100000492 | Ga0068869_10000049213 | 476 |
| 47 | 3300005336 | Ga0070680_100076925 | Ga0070680_1000769254 | 476 |
| 48 | 3300005548 | Ga0070665_100028940 | Ga0070665_1000289403 | 476 |
| 49 | 3300005840 | Ga0068870_10069615 | Ga0068870_100696151 | 476 |
| 50 | 3300005842 | Ga0068858_100019496 | Ga0068858_1000194963 | 476 |
| 51 | 3300005843 | Ga0068860_100073083 | Ga0068860_1000730832 | 476 |
| 52 | 3300005844 | Ga0068862_100140492 | Ga0068862_1001404922 | 476 |
| 53 | 3300006237 | Ga0097621_100003378 | Ga0097621_1000033786 | 476 |
| 54 | 3300006358 | Ga0068871_100084964 | Ga0068871_1000849642 | 476 |
| 55 | 3300009098 | Ga0105245_10040363 | Ga0105245_100403634 | 476 |
| 56 | 3300009177 | Ga0105248_10005948 | Ga0105248_1000594810 | 476 |
| 57 | 3300013308 | Ga0157375_10005919 | Ga0157375_1000591910 | 476 |
| 58 | 3300014969 | Ga0157376_10003300 | Ga0157376_100033007 | 476 |
| 59 | 3300025938 | Ga0207704_10036911 | Ga0207704_100369114 | 476 |
| 60 | 3300025941 | Ga0207711_10024546 | Ga0207711_100245463 | 476 |
| 61 | 3300025942 | Ga0207689_10000320 | Ga0207689_1000032022 | 476 |
| 62 | 3300026035 | Ga0207703_10128630 | Ga0207703_101286301 | 476 |
| 63 | 3300027876 | Ga0209974_10000461 | Ga0209974_1000046114 | 476 |
| 64 | 3300005339 | Ga0070660_100000581 | Ga0070660_1000005813 | 478 |
| 65 | 3300005344 | Ga0070661_100005599 | Ga0070661_1000055995 | 478 |
| 66 | 3300005355 | Ga0070671_100002453 | Ga0070671_1000024534 | 478 |
| 67 | 3300005364 | Ga0070673_100013295 | Ga0070673_1000132956 | 478 |
| 68 | 3300005366 | Ga0070659_100001886 | Ga0070659_1000018863 | 478 |
| 69 | 3300005457 | Ga0070662_100000078 | Ga0070662_10000007838 | 478 |
| 70 | 3300005563 | Ga0068855_100004942 | Ga0068855_1000049425 | 478 |
| 71 | 3300005564 | Ga0070664_100009168 | Ga0070664_1000091682 | 478 |
| 72 | 3300005578 | Ga0068854_100135501 | Ga0068854_1001355013 | 478 |
| 73 | 3300005614 | Ga0068856_100009851 | Ga0068856_10000985111 | 478 |
| 74 | 3300013100 | Ga0157373_10001248 | Ga0157373_1000124826 | 478 |
| 75 | 3300013307 | Ga0157372_10000380 | Ga0157372_1000038019 | 478 |
| 76 | 3300025919 | Ga0207657_10000411 | Ga0207657_1000041119 | 478 |
| 77 | 3300025920 | Ga0207649_10021387 | Ga0207649_100213873 | 478 |
| 78 | 3300025926 | Ga0207659_10008529 | Ga0207659_100085296 | 478 |
| 79 | 3300025931 | Ga0207644_10004497 | Ga0207644_1000449710 | 478 |
| 80 | 3300025932 | Ga0207690_10001598 | Ga0207690_100015983 | 478 |
| 81 | 3300025933 | Ga0207706_10000008 | Ga0207706_10000008167 | 478 |
| 82 | 3300025945 | Ga0207679_10007633 | Ga0207679_100076338 | 478 |
| 83 | 3300025949 | Ga0207667_10002837 | Ga0207667_100028373 | 478 |
| 84 | 3300026041 | Ga0207639_10004141 | Ga0207639_100041419 | 478 |
| 85 | 3300026067 | Ga0207678_10010235 | Ga0207678_100102352 | 478 |
| 86 | 3300026078 | Ga0207702_10003563 | Ga0207702_100035634 | 478 |
| 87 | 3300027876 | Ga0209974_10029771 | Ga0209974_100297712 | 478 |
| 88 | 3300045051 | Ga0451576_0000030 | Ga0451576_0000030_213372_214838 | 478 |
| 89 | 3300045051 | Ga0451576_0090232 | Ga0451576_0090232_99_1580 | 478 |
| 90 | 3300046522 | Ga0495643_0026083 | Ga0495643_0026083_25_1500 | 479 |
| 91 | 3300050509 | nmdc:mga0qj67_24755_c1 | nmdc:mga0qj67_24755_c1_388_1860 | 479 |
| 92 | 3300005290 | Ga0065712_10077285 | Ga0065712_100772853 | 481 |
| 93 | 3300005328 | Ga0070676_10002350 | Ga0070676_100023506 | 481 |
| 94 | 3300005330 | Ga0070690_100006640 | Ga0070690_1000066403 | 481 |
| 95 | 3300005333 | Ga0070677_10011502 | Ga0070677_100115024 | 481 |
| 96 | 3300005334 | Ga0068869_100011811 | Ga0068869_1000118116 | 481 |
| 97 | 3300005347 | Ga0070668_100119687 | Ga0070668_1001196873 | 481 |
| 98 | 3300005353 | Ga0070669_100012646 | Ga0070669_1000126463 | 481 |
| 99 | 3300005354 | Ga0070675_100043868 | Ga0070675_1000438682 | 481 |
| 100 | 3300005364 | Ga0070673_100006904 | Ga0070673_1000069043 | 481 |
| 101 | 3300005365 | Ga0070688_100004092 | Ga0070688_1000040927 | 481 |
| 102 | 3300005438 | Ga0070701_10012016 | Ga0070701_100120163 | 481 |
| 103 | 3300005459 | Ga0068867_100037937 | Ga0068867_1000379374 | 481 |
| 104 | 3300005466 | Ga0070685_10004485 | Ga0070685_100044857 | 481 |
| 105 | 3300005539 | Ga0068853_100027833 | Ga0068853_1000278333 | 481 |
| 106 | 3300005543 | Ga0070672_100029364 | Ga0070672_1000293643 | 481 |
| 107 | 3300005548 | Ga0070665_100013687 | Ga0070665_1000136878 | 481 |
| 108 | 3300005577 | Ga0068857_100018857 | Ga0068857_1000188576 | 481 |
| 109 | 3300005616 | Ga0068852_100002270 | Ga0068852_1000022708 | 481 |
| 110 | 3300005617 | Ga0068859_100021839 | Ga0068859_1000218394 | 481 |
| 111 | 3300005618 | Ga0068864_100019221 | Ga0068864_1000192216 | 481 |
| 112 | 3300005840 | Ga0068870_10003032 | Ga0068870_100030328 | 481 |
| 113 | 3300005842 | Ga0068858_100006571 | Ga0068858_1000065714 | 481 |
| 114 | 3300005843 | Ga0068860_100063837 | Ga0068860_1000638371 | 481 |
| 115 | 3300006237 | Ga0097621_100039906 | Ga0097621_1000399063 | 481 |
| 116 | 3300006358 | Ga0068871_100006581 | Ga0068871_1000065815 | 481 |
| 117 | 3300006931 | Ga0097620_100021839 | Ga0097620_1000218394 | 481 |
| 118 | 3300013105 | Ga0157369_10117510 | Ga0157369_101175101 | 481 |
| 119 | 3300013296 | Ga0157374_10005259 | Ga0157374_100052594 | 481 |
| 120 | 3300014325 | Ga0163163_10100720 | Ga0163163_101007202 | 481 |
| 121 | 3300014326 | Ga0157380_10153231 | Ga0157380_101532313 | 481 |
| 122 | 3300014968 | Ga0157379_10035140 | Ga0157379_100351405 | 481 |
| 123 | 3300025315 | Ga0207697_10001788 | Ga0207697_1000178810 | 481 |
| 124 | 3300025893 | Ga0207682_10001492 | Ga0207682_100014924 | 481 |
| 125 | 3300025901 | Ga0207688_10028868 | Ga0207688_100288684 | 481 |
| 126 | 3300025908 | Ga0207643_10002157 | Ga0207643_1000215710 | 481 |
| 127 | 3300025925 | Ga0207650_10060896 | Ga0207650_100608961 | 481 |
| 128 | 3300025926 | Ga0207659_10004068 | Ga0207659_100040688 | 481 |
| 129 | 3300025933 | Ga0207706_10007150 | Ga0207706_100071509 | 481 |
| 130 | 3300025940 | Ga0207691_10017270 | Ga0207691_100172704 | 481 |
| 131 | 3300025945 | Ga0207679_10108454 | Ga0207679_101084541 | 481 |
| 132 | 3300025949 | Ga0207667_10033936 | Ga0207667_100339363 | 481 |
| 133 | 3300025981 | Ga0207640_10018413 | Ga0207640_100184133 | 481 |
| 134 | 3300026041 | Ga0207639_10016645 | Ga0207639_100166454 | 481 |
| 135 | 3300026075 | Ga0207708_10027763 | Ga0207708_100277632 | 481 |
| 136 | 3300026088 | Ga0207641_10089695 | Ga0207641_100896953 | 481 |
| 137 | 3300026089 | Ga0207648_10021177 | Ga0207648_100211774 | 481 |
| 138 | 3300026095 | Ga0207676_10005802 | Ga0207676_100058025 | 481 |
| 139 | 3300026116 | Ga0207674_10025066 | Ga0207674_100250668 | 481 |
| 140 | 3300026118 | Ga0207675_100016625 | Ga0207675_1000166258 | 481 |
| 141 | 3300036401 | Ga0373937_0134922 | Ga0373937_0134922_251_1744 | 481 |
| 142 | 3300048911 | Ga0496108_0008916 | Ga0496108_0008916_3871_5364 | 481 |
| 143 | 3300048913 | Ga0496110_0004898 | Ga0496110_0004898_141_1634 | 481 |
| 144 | 3300045976 | Ga0466967_0129519 | Ga0466967_0129519_302_1789 | 482 |
| 145 | 3300036712 | Ga0316584_0012532 | Ga0316584_0012532_2964_4451 | 483 |
| 146 | iso_pu_bacteria | 2842333319 | 2842338371 | 483 |
| 147 | 3300048922 | Ga0496119_0030059 | Ga0496119_0030059_220_1707 | 484 |
| 148 | 3300039437 | Ga0436365_1306047 | Ga0436365_1306047_22970_24472 | 489 |
| 149 | iso_pu_bacteria | 2513237305 | 2514423330 | 489 |
| 150 | iso_pu_bacteria | 2970136068 | 2970140363 | 489 |
| 151 | iso_pu_bacteria | 2844002411 | 2844006589 | 490 |
| 152 | iso_pu_bacteria | 2871466892 | 2871469906 | 490 |
| 153 | iso_pu_bacteria | 2924710171 | 2924715103 | 490 |
| 154 | 3300025941 | Ga0207711_10186484 | Ga0207711_101864841 | 501 |
| 155 | 3300049571 | Ga0501034_0263072 | Ga0501034_0263072_89_1648 | 508 |
| 156 | 3300049688 | Ga0501259_001664 | Ga0501259_001664_32_1612 | 508 |
| 157 | 3300031995 | Ga0307409_100030858 | Ga0307409_1000308582 | 509 |
| 158 | 3300006846 | Ga0075430_100003721 | Ga0075430_1000037215 | 510 |
| 159 | 3300031824 | Ga0307413_10001785 | Ga0307413_100017859 | 511 |
| 160 | 3300031852 | Ga0307410_10002237 | Ga0307410_1000223711 | 511 |
| 161 | 3300031903 | Ga0307407_10008356 | Ga0307407_100083563 | 511 |
| 162 | iso_pu_bacteria | 2899275550 | 2899279376 | 511 |
| 163 | 3300005618 | Ga0068864_100028820 | Ga0068864_1000288203 | 513 |
| 164 | 3300046660 | Ga0495625_0000223 | Ga0495625_0000223_49128_50834 | 513 |
| 165 | 3300025931 | Ga0207644_10005466 | Ga0207644_100054665 | 514 |
| 166 | 3300026095 | Ga0207676_10001380 | Ga0207676_1000138019 | 514 |
| 167 | 3300045051 | Ga0451576_0002914 | Ga0451576_0002914_13063_14661 | 515 |
| 168 | 3300046660 | Ga0495625_0030398 | Ga0495625_0030398_1975_3636 | 515 |
| 169 | 3300049569 | Ga0501032_0000520 | Ga0501032_0000520_24585_26225 | 515 |
| 170 | 3300049570 | Ga0501033_0002279 | Ga0501033_0002279_2840_4480 | 515 |
| 171 | 3300049571 | Ga0501034_0002321 | Ga0501034_0002321_16552_18192 | 515 |
| 172 | 3300049572 | Ga0501036_0000152 | Ga0501036_0000152_5748_7388 | 515 |
| 173 | 3300049573 | Ga0501037_0000029 | Ga0501037_0000029_96101_97741 | 515 |
| 174 | 3300049574 | Ga0501038_0000263 | Ga0501038_0000263_24457_26097 | 515 |
| 175 | 3300049575 | Ga0501039_0000043 | Ga0501039_0000043_96089_97729 | 515 |
| 176 | 3300049579 | Ga0501043_0000260 | Ga0501043_0000260_11322_12962 | 515 |
| 177 | 3300049822 | Ga0501035_0000057 | Ga0501035_0000057_96081_97721 | 515 |
| 178 | 3300050509 | nmdc:mga0qj67_3082_c1 | nmdc:mga0qj67_3082_c1_2989_4683 | 515 |
| 179 | 3300053087 | Ga0500643_004215 | Ga0500643_004215_3633_5294 | 515 |
| 180 | 3300053104 | Ga0500556_0000031 | Ga0500556_0000031_96981_98642 | 515 |
| 181 | iso_pu_bacteria | 2855020534 | 2855023013 | 515 |
| 182 | iso_pu_bacteria | 2919679072 | 2919679229 | 515 |
| 183 | 3300039062 | Ga0400483_083742 | Ga0400483_083742_811_2415 | 516 |
| 184 | 3300039062 | Ga0400483_165238 | Ga0400483_165238_569_2173 | 516 |
| 185 | 3300039062 | Ga0400483_211635 | Ga0400483_211635_437_2041 | 516 |
| 186 | iso_pu_bacteria | 2840878972 | 2840881430 | 516 |
| 187 | 3300009093 | Ga0105240_10008082 | Ga0105240_100080825 | 517 |
| 188 | 3300010375 | Ga0105239_10114605 | Ga0105239_101146052 | 517 |
| 189 | 3300005327 | Ga0070658_10005829 | Ga0070658_100058298 | 518 |
| 190 | 3300005335 | Ga0070666_10056526 | Ga0070666_100565262 | 518 |
| 191 | 3300005339 | Ga0070660_100009163 | Ga0070660_1000091634 | 518 |
| 192 | 3300005366 | Ga0070659_100003357 | Ga0070659_1000033576 | 518 |
| 193 | 3300005577 | Ga0068857_100007911 | Ga0068857_1000079116 | 518 |
| 194 | 3300010375 | Ga0105239_10006936 | Ga0105239_1000693612 | 518 |
| 195 | 3300025913 | Ga0207695_10022001 | Ga0207695_100220014 | 518 |
| 196 | 3300025919 | Ga0207657_10009801 | Ga0207657_100098016 | 518 |
| 197 | iso_pu_bacteria | 2834578030 | 2834579506 | 518 |
| 198 | 3300003775 | Ga0055524_1000221 | Ga0055524_10002214 | 519 |
| 199 | 3300025263 | Ga0209565_1000010 | Ga0209565_10000102 | 519 |
| 200 | 3300025299 | Ga0209256_1000012 | Ga0209256_1000012145 | 519 |
| 201 | iso_pu_bacteria | 2713897090 | 2715498869 | 519 |
| 202 | 3300005338 | Ga0068868_100127800 | Ga0068868_1001278002 | 520 |
| 203 | 3300025231 | Ga0207427_104089 | Ga0207427_1040892 | 521 |
| 204 | 3300025261 | Ga0209233_1000713 | Ga0209233_100071317 | 521 |
| 205 | 3300031251 | Ga0265327_10000772 | Ga0265327_100007729 | 521 |
| 206 | 3300005331 | Ga0070670_100041478 | Ga0070670_1000414783 | 522 |
| 207 | 3300005347 | Ga0070668_100018696 | Ga0070668_1000186962 | 522 |
| 208 | 3300005353 | Ga0070669_100001184 | Ga0070669_10000118410 | 522 |
| 209 | 3300005355 | Ga0070671_100007531 | Ga0070671_1000075319 | 522 |
| 210 | 3300005548 | Ga0070665_100000129 | Ga0070665_10000012986 | 522 |
| 211 | 3300005548 | Ga0070665_100000169 | Ga0070665_10000016953 | 522 |
| 212 | 3300005841 | Ga0068863_100025902 | Ga0068863_1000259024 | 522 |
| 213 | 3300009011 | Ga0105251_10003202 | Ga0105251_100032027 | 522 |
| 214 | 3300025735 | Ga0207713_1001813 | Ga0207713_100181310 | 522 |
| 215 | 3300025923 | Ga0207681_10001199 | Ga0207681_100011997 | 522 |
| 216 | 3300025931 | Ga0207644_10000519 | Ga0207644_1000051911 | 522 |
| 217 | 3300026088 | Ga0207641_10005539 | Ga0207641_100055397 | 522 |
| 218 | 3300027876 | Ga0209974_10025420 | Ga0209974_100254201 | 522 |
| 219 | 3300028379 | Ga0268266_10000019 | Ga0268266_10000019409 | 522 |
| 220 | 3300028379 | Ga0268266_10003322 | Ga0268266_100033222 | 522 |
| 221 | 3300028381 | Ga0268264_10015699 | Ga0268264_100156992 | 522 |
| 222 | 3300048919 | Ga0496116_0036219 | Ga0496116_0036219_855_2510 | 522 |
| 223 | 3300048921 | Ga0496118_0049609 | Ga0496118_0049609_288_1943 | 522 |
| 224 | 3300048924 | Ga0496121_0034147 | Ga0496121_0034147_1989_3644 | 522 |
| 225 | 3300048928 | Ga0496125_0012254 | Ga0496125_0012254_5767_7422 | 522 |
| 226 | 3300049571 | Ga0501034_0142595 | Ga0501034_0142595_537_2141 | 522 |
| 227 | 3300049571 | Ga0501034_0153285 | Ga0501034_0153285_382_1986 | 522 |
| 228 | 3300053094 | Ga0500566_0004023 | Ga0500566_0004023_274_1980 | 522 |
| 229 | 3300053139 | Ga0500568_0000312 | Ga0500568_0000312_30700_32367 | 522 |
| 230 | 3300053151 | Ga0500604_0000009 | Ga0500604_0000009_110372_112039 | 522 |
| 231 | 3300053153 | Ga0500616_0000119 | Ga0500616_0000119_59010_60677 | 522 |
| 232 | 3300003791 | Ga0055530_10004799 | Ga0055530_100047991 | 523 |
| 233 | 3300025292 | Ga0209676_1000311 | Ga0209676_100031153 | 523 |
| 234 | 3300025298 | Ga0209050_1000375 | Ga0209050_100037553 | 523 |
| 235 | 3300025303 | Ga0209051_1000966 | Ga0209051_100096614 | 523 |
| 236 | 3300025304 | Ga0209257_1010140 | Ga0209257_10101401 | 523 |
| 237 | 3300053136 | Ga0500559_0000006 | Ga0500559_0000006_84357_86015 | 523 |
| 238 | 3300002459 | JGI24751J29686_10000202 | JGI24751J29686_100002023 | 524 |
| 239 | 3300005331 | Ga0070670_100000339 | Ga0070670_10000033927 | 524 |
| 240 | 3300005367 | Ga0070667_100000390 | Ga0070667_10000039025 | 525 |
| 241 | 3300005841 | Ga0068863_100001079 | Ga0068863_1000010798 | 525 |
| 242 | 3300025913 | Ga0207695_10001391 | Ga0207695_1000139139 | 525 |
| 243 | 3300025931 | Ga0207644_10019920 | Ga0207644_100199202 | 525 |
| 244 | 3300025986 | Ga0207658_10001286 | Ga0207658_1000128614 | 525 |
| 245 | 3300026088 | Ga0207641_10014944 | Ga0207641_100149446 | 525 |
| 246 | 3300048924 | Ga0496121_0000274 | Ga0496121_0000274_64532_66181 | 526 |
| 247 | iso_pu_bacteria | 2919138771 | 2919139459 | 526 |
| 248 | iso_pu_bacteria | 2960624210 | 2960626118 | 526 |
| 249 | 3300005548 | Ga0070665_100006197 | Ga0070665_1000061975 | 527 |
| 250 | 3300025941 | Ga0207711_10036124 | Ga0207711_100361245 | 527 |
| 251 | 3300025986 | Ga0207658_10067791 | Ga0207658_100677912 | 527 |
| 252 | 3300049571 | Ga0501034_0029689 | Ga0501034_0029689_2321_3961 | 527 |
| 253 | 3300049571 | Ga0501034_0007640 | Ga0501034_0007640_2698_4353 | 528 |
| 254 | 3300050489 | nmdc:mga03683_8140_c1 | nmdc:mga03683_8140_c1_181_1797 | 528 |
| 255 | iso_pu_bacteria | 8005695170 | 8005699763 | 528 |
| 256 | 3300005295 | Ga0065707_10097586 | Ga0065707_100975862 | 529 |
| 257 | 3300005353 | Ga0070669_100000345 | Ga0070669_10000034518 | 529 |
| 258 | 3300005367 | Ga0070667_100016634 | Ga0070667_1000166347 | 529 |
| 259 | 3300014326 | Ga0157380_10003365 | Ga0157380_100033658 | 529 |
| 260 | 3300025923 | Ga0207681_10000086 | Ga0207681_1000008665 | 529 |
| 261 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008434 | 529 |
| 262 | 3300026095 | Ga0207676_10000264 | Ga0207676_1000026430 | 529 |
| 263 | 3300053087 | Ga0500643_000637 | Ga0500643_000637_8040_9785 | 529 |
| 264 | 3300005843 | Ga0068860_100000023 | Ga0068860_100000023215 | 530 |
| 265 | 3300046522 | Ga0495643_0022274 | Ga0495643_0022274_538_2244 | 530 |
| 266 | 3300046542 | Ga0495597_0005777 | Ga0495597_0005777_3116_4822 | 530 |
| 267 | 3300049670 | Ga0501236_000422 | Ga0501236_000422_406_2082 | 530 |
| 268 | 3300053093 | Ga0500651_0004436 | Ga0500651_0004436_5115_6821 | 530 |
| 269 | 3300053096 | Ga0500641_0007464 | Ga0500641_0007464_2064_3770 | 530 |
| 270 | 3300053125 | Ga0500618_003126 | Ga0500618_003126_3949_5655 | 530 |
| 271 | 3300053130 | Ga0500642_0003588 | Ga0500642_0003588_2468_4174 | 530 |
| 272 | 3300053133 | Ga0500655_000039 | Ga0500655_000039_34933_36639 | 530 |
| 273 | 3300053148 | Ga0500590_023710 | Ga0500590_023710_905_2611 | 530 |
| 274 | 3300053156 | Ga0500622_0002897 | Ga0500622_0002897_2910_4616 | 530 |
| 275 | 3300053724 | Ga0500570_000154 | Ga0500570_000154_15739_17445 | 530 |
| 276 | iso_pu_bacteria | 2558860983 | 2561466568 | 530 |
| 277 | iso_pu_bacteria | 2739367664 | 2739650328 | 530 |
| 278 | iso_pu_bacteria | 2739367865 | 2740028801 | 530 |
| 279 | 3300005578 | Ga0068854_100000255 | Ga0068854_10000025535 | 531 |
| 280 | 3300005616 | Ga0068852_100000208 | Ga0068852_10000020822 | 531 |
| 281 | 3300025981 | Ga0207640_10002020 | Ga0207640_100020205 | 531 |
| 282 | 3300026142 | Ga0207698_10000119 | Ga0207698_1000011922 | 531 |
| 283 | 3300005843 | Ga0068860_100039245 | Ga0068860_1000392452 | 532 |
| 284 | 3300013105 | Ga0157369_10013128 | Ga0157369_100131287 | 532 |
| 285 | 3300026041 | Ga0207639_10033804 | Ga0207639_100338042 | 532 |
| 286 | 3300005548 | Ga0070665_100031714 | Ga0070665_1000317142 | 533 |
| 287 | 3300005618 | Ga0068864_100002699 | Ga0068864_1000026997 | 533 |
| 288 | 3300005841 | Ga0068863_100000081 | Ga0068863_10000008156 | 533 |
| 289 | 3300005841 | Ga0068863_100013152 | Ga0068863_1000131526 | 533 |
| 290 | 3300005842 | Ga0068858_100002847 | Ga0068858_10000284721 | 533 |
| 291 | 3300005843 | Ga0068860_100000108 | Ga0068860_100000108109 | 533 |
| 292 | 3300026035 | Ga0207703_10004419 | Ga0207703_100044193 | 533 |
| 293 | 3300026088 | Ga0207641_10000182 | Ga0207641_1000018258 | 533 |
| 294 | 3300026088 | Ga0207641_10006378 | Ga0207641_100063782 | 533 |
| 295 | 3300026095 | Ga0207676_10000760 | Ga0207676_1000076024 | 533 |
| 296 | 3300028379 | Ga0268266_10018632 | Ga0268266_100186323 | 533 |
| 297 | 3300028381 | Ga0268264_10000126 | Ga0268264_10000126109 | 533 |
| 298 | 3300028381 | Ga0268264_10008585 | Ga0268264_100085857 | 533 |
| 299 | iso_pu_bacteria | 2852653556 | 2852656900 | 533 |
| 300 | 3300005842 | Ga0068858_100000506 | Ga0068858_10000050619 | 534 |
| 301 | 3300009177 | Ga0105248_10058733 | Ga0105248_100587333 | 534 |
| 302 | 3300025920 | Ga0207649_10026496 | Ga0207649_100264964 | 534 |
| 303 | 3300026035 | Ga0207703_10007127 | Ga0207703_100071275 | 534 |
| 304 | 3300048908 | Ga0496105_0000817 | Ga0496105_0000817_8769_10418 | 534 |
| 305 | 3300048917 | Ga0496114_0013350 | Ga0496114_0013350_2604_4286 | 534 |
| 306 | 3300048929 | Ga0496126_0002202 | Ga0496126_0002202_16065_17747 | 534 |
| 307 | 3300005329 | Ga0070683_100033052 | Ga0070683_1000330524 | 535 |
| 308 | 3300005344 | Ga0070661_100001045 | Ga0070661_1000010458 | 535 |
| 309 | 3300005366 | Ga0070659_100028147 | Ga0070659_1000281471 | 535 |
| 310 | 3300005457 | Ga0070662_100000100 | Ga0070662_10000010032 | 535 |
| 311 | 3300005458 | Ga0070681_10004190 | Ga0070681_1000419012 | 535 |
| 312 | 3300005539 | Ga0068853_100005601 | Ga0068853_1000056012 | 535 |
| 313 | 3300005563 | Ga0068855_100010294 | Ga0068855_1000102941 | 535 |
| 314 | 3300005614 | Ga0068856_100040766 | Ga0068856_1000407664 | 535 |
| 315 | 3300013100 | Ga0157373_10018150 | Ga0157373_100181505 | 535 |
| 316 | 3300013102 | Ga0157371_10000519 | Ga0157371_1000051919 | 535 |
| 317 | 3300013105 | Ga0157369_10000446 | Ga0157369_1000044632 | 535 |
| 318 | 3300013307 | Ga0157372_10001430 | Ga0157372_1000143025 | 535 |
| 319 | 3300025912 | Ga0207707_10053011 | Ga0207707_100530112 | 535 |
| 320 | 3300025917 | Ga0207660_10087790 | Ga0207660_100877902 | 535 |
| 321 | 3300025919 | Ga0207657_10000420 | Ga0207657_1000042030 | 535 |
| 322 | 3300025920 | Ga0207649_10002157 | Ga0207649_100021577 | 535 |
| 323 | 3300025932 | Ga0207690_10000043 | Ga0207690_1000004336 | 535 |
| 324 | 3300025933 | Ga0207706_10000468 | Ga0207706_1000046846 | 535 |
| 325 | 3300025945 | Ga0207679_10011729 | Ga0207679_100117295 | 535 |
| 326 | 3300025949 | Ga0207667_10016198 | Ga0207667_100161987 | 535 |
| 327 | 3300026041 | Ga0207639_10000148 | Ga0207639_1000014816 | 535 |
| 328 | 3300026116 | Ga0207674_10039815 | Ga0207674_100398153 | 535 |
| 329 | 3300048913 | Ga0496110_0023687 | Ga0496110_0023687_1211_2869 | 535 |
| 330 | 3300009177 | Ga0105248_10008636 | Ga0105248_1000863610 | 536 |
| 331 | 3300025945 | Ga0207679_10035026 | Ga0207679_100350264 | 536 |
| 332 | 3300031852 | Ga0307410_10017409 | Ga0307410_100174093 | 536 |
| 333 | 3300031911 | Ga0307412_10048275 | Ga0307412_100482753 | 536 |
| 334 | 3300032002 | Ga0307416_100205399 | Ga0307416_1002053991 | 536 |
| 335 | 3300050509 | nmdc:mga0qj67_107065_c1 | nmdc:mga0qj67_107065_c1_149_1822 | 536 |
| 336 | 3300053122 | Ga0500608_000988 | Ga0500608_000988_1029_2681 | 536 |
| 337 | 3300053729 | Ga0500625_000030 | Ga0500625_000030_42837_44489 | 536 |
| 338 | iso_pu_bacteria | 2896429255 | 2896431480 | 536 |
| 339 | iso_pu_bacteria | 8054302542 | 8054306667 | 536 |
| 340 | 3300001904 | JGI24736J21556_1005870 | JGI24736J21556_10058702 | 537 |
| 341 | 3300001989 | JGI24739J22299_10026015 | JGI24739J22299_100260152 | 537 |
| 342 | 3300006051 | Ga0075364_10010857 | Ga0075364_100108575 | 537 |
| 343 | 3300006177 | Ga0075362_10000015 | Ga0075362_1000001568 | 537 |
| 344 | 3300006186 | Ga0075369_10000186 | Ga0075369_100001867 | 537 |
| 345 | 3300006195 | Ga0075366_10000153 | Ga0075366_100001539 | 537 |
| 346 | 3300025904 | Ga0207647_10002484 | Ga0207647_1000248413 | 537 |
| 347 | 3300048920 | Ga0496117_0001317 | Ga0496117_0001317_4972_6615 | 537 |
| 348 | 3300048921 | Ga0496118_0000122 | Ga0496118_0000122_33133_34776 | 537 |
| 349 | 3300050489 | nmdc:mga03683_35_c1 | nmdc:mga03683_35_c1_53456_55114 | 537 |
| 350 | 3300050493 | nmdc:mga0k408_2_c1 | nmdc:mga0k408_2_c1_252762_254420 | 537 |
| 351 | 3300050516 | nmdc:mga0sz30_261_c1 | nmdc:mga0sz30_261_c1_18166_19824 | 537 |
| 352 | iso_pu_bacteria | 2643221563 | 2643832618 | 537 |
| 353 | iso_pu_bacteria | 2643221608 | 2644053587 | 537 |
| 354 | 3300005327 | Ga0070658_10002177 | Ga0070658_1000217713 | 538 |
| 355 | 3300005339 | Ga0070660_100005066 | Ga0070660_1000050669 | 538 |
| 356 | 3300005366 | Ga0070659_100093282 | Ga0070659_1000932821 | 538 |
| 357 | 3300025919 | Ga0207657_10002193 | Ga0207657_1000219325 | 538 |
| 358 | 3300025921 | Ga0207652_10006580 | Ga0207652_100065804 | 538 |
| 359 | 3300025932 | Ga0207690_10019935 | Ga0207690_100199352 | 538 |
| 360 | 3300026067 | Ga0207678_10038771 | Ga0207678_100387715 | 538 |
| 361 | 3300033180 | Ga0307510_10000248 | Ga0307510_1000024849 | 538 |
| 362 | 3300045051 | Ga0451576_0119414 | Ga0451576_0119414_307_1950 | 538 |
| 363 | iso_pu_bacteria | 2582581305 | 2585263413 | 538 |
| 364 | iso_pu_bacteria | 2643221560 | 2643821626 | 538 |
| 365 | iso_pu_bacteria | 2643221588 | 2643950587 | 538 |
| 366 | iso_pu_bacteria | 2643221605 | 2644039718 | 538 |
| 367 | iso_pu_bacteria | 2775507255 | 2778126910 | 538 |
| 368 | iso_pu_bacteria | 2895880812 | 2895881281 | 538 |
| 369 | iso_pu_bacteria | 2919709256 | 2919709549 | 538 |
| 370 | 3300005327 | Ga0070658_10001136 | Ga0070658_1000113621 | 539 |
| 371 | 3300005618 | Ga0068864_100000233 | Ga0068864_10000023329 | 539 |
| 372 | 3300005842 | Ga0068858_100001600 | Ga0068858_10000160021 | 539 |
| 373 | 3300009551 | Ga0105238_10033163 | Ga0105238_100331634 | 539 |
| 374 | 3300013306 | Ga0163162_10005912 | Ga0163162_100059127 | 539 |
| 375 | 3300025909 | Ga0207705_10000037 | Ga0207705_10000037176 | 539 |
| 376 | 3300025924 | Ga0207694_10061446 | Ga0207694_100614464 | 539 |
| 377 | 3300026035 | Ga0207703_10000409 | Ga0207703_1000040931 | 539 |
| 378 | 3300026095 | Ga0207676_10000150 | Ga0207676_1000015043 | 539 |
| 379 | 3300047472 | Ga0495686_0002043 | Ga0495686_0002043_17661_19328 | 539 |
| 380 | 3300002459 | JGI24751J29686_10001546 | JGI24751J29686_100015465 | 540 |
| 381 | 3300005347 | Ga0070668_100015604 | Ga0070668_1000156042 | 540 |
| 382 | 3300005355 | Ga0070671_100000007 | Ga0070671_10000000717 | 540 |
| 383 | 3300005367 | Ga0070667_100050679 | Ga0070667_1000506792 | 540 |
| 384 | 3300005617 | Ga0068859_100001637 | Ga0068859_10000163722 | 540 |
| 385 | 3300005618 | Ga0068864_100009652 | Ga0068864_1000096527 | 540 |
| 386 | 3300005719 | Ga0068861_100003970 | Ga0068861_10000397013 | 540 |
| 387 | 3300005841 | Ga0068863_100001536 | Ga0068863_10000153614 | 540 |
| 388 | 3300005843 | Ga0068860_100025709 | Ga0068860_1000257092 | 540 |
| 389 | 3300005844 | Ga0068862_100000288 | Ga0068862_10000028840 | 540 |
| 390 | 3300006931 | Ga0097620_100001637 | Ga0097620_10000163722 | 540 |
| 391 | 3300009177 | Ga0105248_10041655 | Ga0105248_100416551 | 540 |
| 392 | 3300009553 | Ga0105249_10070001 | Ga0105249_100700012 | 540 |
| 393 | 3300014968 | Ga0157379_10007542 | Ga0157379_100075428 | 540 |
| 394 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002692 | 540 |
| 395 | 3300025972 | Ga0207668_10000477 | Ga0207668_100004779 | 540 |
| 396 | 3300026035 | Ga0207703_10008781 | Ga0207703_100087815 | 540 |
| 397 | 3300026088 | Ga0207641_10001652 | Ga0207641_1000165217 | 540 |
| 398 | 3300026095 | Ga0207676_10003418 | Ga0207676_100034184 | 540 |
| 399 | 3300026118 | Ga0207675_100000294 | Ga0207675_10000029451 | 540 |
| 400 | 3300028380 | Ga0268265_10000049 | Ga0268265_1000004918 | 540 |
| 401 | 3300028381 | Ga0268264_10000071 | Ga0268264_10000071230 | 540 |
| 402 | 3300031824 | Ga0307413_10031204 | Ga0307413_100312042 | 540 |
| 403 | 3300046500 | Ga0495596_0001207 | Ga0495596_0001207_12134_13777 | 540 |
| 404 | 3300046506 | Ga0495583_0005996 | Ga0495583_0005996_4116_5759 | 540 |
| 405 | 3300048090 | Ga0495615_0000272 | Ga0495615_0000272_7852_9495 | 540 |
| 406 | 3300048926 | Ga0496123_0001685 | Ga0496123_0001685_20598_22256 | 540 |
| 407 | 3300053119 | Ga0500595_005197 | Ga0500595_005197_3746_5401 | 540 |
| 408 | iso_pu_bacteria | 2643221541 | 2643729526 | 540 |
| 409 | iso_pu_bacteria | 2643221606 | 2644043883 | 540 |
| 410 | iso_pu_bacteria | 2643221671 | 2644392354 | 540 |
| 411 | iso_pu_bacteria | 2738541275 | 2738710968 | 540 |
| 412 | iso_pu_bacteria | 2738541301 | 2738849393 | 540 |
| 413 | iso_pu_bacteria | 2738541304 | 2738865122 | 540 |
| 414 | iso_pu_bacteria | 2738543022 | 2739297640 | 540 |
| 415 | iso_pu_bacteria | 2738543033 | 2739359318 | 540 |
| 416 | iso_pu_bacteria | 2896184354 | 2896185837 | 540 |
| 417 | iso_pu_bacteria | 2928100450 | 2928101076 | 540 |
| 418 | iso_pu_bacteria | 2928959182 | 2928960514 | 540 |
| 419 | 3300003791 | Ga0055530_10000518 | Ga0055530_1000051826 | 541 |
| 420 | 3300003794 | Ga0055531_10016199 | Ga0055531_100161992 | 541 |
| 421 | 3300005295 | Ga0065707_10085887 | Ga0065707_100858875 | 541 |
| 422 | 3300005356 | Ga0070674_100034190 | Ga0070674_1000341904 | 541 |
| 423 | 3300005364 | Ga0070673_100033483 | Ga0070673_1000334834 | 541 |
| 424 | 3300005456 | Ga0070678_100028584 | Ga0070678_1000285842 | 541 |
| 425 | 3300005548 | Ga0070665_100019755 | Ga0070665_1000197552 | 541 |
| 426 | 3300005843 | Ga0068860_100005575 | Ga0068860_1000055757 | 541 |
| 427 | 3300009093 | Ga0105240_10004622 | Ga0105240_100046225 | 541 |
| 428 | 3300009101 | Ga0105247_10007289 | Ga0105247_100072894 | 541 |
| 429 | 3300009553 | Ga0105249_10000053 | Ga0105249_100000538 | 541 |
| 430 | 3300014326 | Ga0157380_10009984 | Ga0157380_100099847 | 541 |
| 431 | 3300017792 | Ga0163161_10071667 | Ga0163161_100716672 | 541 |
| 432 | 3300025292 | Ga0209676_1000132 | Ga0209676_1000132141 | 541 |
| 433 | 3300025292 | Ga0209676_1000155 | Ga0209676_1000155106 | 541 |
| 434 | 3300025298 | Ga0209050_1000139 | Ga0209050_1000139142 | 541 |
| 435 | 3300025304 | Ga0209257_1000164 | Ga0209257_100016444 | 541 |
| 436 | 3300025900 | Ga0207710_10003665 | Ga0207710_100036657 | 541 |
| 437 | 3300025941 | Ga0207711_10014352 | Ga0207711_100143522 | 541 |
| 438 | 3300025961 | Ga0207712_10000045 | Ga0207712_10000045166 | 541 |
| 439 | 3300025972 | Ga0207668_10003827 | Ga0207668_100038277 | 541 |
| 440 | 3300026088 | Ga0207641_10001052 | Ga0207641_100010524 | 541 |
| 441 | 3300026089 | Ga0207648_10047574 | Ga0207648_100475742 | 541 |
| 442 | 3300028379 | Ga0268266_10009483 | Ga0268266_100094837 | 541 |
| 443 | 3300028381 | Ga0268264_10007232 | Ga0268264_100072327 | 541 |
| 444 | 3300031616 | Ga0307508_10007169 | Ga0307508_1000716910 | 541 |
| 445 | 3300032004 | Ga0307414_10000068 | Ga0307414_100000682 | 541 |
| 446 | 3300032005 | Ga0307411_10034443 | Ga0307411_100344433 | 541 |
| 447 | 3300038705 | Ga0237819_00251 | Ga0237819_00251_13843_15510 | 541 |
| 448 | 3300046453 | Ga0495627_000110 | Ga0495627_000110_8784_10436 | 541 |
| 449 | 3300046460 | Ga0495638_0000073 | Ga0495638_0000073_55489_57147 | 541 |
| 450 | 3300046506 | Ga0495583_0000087 | Ga0495583_0000087_55482_57140 | 541 |
| 451 | 3300046512 | Ga0495610_0000303 | Ga0495610_0000303_7024_8670 | 541 |
| 452 | 3300046519 | Ga0495632_0000271 | Ga0495632_0000271_47894_49555 | 541 |
| 453 | 3300046519 | Ga0495632_0001911 | Ga0495632_0001911_3401_5059 | 541 |
| 454 | 3300046520 | Ga0495637_0000124 | Ga0495637_0000124_40094_41749 | 541 |
| 455 | 3300046522 | Ga0495643_0000031 | Ga0495643_0000031_208274_209929 | 541 |
| 456 | 3300046522 | Ga0495643_0000341 | Ga0495643_0000341_48889_50535 | 541 |
| 457 | 3300046524 | Ga0495648_0000049 | Ga0495648_0000049_55489_57147 | 541 |
| 458 | 3300046524 | Ga0495648_0004359 | Ga0495648_0004359_2088_3740 | 541 |
| 459 | 3300046525 | Ga0495663_0000057 | Ga0495663_0000057_1780_3441 | 541 |
| 460 | 3300046538 | Ga0495609_0004437 | Ga0495609_0004437_4678_6324 | 541 |
| 461 | 3300046558 | Ga0495633_0003341 | Ga0495633_0003341_7332_8993 | 541 |
| 462 | 3300046660 | Ga0495625_0027078 | Ga0495625_0027078_1239_2885 | 541 |
| 463 | 3300046692 | Ga0495671_0000021 | Ga0495671_0000021_47892_49547 | 541 |
| 464 | 3300046692 | Ga0495671_0000042 | Ga0495671_0000042_55709_57367 | 541 |
| 465 | 3300047469 | Ga0495673_0000111 | Ga0495673_0000111_107835_109493 | 541 |
| 466 | 3300047469 | Ga0495673_0029254 | Ga0495673_0029254_340_2052 | 541 |
| 467 | 3300047470 | Ga0495681_0023806 | Ga0495681_0023806_1354_3009 | 541 |
| 468 | 3300048925 | Ga0496122_0001014 | Ga0496122_0001014_13450_15114 | 541 |
| 469 | 3300048926 | Ga0496123_0000212 | Ga0496123_0000212_76934_78598 | 541 |
| 470 | 3300049520 | Ga0501297_000522 | Ga0501297_000522_408_2117 | 541 |
| 471 | 3300049524 | Ga0501301_000368 | Ga0501301_000368_447_2156 | 541 |
| 472 | 3300049569 | Ga0501032_0018313 | Ga0501032_0018313_3196_4854 | 541 |
| 473 | 3300049573 | Ga0501037_0018342 | Ga0501037_0018342_721_2379 | 541 |
| 474 | 3300049663 | Ga0501223_000124 | Ga0501223_000124_16665_18323 | 541 |
| 475 | 3300049664 | Ga0501224_000003 | Ga0501224_000003_26900_28558 | 541 |
| 476 | 3300049664 | Ga0501224_000724 | Ga0501224_000724_1223_2932 | 541 |
| 477 | 3300049665 | Ga0501227_001028 | Ga0501227_001028_1693_3402 | 541 |
| 478 | 3300049668 | Ga0501233_001151 | Ga0501233_001151_1099_2808 | 541 |
| 479 | 3300049668 | Ga0501233_001401 | Ga0501233_001401_799_2457 | 541 |
| 480 | 3300049669 | Ga0501235_000862 | Ga0501235_000862_1283_2992 | 541 |
| 481 | 3300049686 | Ga0501257_002742 | Ga0501257_002742_569_2278 | 541 |
| 482 | 3300049690 | Ga0501261_000053 | Ga0501261_000053_18002_19711 | 541 |
| 483 | 3300049705 | Ga0501225_0000001 | Ga0501225_0000001_160488_162146 | 541 |
| 484 | 3300049707 | Ga0501234_000627 | Ga0501234_000627_1036_2694 | 541 |
| 485 | 3300049708 | Ga0501245_000181 | Ga0501245_000181_604_2313 | 541 |
| 486 | 3300049775 | Ga0501279_000005 | Ga0501279_000005_124731_126440 | 541 |
| 487 | 3300049776 | Ga0501280_000012 | Ga0501280_000012_49270_50979 | 541 |
| 488 | 3300049777 | Ga0501281_00005 | Ga0501281_00005_27422_29131 | 541 |
| 489 | 3300049778 | Ga0501282_000420 | Ga0501282_000420_556_2265 | 541 |
| 490 | 3300049779 | Ga0501283_000558 | Ga0501283_000558_1497_3206 | 541 |
| 491 | 3300049822 | Ga0501035_0048671 | Ga0501035_0048671_1983_3641 | 541 |
| 492 | 3300049853 | Ga0501226_000013 | Ga0501226_000013_13081_14739 | 541 |
| 493 | 3300053158 | Ga0500627_0000020 | Ga0500627_0000020_51328_52986 | 541 |
| 494 | iso_pu_bacteria | 2808606401 | 2809064717 | 541 |
| 495 | iso_pu_bacteria | 2808606404 | 2809080614 | 541 |
| 496 | iso_pu_bacteria | 2808606405 | 2809084979 | 541 |
| 497 | iso_pu_bacteria | 2880518877 | 2880519611 | 541 |
| 498 | 3300001904 | JGI24736J21556_1000172 | JGI24736J21556_10001725 | 542 |
| 499 | 3300001904 | JGI24736J21556_1000319 | JGI24736J21556_10003197 | 542 |
| 500 | 3300001915 | JGI24741J21665_1000143 | JGI24741J21665_10001438 | 542 |
| 501 | 3300001979 | JGI24740J21852_10001914 | JGI24740J21852_100019149 | 542 |
| 502 | 3300001979 | JGI24740J21852_10004740 | JGI24740J21852_100047405 | 542 |
| 503 | 3300001989 | JGI24739J22299_10001814 | JGI24739J22299_100018145 | 542 |
| 504 | 3300001989 | JGI24739J22299_10003317 | JGI24739J22299_100033173 | 542 |
| 505 | 3300001989 | JGI24739J22299_10004003 | JGI24739J22299_100040035 | 542 |
| 506 | 3300001990 | JGI24737J22298_10003835 | JGI24737J22298_100038353 | 542 |
| 507 | 3300001990 | JGI24737J22298_10004097 | JGI24737J22298_100040975 | 542 |
| 508 | 3300002067 | JGI24735J21928_10001460 | JGI24735J21928_100014608 | 542 |
| 509 | 3300002067 | JGI24735J21928_10005791 | JGI24735J21928_100057915 | 542 |
| 510 | 3300002067 | JGI24735J21928_10009849 | JGI24735J21928_100098492 | 542 |
| 511 | 3300002075 | JGI24738J21930_10002457 | JGI24738J21930_100024573 | 542 |
| 512 | 3300002075 | JGI24738J21930_10004108 | JGI24738J21930_100041082 | 542 |
| 513 | 3300003214 | JGI25165J46597_1000138 | JGI25165J46597_100013849 | 542 |
| 514 | 3300005289 | Ga0065704_10000306 | Ga0065704_100003064 | 542 |
| 515 | 3300005295 | Ga0065707_10085409 | Ga0065707_100854096 | 542 |
| 516 | 3300005327 | Ga0070658_10004633 | Ga0070658_1000463310 | 542 |
| 517 | 3300005328 | Ga0070676_10000079 | Ga0070676_1000007913 | 542 |
| 518 | 3300005331 | Ga0070670_100002660 | Ga0070670_1000026607 | 542 |
| 519 | 3300005334 | Ga0068869_100001745 | Ga0068869_10000174513 | 542 |
| 520 | 3300005338 | Ga0068868_100000154 | Ga0068868_10000015442 | 542 |
| 521 | 3300005339 | Ga0070660_100000544 | Ga0070660_10000054423 | 542 |
| 522 | 3300005339 | Ga0070660_100007495 | Ga0070660_1000074952 | 542 |
| 523 | 3300005339 | Ga0070660_100008064 | Ga0070660_1000080647 | 542 |
| 524 | 3300005347 | Ga0070668_100028638 | Ga0070668_1000286383 | 542 |
| 525 | 3300005353 | Ga0070669_100036074 | Ga0070669_1000360742 | 542 |
| 526 | 3300005353 | Ga0070669_100040950 | Ga0070669_1000409502 | 542 |
| 527 | 3300005355 | Ga0070671_100000027 | Ga0070671_100000027114 | 542 |
| 528 | 3300005364 | Ga0070673_100000023 | Ga0070673_100000023104 | 542 |
| 529 | 3300005367 | Ga0070667_100000004 | Ga0070667_10000000445 | 542 |
| 530 | 3300005367 | Ga0070667_100000300 | Ga0070667_10000030055 | 542 |
| 531 | 3300005455 | Ga0070663_100000791 | Ga0070663_1000007913 | 542 |
| 532 | 3300005459 | Ga0068867_100000007 | Ga0068867_1000000072 | 542 |
| 533 | 3300005539 | Ga0068853_100010552 | Ga0068853_1000105527 | 542 |
| 534 | 3300005539 | Ga0068853_100203241 | Ga0068853_1002032411 | 542 |
| 535 | 3300005563 | Ga0068855_100120775 | Ga0068855_1001207752 | 542 |
| 536 | 3300005563 | Ga0068855_100122583 | Ga0068855_1001225832 | 542 |
| 537 | 3300005577 | Ga0068857_100033275 | Ga0068857_1000332755 | 542 |
| 538 | 3300005577 | Ga0068857_100049951 | Ga0068857_1000499512 | 542 |
| 539 | 3300005578 | Ga0068854_100006050 | Ga0068854_1000060507 | 542 |
| 540 | 3300005578 | Ga0068854_100034900 | Ga0068854_1000349004 | 542 |
| 541 | 3300005614 | Ga0068856_100033854 | Ga0068856_1000338545 | 542 |
| 542 | 3300005614 | Ga0068856_100059205 | Ga0068856_1000592054 | 542 |
| 543 | 3300005614 | Ga0068856_100086466 | Ga0068856_1000864662 | 542 |
| 544 | 3300005616 | Ga0068852_100006502 | Ga0068852_10000650210 | 542 |
| 545 | 3300005616 | Ga0068852_100011473 | Ga0068852_1000114731 | 542 |
| 546 | 3300005617 | Ga0068859_100024271 | Ga0068859_1000242713 | 542 |
| 547 | 3300005617 | Ga0068859_100178631 | Ga0068859_1001786312 | 542 |
| 548 | 3300005834 | Ga0068851_10001881 | Ga0068851_100018814 | 542 |
| 549 | 3300005841 | Ga0068863_100000169 | Ga0068863_10000016920 | 542 |
| 550 | 3300005841 | Ga0068863_100006692 | Ga0068863_1000066923 | 542 |
| 551 | 3300005842 | Ga0068858_100000587 | Ga0068858_10000058714 | 542 |
| 552 | 3300005842 | Ga0068858_100003843 | Ga0068858_10000384315 | 542 |
| 553 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000230 | 542 |
| 554 | 3300005843 | Ga0068860_100000224 | Ga0068860_10000022461 | 542 |
| 555 | 3300005844 | Ga0068862_100002573 | Ga0068862_1000025735 | 542 |
| 556 | 3300005844 | Ga0068862_100078946 | Ga0068862_1000789462 | 542 |
| 557 | 3300006042 | Ga0075368_10000377 | Ga0075368_100003778 | 542 |
| 558 | 3300006178 | Ga0075367_10000570 | Ga0075367_100005709 | 542 |
| 559 | 3300006195 | Ga0075366_10021020 | Ga0075366_100210202 | 542 |
| 560 | 3300006353 | Ga0075370_10064874 | Ga0075370_100648742 | 542 |
| 561 | 3300006881 | Ga0068865_100000010 | Ga0068865_100000010178 | 542 |
| 562 | 3300006931 | Ga0097620_100024271 | Ga0097620_1000242713 | 542 |
| 563 | 3300006931 | Ga0097620_100178636 | Ga0097620_1001786362 | 542 |
| 564 | 3300009093 | Ga0105240_10092234 | Ga0105240_100922344 | 542 |
| 565 | 3300009098 | Ga0105245_10019720 | Ga0105245_100197202 | 542 |
| 566 | 3300009101 | Ga0105247_10069554 | Ga0105247_100695542 | 542 |
| 567 | 3300009148 | Ga0105243_10000950 | Ga0105243_100009502 | 542 |
| 568 | 3300009174 | Ga0105241_10001752 | Ga0105241_100017527 | 542 |
| 569 | 3300009174 | Ga0105241_10006964 | Ga0105241_100069647 | 542 |
| 570 | 3300009176 | Ga0105242_10000210 | Ga0105242_100002102 | 542 |
| 571 | 3300009551 | Ga0105238_10018659 | Ga0105238_100186593 | 542 |
| 572 | 3300009553 | Ga0105249_10022128 | Ga0105249_100221286 | 542 |
| 573 | 3300009978 | Ga0105148_100614 | Ga0105148_1006144 | 542 |
| 574 | 3300010375 | Ga0105239_10072195 | Ga0105239_100721953 | 542 |
| 575 | 3300011119 | Ga0105246_10000333 | Ga0105246_100003339 | 542 |
| 576 | 3300011119 | Ga0105246_10011832 | Ga0105246_100118323 | 542 |
| 577 | 3300013100 | Ga0157373_10023870 | Ga0157373_100238705 | 542 |
| 578 | 3300013104 | Ga0157370_10006473 | Ga0157370_1000647310 | 542 |
| 579 | 3300013104 | Ga0157370_10027954 | Ga0157370_100279542 | 542 |
| 580 | 3300013105 | Ga0157369_10123431 | Ga0157369_101234313 | 542 |
| 581 | 3300013296 | Ga0157374_10000830 | Ga0157374_100008302 | 542 |
| 582 | 3300013297 | Ga0157378_10019607 | Ga0157378_100196072 | 542 |
| 583 | 3300013297 | Ga0157378_10045704 | Ga0157378_100457042 | 542 |
| 584 | 3300013308 | Ga0157375_10034342 | Ga0157375_100343422 | 542 |
| 585 | 3300014969 | Ga0157376_10000047 | Ga0157376_100000472 | 542 |
| 586 | 3300025229 | Ga0209147_101557 | Ga0209147_1015576 | 542 |
| 587 | 3300025261 | Ga0209233_1000182 | Ga0209233_100018259 | 542 |
| 588 | 3300025272 | Ga0209455_1006444 | Ga0209455_10064444 | 542 |
| 589 | 3300025321 | Ga0207656_10002966 | Ga0207656_100029664 | 542 |
| 590 | 3300025321 | Ga0207656_10013321 | Ga0207656_100133212 | 542 |
| 591 | 3300025903 | Ga0207680_10070228 | Ga0207680_100702282 | 542 |
| 592 | 3300025904 | Ga0207647_10005479 | Ga0207647_100054799 | 542 |
| 593 | 3300025904 | Ga0207647_10008107 | Ga0207647_100081072 | 542 |
| 594 | 3300025907 | Ga0207645_10001300 | Ga0207645_1000130018 | 542 |
| 595 | 3300025909 | Ga0207705_10001772 | Ga0207705_100017722 | 542 |
| 596 | 3300025909 | Ga0207705_10020526 | Ga0207705_100205264 | 542 |
| 597 | 3300025911 | Ga0207654_10002334 | Ga0207654_100023349 | 542 |
| 598 | 3300025913 | Ga0207695_10014635 | Ga0207695_100146357 | 542 |
| 599 | 3300025914 | Ga0207671_10000841 | Ga0207671_1000084125 | 542 |
| 600 | 3300025914 | Ga0207671_10016046 | Ga0207671_100160466 | 542 |
| 601 | 3300025919 | Ga0207657_10003249 | Ga0207657_1000324917 | 542 |
| 602 | 3300025919 | Ga0207657_10010428 | Ga0207657_100104284 | 542 |
| 603 | 3300025919 | Ga0207657_10033891 | Ga0207657_100338912 | 542 |
| 604 | 3300025919 | Ga0207657_10044982 | Ga0207657_100449825 | 542 |
| 605 | 3300025923 | Ga0207681_10006062 | Ga0207681_100060625 | 542 |
| 606 | 3300025923 | Ga0207681_10006088 | Ga0207681_100060885 | 542 |
| 607 | 3300025924 | Ga0207694_10009370 | Ga0207694_100093703 | 542 |
| 608 | 3300025925 | Ga0207650_10002924 | Ga0207650_1000292410 | 542 |
| 609 | 3300025927 | Ga0207687_10004556 | Ga0207687_100045566 | 542 |
| 610 | 3300025927 | Ga0207687_10012191 | Ga0207687_100121912 | 542 |
| 611 | 3300025931 | Ga0207644_10000064 | Ga0207644_1000006430 | 542 |
| 612 | 3300025934 | Ga0207686_10000332 | Ga0207686_1000033215 | 542 |
| 613 | 3300025935 | Ga0207709_10000050 | Ga0207709_10000050249 | 542 |
| 614 | 3300025938 | Ga0207704_10000020 | Ga0207704_10000020159 | 542 |
| 615 | 3300025942 | Ga0207689_10004290 | Ga0207689_100042902 | 542 |
| 616 | 3300025949 | Ga0207667_10006744 | Ga0207667_100067449 | 542 |
| 617 | 3300025949 | Ga0207667_10007432 | Ga0207667_100074327 | 542 |
| 618 | 3300025960 | Ga0207651_10000005 | Ga0207651_100000052 | 542 |
| 619 | 3300025961 | Ga0207712_10085225 | Ga0207712_100852252 | 542 |
| 620 | 3300025972 | Ga0207668_10000024 | Ga0207668_10000024115 | 542 |
| 621 | 3300025972 | Ga0207668_10000265 | Ga0207668_1000026515 | 542 |
| 622 | 3300025972 | Ga0207668_10002663 | Ga0207668_1000266310 | 542 |
| 623 | 3300025981 | Ga0207640_10033847 | Ga0207640_100338473 | 542 |
| 624 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002337 | 542 |
| 625 | 3300025986 | Ga0207658_10000074 | Ga0207658_1000007478 | 542 |
| 626 | 3300025986 | Ga0207658_10000258 | Ga0207658_100002583 | 542 |
| 627 | 3300026023 | Ga0207677_10000373 | Ga0207677_1000037326 | 542 |
| 628 | 3300026035 | Ga0207703_10004594 | Ga0207703_100045948 | 542 |
| 629 | 3300026035 | Ga0207703_10009066 | Ga0207703_100090667 | 542 |
| 630 | 3300026041 | Ga0207639_10009358 | Ga0207639_100093587 | 542 |
| 631 | 3300026041 | Ga0207639_10035712 | Ga0207639_100357122 | 542 |
| 632 | 3300026067 | Ga0207678_10000979 | Ga0207678_1000097913 | 542 |
| 633 | 3300026078 | Ga0207702_10001863 | Ga0207702_1000186312 | 542 |
| 634 | 3300026078 | Ga0207702_10002491 | Ga0207702_1000249115 | 542 |
| 635 | 3300026078 | Ga0207702_10003048 | Ga0207702_1000304811 | 542 |
| 636 | 3300026078 | Ga0207702_10009519 | Ga0207702_100095195 | 542 |
| 637 | 3300026088 | Ga0207641_10000181 | Ga0207641_1000018117 | 542 |
| 638 | 3300026088 | Ga0207641_10000475 | Ga0207641_1000047544 | 542 |
| 639 | 3300026088 | Ga0207641_10000883 | Ga0207641_100008837 | 542 |
| 640 | 3300026089 | Ga0207648_10000017 | Ga0207648_10000017159 | 542 |
| 641 | 3300026116 | Ga0207674_10029609 | Ga0207674_100296092 | 542 |
| 642 | 3300026116 | Ga0207674_10081160 | Ga0207674_100811604 | 542 |
| 643 | 3300026142 | Ga0207698_10000397 | Ga0207698_100003972 | 542 |
| 644 | 3300026142 | Ga0207698_10001985 | Ga0207698_1000198510 | 542 |
| 645 | 3300026142 | Ga0207698_10047994 | Ga0207698_100479942 | 542 |
| 646 | 3300027866 | Ga0209813_10000103 | Ga0209813_1000010331 | 542 |
| 647 | 3300027876 | Ga0209974_10005517 | Ga0209974_100055172 | 542 |
| 648 | 3300028380 | Ga0268265_10000204 | Ga0268265_1000020433 | 542 |
| 649 | 3300028380 | Ga0268265_10005194 | Ga0268265_100051947 | 542 |
| 650 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001662 | 542 |
| 651 | 3300028381 | Ga0268264_10000161 | Ga0268264_1000016128 | 542 |
| 652 | 3300028381 | Ga0268264_10003264 | Ga0268264_100032645 | 542 |
| 653 | 3300031731 | Ga0307405_10006017 | Ga0307405_100060172 | 542 |
| 654 | 3300031911 | Ga0307412_10014986 | Ga0307412_100149865 | 542 |
| 655 | 3300031911 | Ga0307412_10024421 | Ga0307412_100244214 | 542 |
| 656 | 3300032004 | Ga0307414_10051280 | Ga0307414_100512803 | 542 |
| 657 | 3300037471 | Ga0395905_0053716 | Ga0395905_0053716_462_2174 | 542 |
| 658 | 3300038443 | Ga0395901_0117983 | Ga0395901_0117983_202_1914 | 542 |
| 659 | 3300045051 | Ga0451576_0000165 | Ga0451576_0000165_140774_142441 | 542 |
| 660 | 3300046558 | Ga0495633_0000136 | Ga0495633_0000136_25364_27022 | 542 |
| 661 | 3300048905 | Ga0496102_0000472 | Ga0496102_0000472_12955_14631 | 542 |
| 662 | 3300048905 | Ga0496102_0055787 | Ga0496102_0055787_819_2477 | 542 |
| 663 | 3300048906 | Ga0496103_0000318 | Ga0496103_0000318_29948_31624 | 542 |
| 664 | 3300048919 | Ga0496116_0001661 | Ga0496116_0001661_2475_4151 | 542 |
| 665 | 3300048920 | Ga0496117_0000946 | Ga0496117_0000946_29889_31565 | 542 |
| 666 | 3300048921 | Ga0496118_0000133 | Ga0496118_0000133_78079_79755 | 542 |
| 667 | 3300048927 | Ga0496124_0000359 | Ga0496124_0000359_29911_31587 | 542 |
| 668 | 3300048927 | Ga0496124_0016020 | Ga0496124_0016020_2168_3817 | 542 |
| 669 | 3300049581 | Ga0501047_0102959 | Ga0501047_0102959_507_2162 | 542 |
| 670 | 3300049663 | Ga0501223_000060 | Ga0501223_000060_17559_19217 | 542 |
| 671 | 3300049676 | Ga0501246_000266 | Ga0501246_000266_240_1898 | 542 |
| 672 | 3300049705 | Ga0501225_0000021 | Ga0501225_0000021_17559_19217 | 542 |
| 673 | 3300050494 | nmdc:mga06z11_342_c1 | nmdc:mga06z11_342_c1_6598_8259 | 542 |
| 674 | 3300050495 | nmdc:mga04h51_239_c1 | nmdc:mga04h51_239_c1_6965_8626 | 542 |
| 675 | 3300050496 | nmdc:mga07m45_18364_c1 | nmdc:mga07m45_18364_c1_295_1956 | 542 |
| 676 | 3300053116 | Ga0500592_001795 | Ga0500592_001795_124_1779 | 542 |
| 677 | 3300053153 | Ga0500616_0026039 | Ga0500616_0026039_671_2335 | 542 |
| 678 | 3300006353 | Ga0075370_10000005 | Ga0075370_1000000517 | 543 |
| 679 | 3300027907 | Ga0207428_10030840 | Ga0207428_100308402 | 543 |
| 680 | 3300031824 | Ga0307413_10001824 | Ga0307413_100018247 | 543 |
| 681 | 3300031852 | Ga0307410_10009198 | Ga0307410_100091982 | 543 |
| 682 | 3300031911 | Ga0307412_10000638 | Ga0307412_1000063810 | 543 |
| 683 | 3300032004 | Ga0307414_10003981 | Ga0307414_100039816 | 543 |
| 684 | 3300032004 | Ga0307414_10016298 | Ga0307414_100162985 | 543 |
| 685 | 3300048924 | Ga0496121_0000070 | Ga0496121_0000070_21258_22919 | 543 |
| 686 | 3300050493 | nmdc:mga0k408_45325_c1 | nmdc:mga0k408_45325_c1_47_1705 | 543 |
| 687 | 3300050496 | nmdc:mga07m45_1_c1 | nmdc:mga07m45_1_c1_396848_398506 | 543 |
| 688 | 3300053087 | Ga0500643_001993 | Ga0500643_001993_7264_8943 | 543 |
| 689 | 3300053125 | Ga0500618_000553 | Ga0500618_000553_8225_9883 | 543 |
| 690 | 2162886007 | SwRhRL2b_contig_118179 | SwRhRL2b_0380.00001290 | 544 |
| 691 | 3300002239 | JGI24034J26672_10004435 | JGI24034J26672_100044351 | 544 |
| 692 | 3300005289 | Ga0065704_10002284 | Ga0065704_100022847 | 544 |
| 693 | 3300005347 | Ga0070668_100003324 | Ga0070668_1000033245 | 544 |
| 694 | 3300005353 | Ga0070669_100004097 | Ga0070669_1000040976 | 544 |
| 695 | 3300005548 | Ga0070665_100001656 | Ga0070665_10000165616 | 544 |
| 696 | 3300005563 | Ga0068855_100050081 | Ga0068855_1000500814 | 544 |
| 697 | 3300005843 | Ga0068860_100010596 | Ga0068860_10001059610 | 544 |
| 698 | 3300005844 | Ga0068862_100067336 | Ga0068862_1000673362 | 544 |
| 699 | 3300009177 | Ga0105248_10043765 | Ga0105248_100437654 | 544 |
| 700 | 3300025711 | Ga0207696_1001974 | Ga0207696_10019744 | 544 |
| 701 | 3300025735 | Ga0207713_1026935 | Ga0207713_10269352 | 544 |
| 702 | 3300025923 | Ga0207681_10000852 | Ga0207681_100008522 | 544 |
| 703 | 3300025923 | Ga0207681_10001437 | Ga0207681_100014376 | 544 |
| 704 | 3300025931 | Ga0207644_10000022 | Ga0207644_1000002218 | 544 |
| 705 | 3300025949 | Ga0207667_10014312 | Ga0207667_100143124 | 544 |
| 706 | 3300025972 | Ga0207668_10002922 | Ga0207668_100029227 | 544 |
| 707 | 3300025986 | Ga0207658_10062849 | Ga0207658_100628492 | 544 |
| 708 | 3300026095 | Ga0207676_10090832 | Ga0207676_100908322 | 544 |
| 709 | 3300028379 | Ga0268266_10017214 | Ga0268266_100172147 | 544 |
| 710 | 3300028381 | Ga0268264_10029464 | Ga0268264_100294642 | 544 |
| 711 | 3300048904 | Ga0496101_0010420 | Ga0496101_0010420_1397_3079 | 544 |
| 712 | 3300048905 | Ga0496102_0000377 | Ga0496102_0000377_44138_45790 | 544 |
| 713 | 3300048906 | Ga0496103_0000128 | Ga0496103_0000128_35165_36817 | 544 |
| 714 | 3300048907 | Ga0496104_0000205 | Ga0496104_0000205_21675_23327 | 544 |
| 715 | 3300048908 | Ga0496105_0001478 | Ga0496105_0001478_14500_16152 | 544 |
| 716 | 3300048909 | Ga0496106_0003228 | Ga0496106_0003228_10078_11760 | 544 |
| 717 | 3300048916 | Ga0496113_0006055 | Ga0496113_0006055_5273_6925 | 544 |
| 718 | 3300048916 | Ga0496113_0007493 | Ga0496113_0007493_3353_5035 | 544 |
| 719 | 3300048920 | Ga0496117_0006093 | Ga0496117_0006093_9926_11578 | 544 |
| 720 | 3300048921 | Ga0496118_0043238 | Ga0496118_0043238_1119_2771 | 544 |
| 721 | 3300048922 | Ga0496119_0002177 | Ga0496119_0002177_19678_21330 | 544 |
| 722 | 3300048923 | Ga0496120_0001695 | Ga0496120_0001695_9424_11076 | 544 |
| 723 | 3300048924 | Ga0496121_0006631 | Ga0496121_0006631_9288_10940 | 544 |
| 724 | 3300048926 | Ga0496123_0023585 | Ga0496123_0023585_2748_4400 | 544 |
| 725 | 3300048927 | Ga0496124_0000417 | Ga0496124_0000417_55639_57291 | 544 |
| 726 | 3300048928 | Ga0496125_0006733 | Ga0496125_0006733_9926_11578 | 544 |
| 727 | 3300048929 | Ga0496126_0000493 | Ga0496126_0000493_45712_47364 | 544 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8snh-assembly1.cif.gz_E | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.9546 | 68 | 521 |
| 6xkw-assembly1.cif.gz_n | r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy | 0.9487 | 69 | 521 |
| 3mk7-assembly4.cif.gz_K | the structure of cbb3 cytochrome oxidase | 0.9419 | 67 | 527 |
| 3mk7-assembly4.cif.gz_K | the structure of cbb3 cytochrome oxidase | 0.932 | 67 | 527 |
| 8snh-assembly1.cif.gz_E | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.9246 | 68 | 521 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5djqA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9353 | 69 | 530 | 1.20.210.10 |
| 5djqA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9255 | 69 | 530 | 1.20.210.10 |
| 4xydA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8275 | 68 | 524 | 1.20.210.10 |
| 4xydA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.824 | 68 | 524 | 1.20.210.10 |
| 2yevD01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.7781 | 73 | 526 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4S4I9D0-F1-model_v4 | deleted | 0.994 | 398 | 517 |
|
| AF-A0A2Z5ZPJ1-F1-model_v4 | Nitric oxide reductase | 0.9923 | 413 | 515 |
GO:0004129
GO:0009060 GO:0016020 GO:0020037 |
| AF-A0A7Z1SA03-F1-model_v4 | Cytochrome C oxidase Cbb3 | 0.9912 | 368 | 511 |
GO:0004129
GO:0005886 GO:0009060 GO:0015990 GO:0020037 GO:0022904 |
| AF-A0A259K6V1-F1-model_v4 | deleted | 0.9908 | 366 | 517 |
|
| AF-A0A485EQ03-F1-model_v4 | deleted | 0.9906 | 345 | 517 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar