F477438

General Info

Members Datasets Scaffolds Average Seq Length
722 393 700 155

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0003620|Ga0466969_0003620_6120_6653
Length 177
Sequence LSARAKALLSRISLFKGKRLLSQEQPLRLLIVESRFYDDIADELLAGARDALEAHGVDYDVVTVPGAFEIPAAIAMAEDAAHRPMGKAYDGYVALGCVIRGETTHYDYVCNESARGLMELSYTQRLAIGYGILTVEDEAQAWARARRSEGDKGGTVAKVCLSMIALRKSLMEGSVNG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221733 Bosea sp. Root381 Isolate Unclassified
11 2643221734 Bosea sp. Root670 Isolate Unclassified
12 2643221736 Bosea sp. Root483D1 Isolate Unclassified
13 2818991467 Bosea vestrisii 3192 Isolate Unclassified
14 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
15 2841760612 Bosea sp. Tri-49 Isolate Nodule
16 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
17 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
18 2844104063 Bosea sp. Tri-39 Isolate Nodule
19 2851182111 Bosea sp. Tri-44 Isolate Nodule
20 2851246043 Bosea sp. Tri-54 Isolate Nodule
21 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
22 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
226 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
238 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
239 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
243 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
244 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
245 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
337 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
360 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
361 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
362 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
367 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
371 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
372 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
373 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
374 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
375 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
376 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
377 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
378 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
379 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
380 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
381 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
382 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
383 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
384 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
385 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
386 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
387 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
393 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0.28
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.5
Nodule 1.52
Rhizoplane 4.57
Rhizosphere 64.54
Stem 0
Stem Tuber 0
Unclassified 8.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003184 3300002773 Bacteria 5710
2 JGI25150J39212_1011358 3300002774 Bacteria 1618
3 JGI25159J45721_1007881 3300002987 Bacteria 2995
4 JGI25151J46595_10000047 3300003187 Bacteria 166938
5 JGI25151J46595_10067274 3300003187 Bacteria 1105
6 JGI25153J46596_10003416 3300003215 Bacteria 8884
7 JGI25153J46596_10003814 3300003215 Bacteria 8317
8 rootH1_10004001 3300003316 Bacteria 4240
9 rootH1_10004001 3300003323 Bacteria 7650
10 rootH2_10067744 3300003320 Bacteria 4726
11 rootH1_10003085 3300003323 Bacteria 20562
12 rootH1_10149653 3300003323 Bacteria 2123
13 Ga0055525_1000021 3300003759 Bacteria 370802
14 Ga0055526_1000274 3300003771 Bacteria 43546
15 Ga0055526_1003449 3300003771 Bacteria 10032
16 Ga0055526_1004542 3300003771 Bacteria 8297
17 Ga0055524_1000100 3300003775 Bacteria 107020
18 Ga0055524_1000253 3300003775 Bacteria 55038
19 Ga0055524_1006673 3300003775 Bacteria 4987
20 Ga0055524_1006902 3300003775 Bacteria 4888
21 Ga0055530_10012910 3300003791 Bacteria 2885
22 Ga0055530_10016972 3300003791 Bacteria 2296
23 Ga0055540_1000011 3300003792 Bacteria 282927
24 Ga0055531_10000841 3300003794 Bacteria 25310
25 Ga0055531_10007597 3300003794 Bacteria 5877
26 Ga0055543_1021852 3300004625 Bacteria 1165
27 Ga0065165_1000046 3300005262 Bacteria 198873
28 Ga0065165_1000092 3300005262 Bacteria 148435
29 Ga0065165_1002514 3300005262 Bacteria 15295
30 Ga0065165_1040895 3300005262 Bacteria 1379
31 Ga0070658_10117742 3300005327 Bacteria 2206
32 Ga0070658_10329543 3300005327 Bacteria 1304
33 Ga0070658_10535863 3300005327 Bacteria 1013
34 Ga0070670_100000316 3300005331 Bacteria 41464
35 Ga0070677_10085159 3300005333 Bacteria 1362
36 Ga0068869_100499330 3300005334 Bacteria 1015
37 Ga0068869_101011222 3300005334 Bacteria 724
38 Ga0070680_100016657 3300005336 Bacteria 5787
39 Ga0070680_100117530 3300005336 Bacteria 2217
40 Ga0068868_100018706 3300005338 Bacteria 5184
41 Ga0068868_100586243 3300005338 Bacteria 986
42 Ga0070660_100650170 3300005339 Bacteria 883
43 Ga0070660_101486232 3300005339 Bacteria 576
44 Ga0070661_100003441 3300005344 Bacteria 10933
45 Ga0070661_100098901 3300005344 Bacteria 2167
46 Ga0070661_100299687 3300005344 Bacteria 1251
47 Ga0070669_100014753 3300005353 Bacteria 5563
48 Ga0070669_100087143 3300005353 Bacteria 2334
49 Ga0070669_100492479 3300005353 Bacteria 1016
50 Ga0070675_100021440 3300005354 Bacteria 5163
51 Ga0070675_100099423 3300005354 Bacteria 2449
52 Ga0070675_100519340 3300005354 Bacteria 1074
53 Ga0070671_100020520 3300005355 Bacteria 5389
54 Ga0070671_100099089 3300005355 Bacteria 2444
55 Ga0070674_100008892 3300005356 Bacteria 5997
56 Ga0070674_100083373 3300005356 Bacteria 2289
57 Ga0070673_100005627 3300005364 Bacteria 8040
58 Ga0070673_100029285 3300005364 Bacteria 4105
59 Ga0070673_100157990 3300005364 Bacteria 1926
60 Ga0070673_100191134 3300005364 Bacteria 1759
61 Ga0070659_100000414 3300005366 Bacteria 32437
62 Ga0070659_100015408 3300005366 Bacteria 5726
63 Ga0070659_101279782 3300005366 Bacteria 650
64 Ga0070667_100003744 3300005367 Bacteria 12915
65 Ga0070667_100102848 3300005367 Bacteria 2469
66 Ga0070667_100331610 3300005367 Bacteria 1375
67 Ga0070667_100415500 3300005367 Bacteria 1226
68 Ga0070708_100091905 3300005445 Bacteria 2764
69 Ga0070708_100806973 3300005445 Bacteria 882
70 Ga0070708_101560086 3300005445 Bacteria 615
71 Ga0070663_100000288 3300005455 Bacteria 25697
72 Ga0070663_100092489 3300005455 Bacteria 2243
73 Ga0070663_100467579 3300005455 Bacteria 1042
74 Ga0070678_100040094 3300005456 Bacteria 3311
75 Ga0070678_100102871 3300005456 Bacteria 2218
76 Ga0070678_100164633 3300005456 Bacteria 1800
77 Ga0070678_100554348 3300005456 Bacteria 1021
78 Ga0070662_100035026 3300005457 Bacteria 3543
79 Ga0070662_100081290 3300005457 Bacteria 2414
80 Ga0070662_100577276 3300005457 Bacteria 944
81 Ga0070662_100770099 3300005457 Bacteria 817
82 Ga0070662_100886986 3300005457 Bacteria 761
83 Ga0070681_10054252 3300005458 Bacteria 3993
84 Ga0070681_10063126 3300005458 Bacteria 3677
85 Ga0068867_100000018 3300005459 Bacteria 102056
86 Ga0068867_100000712 3300005459 Bacteria 22179
87 Ga0068867_100638880 3300005459 Bacteria 932
88 Ga0068867_100744418 3300005459 Bacteria 869
89 Ga0070706_100007035 3300005467 Bacteria 10608
90 Ga0070707_100468705 3300005468 Bacteria 1220
91 Ga0070698_100186433 3300005471 Bacteria 2012
92 Ga0070679_100013942 3300005530 Bacteria 7702
93 Ga0068853_100029981 3300005539 Bacteria 4591
94 Ga0068853_100095928 3300005539 Bacteria 2616
95 Ga0068853_100252485 3300005539 Bacteria 1619
96 Ga0068853_100815956 3300005539 Bacteria 894
97 Ga0070672_100000206 3300005543 Bacteria 32562
98 Ga0070672_100045348 3300005543 Bacteria 3400
99 Ga0070672_100425536 3300005543 Bacteria 1141
100 Ga0070665_100000327 3300005548 Bacteria 73382
101 Ga0070665_100405347 3300005548 Bacteria 1372
102 Ga0070665_100997449 3300005548 Bacteria 850
103 Ga0070665_101849886 3300005548 Bacteria 610
104 Ga0068855_100116069 3300005563 Bacteria 3068
105 Ga0070664_100013581 3300005564 Bacteria 6634
106 Ga0070664_100018046 3300005564 Bacteria 5793
107 Ga0070664_100162347 3300005564 Bacteria 1977
108 Ga0068857_100021161 3300005577 Bacteria 5724
109 Ga0068857_101020747 3300005577 Bacteria 797
110 Ga0068857_101093259 3300005577 Bacteria 770
111 Ga0068854_100135522 3300005578 Bacteria 1884
112 Ga0068856_100111665 3300005614 Bacteria 2731
113 Ga0070702_100283635 3300005615 Bacteria 1138
114 Ga0068852_100005610 3300005616 Bacteria 9001
115 Ga0068852_100042576 3300005616 Bacteria 3844
116 Ga0068859_100342955 3300005617 Bacteria 1588
117 Ga0068864_100184243 3300005618 Bacteria 1910
118 Ga0068861_101391081 3300005719 Bacteria 685
119 Ga0068870_10180713 3300005840 Bacteria 1266
120 Ga0068858_100321144 3300005842 Bacteria 1480
121 Ga0068860_100044526 3300005843 Bacteria 4230
122 Ga0068860_100902231 3300005843 Bacteria 900
123 Ga0068862_100041852 3300005844 Bacteria 3900
124 Ga0081455_10313754 3300005937 Bacteria 1120
125 Ga0070717_10235061 3300006028 Bacteria 1614
126 Ga0075368_10034052 3300006042 Bacteria 1984
127 Ga0075368_10183265 3300006042 Bacteria 883
128 Ga0075363_100014280 3300006048 Bacteria 3875
129 Ga0075363_100049825 3300006048 Bacteria 2231
130 Ga0075363_100208489 3300006048 Bacteria 1118
131 Ga0075364_10134327 3300006051 Bacteria 1662
132 Ga0075364_10368715 3300006051 Bacteria 979
133 Ga0075362_10002253 3300006177 Bacteria 6422
134 Ga0075362_10062132 3300006177 Bacteria 1692
135 Ga0075362_10251339 3300006177 Bacteria 869
136 Ga0075367_10000848 3300006178 Bacteria 12173
137 Ga0075367_10015213 3300006178 Bacteria 4177
138 Ga0075367_10047448 3300006178 Bacteria 2527
139 Ga0075367_10356749 3300006178 Bacteria 923
140 Ga0075369_10002971 3300006186 Bacteria 6127
141 Ga0075369_10022450 3300006186 Bacteria 2603
142 Ga0075369_10233888 3300006186 Bacteria 852
143 Ga0075366_10030684 3300006195 Bacteria 3161
144 Ga0075366_10039649 3300006195 Bacteria 2784
145 Ga0075366_10083557 3300006195 Bacteria 1908
146 Ga0075366_10126518 3300006195 Bacteria 1541
147 Ga0075366_10174084 3300006195 Bacteria 1306
148 Ga0075366_10196770 3300006195 Bacteria 1225
149 Ga0075366_10767181 3300006195 Bacteria 599
150 Ga0097621_100198506 3300006237 Bacteria 1740
151 Ga0075370_10002309 3300006353 Bacteria 8796
152 Ga0075370_10003363 3300006353 Bacteria 7605
153 Ga0075370_10006079 3300006353 Bacteria 6050
154 Ga0075370_10047864 3300006353 Bacteria 2421
155 Ga0075370_10269571 3300006353 Bacteria 1010
156 Ga0075430_100007141 3300006846 Bacteria 9423
157 Ga0075431_100024811 3300006847 Bacteria 6147
158 Ga0075431_100149677 3300006847 Bacteria 2404
159 Ga0068865_100044344 3300006881 Bacteria 3043
160 Ga0097620_100343001 3300006931 Bacteria 1588
161 Ga0099824_1038383 3300006942 Bacteria 1278
162 Ga0099823_1002588 3300006944 Bacteria 16426
163 Ga0079104_1000040 3300006946 Bacteria 187962
164 Ga0105240_10006664 3300009093 Bacteria 16933
165 Ga0105240_10012992 3300009093 Bacteria 11468
166 Ga0105240_10018555 3300009093 Bacteria 9337
167 Ga0105240_10050283 3300009093 Bacteria 5256
168 Ga0105240_10263605 3300009093 Bacteria 1987
169 Ga0105240_10526827 3300009093 Bacteria 1310
170 Ga0105240_11641934 3300009093 Bacteria 672
171 Ga0111539_10314626 3300009094 Bacteria 1822
172 Ga0111539_12099261 3300009094 Bacteria 655
173 Ga0105245_10019471 3300009098 Bacteria 5946
174 Ga0105245_10220088 3300009098 Bacteria 1831
175 Ga0105245_10363626 3300009098 Bacteria 1437
176 Ga0114129_10118791 3300009147 Bacteria 3642
177 Ga0105243_10040230 3300009148 Bacteria 3649
178 Ga0105243_10171020 3300009148 Bacteria 1882
179 Ga0105243_10317841 3300009148 Bacteria 1418
180 Ga0105243_10891390 3300009148 Bacteria 884
181 Ga0105241_10208010 3300009174 Bacteria 1638
182 Ga0105241_10438568 3300009174 Bacteria 1153
183 Ga0105242_11131663 3300009176 Bacteria 798
184 Ga0105248_10015263 3300009177 Bacteria 8467
185 Ga0105237_10003122 3300009545 Bacteria 19945
186 Ga0105237_10023165 3300009545 Bacteria 6366
187 Ga0105237_12115687 3300009545 Bacteria 572
188 Ga0105238_10021552 3300009551 Bacteria 6563
189 Ga0105238_10044939 3300009551 Bacteria 4464
190 Ga0105238_10051787 3300009551 Bacteria 4128
191 Ga0105238_10451673 3300009551 Bacteria 1282
192 Ga0105249_10599643 3300009553 Bacteria 1156
193 Ga0105239_10000563 3300010375 Bacteria 53173
194 Ga0105239_10026325 3300010375 Bacteria 6401
195 Ga0105239_10216562 3300010375 Bacteria 2147
196 Ga0105239_13222042 3300010375 Bacteria 531
197 Ga0157370_10407612 3300013104 Bacteria 1251
198 Ga0157370_10538377 3300013104 Bacteria 1071
199 Ga0157369_10740205 3300013105 Bacteria 1012
200 Ga0171462_1011 3300013250 Bacteria 229282
201 Ga0157374_10534134 3300013296 Bacteria 1180
202 Ga0157374_12150638 3300013296 Bacteria 585
203 Ga0157378_10261888 3300013297 Bacteria 1659
204 Ga0163162_10266438 3300013306 Bacteria 1844
205 Ga0163162_10620307 3300013306 Bacteria 1207
206 Ga0163162_12423241 3300013306 Bacteria 603
207 Ga0157372_11158564 3300013307 Bacteria 894
208 Ga0157375_10095126 3300013308 Bacteria 3049
209 Ga0157375_10155596 3300013308 Bacteria 2425
210 Ga0157375_10410485 3300013308 Bacteria 1520
211 Ga0163163_10171221 3300014325 Bacteria 2218
212 Ga0157380_11437095 3300014326 Bacteria 741
213 Ga0157380_11851205 3300014326 Bacteria 663
214 Ga0157380_12606719 3300014326 Bacteria 572
215 Ga0157377_10000051 3300014745 Bacteria 90204
216 Ga0157377_10823948 3300014745 Bacteria 686
217 Ga0157379_10467459 3300014968 Bacteria 1166
218 Ga0157376_11986851 3300014969 Bacteria 619
219 Ga0163161_10003613 3300017792 Bacteria 10852
220 Ga0213872_10000046 3300021361 Bacteria 109934
221 Ga0213872_10000048 3300021361 Bacteria 109712
222 Ga0213872_10000086 3300021361 Bacteria 84955
223 Ga0213872_10000090 3300021361 Bacteria 83813
224 Ga0213872_10024668 3300021361 Bacteria 2766
225 Ga0213872_10216111 3300021361 Bacteria 817
226 Ga0213872_10220729 3300021361 Bacteria 807
227 Ga0209563_100005 3300025230 Bacteria 1774893
228 Ga0207425_1001899 3300025245 Bacteria 7953
229 Ga0207425_1070726 3300025245 Bacteria 598
230 Ga0209129_1000124 3300025258 Bacteria 133610
231 Ga0209565_1021127 3300025263 Bacteria 1364
232 Ga0209673_1040424 3300025273 Bacteria 1334
233 Ga0209130_1003746 3300025284 Bacteria 6211
234 Ga0209675_1000536 3300025291 Bacteria 27786
235 Ga0209676_1023653 3300025292 Bacteria 2006
236 Ga0209025_1000016 3300025294 Bacteria 770739
237 Ga0209025_1003819 3300025294 Bacteria 13753
238 Ga0209025_1043804 3300025294 Bacteria 1879
239 Ga0209564_1000023 3300025295 Bacteria 555102
240 Ga0209564_1000035 3300025295 Bacteria 442446
241 Ga0209564_1000057 3300025295 Bacteria 340400
242 Ga0209758_1000214 3300025297 Bacteria 126364
243 Ga0209758_1000232 3300025297 Bacteria 117382
244 Ga0209050_1000376 3300025298 Bacteria 84318
245 Ga0209050_1001215 3300025298 Bacteria 30104
246 Ga0209050_1008356 3300025298 Bacteria 5553
247 Ga0209256_1000025 3300025299 Bacteria 442449
248 Ga0209256_1000113 3300025299 Bacteria 175296
249 Ga0209256_1000262 3300025299 Bacteria 93226
250 Ga0207426_1014534 3300025302 Bacteria 2881
251 Ga0209051_1000020 3300025303 Bacteria 508628
252 Ga0209257_1000085 3300025304 Bacteria 291117
253 Ga0209257_1013523 3300025304 Bacteria 3619
254 Ga0209257_1032608 3300025304 Bacteria 1649
255 Ga0209257_1040596 3300025304 Bacteria 1387
256 Ga0207682_10000269 3300025893 Bacteria 23507
257 Ga0207682_10010445 3300025893 Bacteria 3639
258 Ga0207642_10187481 3300025899 Bacteria 1132
259 Ga0207680_10221406 3300025903 Bacteria 1298
260 Ga0207645_10048409 3300025907 Bacteria 2714
261 Ga0207645_10336406 3300025907 Bacteria 1009
262 Ga0207643_10149855 3300025908 Bacteria 1398
263 Ga0207643_10258548 3300025908 Bacteria 1074
264 Ga0207705_10001301 3300025909 Bacteria 20026
265 Ga0207705_10284910 3300025909 Bacteria 1265
266 Ga0207684_10000871 3300025910 Bacteria 34446
267 Ga0207707_10044666 3300025912 Bacteria 3862
268 Ga0207707_10061291 3300025912 Bacteria 3273
269 Ga0207695_10000728 3300025913 Bacteria 63935
270 Ga0207695_10002551 3300025913 Bacteria 26766
271 Ga0207695_10014064 3300025913 Bacteria 9503
272 Ga0207695_10017230 3300025913 Bacteria 8414
273 Ga0207695_10021053 3300025913 Bacteria 7449
274 Ga0207695_10105580 3300025913 Bacteria 2804
275 Ga0207671_10005735 3300025914 Bacteria 11318
276 Ga0207671_10102303 3300025914 Bacteria 2171
277 Ga0207660_10032401 3300025917 Bacteria 3607
278 Ga0207660_10084746 3300025917 Bacteria 2336
279 Ga0207657_10004872 3300025919 Bacteria 14126
280 Ga0207657_10058952 3300025919 Bacteria 3301
281 Ga0207657_10079911 3300025919 Bacteria 2750
282 Ga0207657_10373856 3300025919 Bacteria 1123
283 Ga0207657_10433400 3300025919 Bacteria 1032
284 Ga0207649_10004702 3300025920 Bacteria 7388
285 Ga0207649_10154689 3300025920 Bacteria 1583
286 Ga0207652_10014009 3300025921 Bacteria 6492
287 Ga0207652_10723290 3300025921 Bacteria 887
288 Ga0207681_10012357 3300025923 Bacteria 5268
289 Ga0207681_10077266 3300025923 Bacteria 2340
290 Ga0207681_10340000 3300025923 Bacteria 1199
291 Ga0207681_10546601 3300025923 Bacteria 953
292 Ga0207694_10017119 3300025924 Bacteria 5476
293 Ga0207694_10046881 3300025924 Bacteria 3341
294 Ga0207694_10162481 3300025924 Bacteria 1805
295 Ga0207650_10000172 3300025925 Bacteria 76270
296 Ga0207650_10194608 3300025925 Bacteria 1622
297 Ga0207650_10433211 3300025925 Bacteria 1092
298 Ga0207659_10000066 3300025926 Bacteria 66468
299 Ga0207659_10352282 3300025926 Bacteria 1222
300 Ga0207687_10184623 3300025927 Bacteria 1618
301 Ga0207687_10264631 3300025927 Bacteria 1372
302 Ga0207687_10368975 3300025927 Bacteria 1173
303 Ga0207644_10017947 3300025931 Bacteria 4784
304 Ga0207644_10343913 3300025931 Bacteria 1210
305 Ga0207690_10000294 3300025932 Bacteria 35162
306 Ga0207690_10000990 3300025932 Bacteria 18184
307 Ga0207706_10046461 3300025933 Bacteria 3844
308 Ga0207706_10428628 3300025933 Bacteria 1145
309 Ga0207706_10599818 3300025933 Bacteria 946
310 Ga0207709_10000889 3300025935 Bacteria 22596
311 Ga0207669_10026021 3300025937 Bacteria 3174
312 Ga0207669_10111764 3300025937 Bacteria 1833
313 Ga0207669_10217891 3300025937 Bacteria 1398
314 Ga0207704_10403934 3300025938 Bacteria 1079
315 Ga0207691_10000265 3300025940 Bacteria 51755
316 Ga0207691_10009413 3300025940 Bacteria 9384
317 Ga0207691_10064013 3300025940 Bacteria 3333
318 Ga0207691_10664794 3300025940 Bacteria 880
319 Ga0207711_10001005 3300025941 Bacteria 27049
320 Ga0207711_11109109 3300025941 Bacteria 732
321 Ga0207689_10175883 3300025942 Bacteria 1765
322 Ga0207679_10006650 3300025945 Bacteria 7318
323 Ga0207679_10011841 3300025945 Bacteria 5670
324 Ga0207679_10271021 3300025945 Bacteria 1452
325 Ga0207679_11408055 3300025945 Bacteria 640
326 Ga0207667_10006530 3300025949 Bacteria 14103
327 Ga0207667_10019379 3300025949 Bacteria 7597
328 Ga0207651_10034339 3300025960 Bacteria 3284
329 Ga0207651_10129420 3300025960 Bacteria 1929
330 Ga0207651_10140082 3300025960 Bacteria 1867
331 Ga0207651_10273466 3300025960 Bacteria 1392
332 Ga0207712_11522526 3300025961 Bacteria 599
333 Ga0207668_10488555 3300025972 Bacteria 1057
334 Ga0207658_10031651 3300025986 Bacteria 3758
335 Ga0207658_10079771 3300025986 Bacteria 2505
336 Ga0207658_10207290 3300025986 Bacteria 1641
337 Ga0207658_10269678 3300025986 Bacteria 1454
338 Ga0207658_10320768 3300025986 Bacteria 1341
339 Ga0207658_10912347 3300025986 Bacteria 800
340 Ga0207677_10064156 3300026023 Bacteria 2557
341 Ga0207677_10357805 3300026023 Bacteria 1225
342 Ga0207677_10666274 3300026023 Bacteria 920
343 Ga0207703_10549307 3300026035 Bacteria 1089
344 Ga0207703_10754915 3300026035 Bacteria 927
345 Ga0207639_10079911 3300026041 Bacteria 2585
346 Ga0207639_10086256 3300026041 Bacteria 2499
347 Ga0207639_10651837 3300026041 Bacteria 974
348 Ga0207639_10690553 3300026041 Bacteria 946
349 Ga0207678_10001406 3300026067 Bacteria 22142
350 Ga0207678_10151853 3300026067 Bacteria 1978
351 Ga0207678_10300228 3300026067 Bacteria 1380
352 Ga0207678_10466618 3300026067 Bacteria 1098
353 Ga0207702_10582604 3300026078 Bacteria 1097
354 Ga0207641_10041181 3300026088 Bacteria 3871
355 Ga0207648_10000060 3300026089 Bacteria 102225
356 Ga0207648_10044482 3300026089 Bacteria 3895
357 Ga0207648_10126026 3300026089 Bacteria 2253
358 Ga0207648_10200534 3300026089 Bacteria 1769
359 Ga0207648_10280613 3300026089 Bacteria 1490
360 Ga0207648_11376382 3300026089 Bacteria 663
361 Ga0207676_10117777 3300026095 Bacteria 2234
362 Ga0207674_10018423 3300026116 Bacteria 7588
363 Ga0207674_10424112 3300026116 Bacteria 1285
364 Ga0207675_100178236 3300026118 Bacteria 2034
365 Ga0207675_100699016 3300026118 Bacteria 1023
366 Ga0207675_101231684 3300026118 Bacteria 769
367 Ga0207683_10065460 3300026121 Bacteria 3205
368 Ga0207683_10114077 3300026121 Bacteria 2421
369 Ga0207683_10259656 3300026121 Bacteria 1586
370 Ga0207683_10337638 3300026121 Bacteria 1381
371 Ga0207683_10478185 3300026121 Bacteria 1149
372 Ga0207698_10003996 3300026142 Bacteria 8945
373 Ga0207698_10039287 3300026142 Bacteria 3504
374 Ga0207698_10315229 3300026142 Bacteria 1462
375 Ga0209281_1000074 3300027111 Bacteria 267848
376 Ga0209813_10036427 3300027866 Bacteria 1478
377 Ga0268266_10000064 3300028379 Bacteria 249533
378 Ga0268266_10108959 3300028379 Bacteria 2452
379 Ga0268266_10675334 3300028379 Bacteria 995
380 Ga0268266_11399608 3300028379 Bacteria 675
381 Ga0307517_10000499 3300028786 Bacteria 67326
382 Ga0307517_10234865 3300028786 Bacteria 1095
383 Ga0307517_10274665 3300028786 Bacteria 966
384 Ga0307515_10000366 3300028794 Bacteria 111195
385 Ga0307515_10001653 3300028794 Bacteria 49625
386 Ga0307515_10124341 3300028794 Bacteria 2895
387 Ga0307515_10141336 3300028794 Bacteria 2580
388 Ga0307515_10251358 3300028794 Bacteria 1520
389 Ga0307515_10283422 3300028794 Bacteria 1361
390 Ga0265338_10611835 3300028800 Bacteria 758
391 Ga0265324_10188597 3300029957 Bacteria 700
392 Ga0307512_10065820 3300030522 Bacteria 2743
393 Ga0265340_10023067 3300031247 Bacteria 3175
394 Ga0265331_10009064 3300031250 Bacteria 5619
395 Ga0265327_10000028 3300031251 Bacteria 361066
396 Ga0307513_10067533 3300031456 Bacteria 3750
397 Ga0307513_10085924 3300031456 Bacteria 3227
398 Ga0307513_10130895 3300031456 Bacteria 2455
399 Ga0307513_10392945 3300031456 Bacteria 1123
400 Ga0307513_10702708 3300031456 Bacteria 717
401 Ga0307408_100120045 3300031548 Bacteria 2035
402 Ga0307408_100148194 3300031548 Bacteria 1850
403 Ga0307408_101519866 3300031548 Bacteria 634
404 Ga0307508_10000194 3300031616 Bacteria 73425
405 Ga0307508_10025639 3300031616 Bacteria 5342
406 Ga0307508_10350083 3300031616 Bacteria 1069
407 Ga0307514_10023006 3300031649 Bacteria 5059
408 Ga0307514_10080658 3300031649 Bacteria 2407
409 Ga0307516_10001561 3300031730 Bacteria 31504
410 Ga0307516_10002583 3300031730 Bacteria 24044
411 Ga0307516_10044992 3300031730 Bacteria 4363
412 Ga0307516_10075203 3300031730 Bacteria 3232
413 Ga0307516_10445659 3300031730 Bacteria 951
414 Ga0307516_10597004 3300031730 Bacteria 758
415 Ga0307406_10058574 3300031901 Bacteria 2476
416 Ga0307412_11288395 3300031911 Bacteria 657
417 Ga0307414_10154051 3300032004 Bacteria 1817
418 Ga0307414_11696264 3300032004 Bacteria 589
419 Ga0307411_11079297 3300032005 Bacteria 723
420 Ga0316593_10039952 3300032168 Bacteria 1558
421 Ga0307507_10172037 3300033179 Bacteria 1571
422 Ga0307510_10394286 3300033180 Bacteria 828
423 Ga0373938_0018338 3300034957 Bacteria 1387
424 Ga0373940_0138048 3300035088 Bacteria 769
425 Ga0373945_0026066 3300035116 Bacteria 2035
426 Ga0373953_0261981 3300035117 Bacteria 752
427 Ga0373943_0338526 3300035170 Bacteria 860
428 Ga0373927_0000732 3300035695 Bacteria 25058
429 Ga0373947_0222831 3300035725 Bacteria 1240
430 Ga0373937_0103288 3300036401 Bacteria 2647
431 Ga0316582_0108050 3300036647 Bacteria 1849
432 Ga0316582_0207049 3300036647 Bacteria 1339
433 Ga0316584_0294569 3300036712 Bacteria 1176
434 Ga0316584_0347375 3300036712 Bacteria 1066
435 Ga0373925_0000039 3300037068 Bacteria 138537
436 Ga0373925_0004687 3300037068 Bacteria 10318
437 Ga0373925_1272001 3300037068 Bacteria 604
438 Ga0395899_0000013 3300037312 Bacteria 510397
439 Ga0395900_0129947 3300037418 Bacteria 2582
440 Ga0395905_0000172 3300037471 Bacteria 105228
441 Ga0395905_0233538 3300037471 Bacteria 1719
442 Ga0395905_0517028 3300037471 Bacteria 1094
443 Ga0237819_10957 3300038705 Bacteria 1166
444 Ga0237816_03719 3300039145 Bacteria 1098
445 Ga0436361_0042216 3300039447 Bacteria 6380
446 Ga0436361_0511852 3300039447 Bacteria 4509
447 Ga0436361_0567912 3300039447 Bacteria 1106
448 Ga0436361_0633280 3300039447 Bacteria 103480
449 Ga0436361_0661766 3300039447 Bacteria 37529
450 Ga0436361_0692684 3300039447 Bacteria 133303
451 Ga0436361_0874346 3300039447 Bacteria 6661
452 Ga0436361_0892385 3300039447 Bacteria 12235
453 Ga0436361_0943694 3300039447 Bacteria 119574
454 Ga0436361_0973074 3300039447 Bacteria 1837
455 Ga0436361_1008726 3300039447 Bacteria 1685
456 Ga0451789_0772919 3300041443 Bacteria 2283
457 Ga0451791_1786793 3300041451 Bacteria 1076
458 Ga0451793_1319808 3300041452 Bacteria 1432
459 Ga0451797_0349248 3300041453 Bacteria 675
460 Ga0451797_0494721 3300041453 Bacteria 529
461 Ga0451797_0636430 3300041453 Bacteria 893
462 Ga0451795_0259599 3300041456 Bacteria 716
463 Ga0451795_0766554 3300041456 Bacteria 1963
464 Ga0451800_0252204 3300041459 Bacteria 2246
465 Ga0451800_1634667 3300041459 Bacteria 1967
466 Ga0451807_2396062 3300041486 Bacteria 551
467 Ga0451837_0656693 3300041494 Bacteria 717
468 Ga0451841_1304204 3300041498 Bacteria 1217
469 Ga0451851_0101857 3300041507 Bacteria 545
470 Ga0451843_0764763 3300041509 Bacteria 674
471 Ga0451855_0947765 3300041511 Bacteria 1493
472 Ga0451853_0482874 3300041512 Bacteria 848
473 Ga0451853_1144964 3300041512 Bacteria 1810
474 Ga0439431_0005195 3300041997 Bacteria 2869
475 Ga0450919_000139 3300042121 Bacteria 7504
476 Ga0450888_002426 3300042126 Bacteria 1842
477 Ga0439458_0006248 3300042157 Bacteria 2658
478 Ga0450918_005133 3300042531 Bacteria 2358
479 Ga0451577_0018787 3300042876 Bacteria 6359
480 Ga0451577_0022716 3300042876 Bacteria 5727
481 Ga0451577_0086132 3300042876 Bacteria 2803
482 Ga0451577_0201049 3300042876 Bacteria 1799
483 Ga0451577_0631265 3300042876 Bacteria 972
484 Ga0466969_0003620 3300044656 Bacteria 8226
485 Ga0466972_0110957 3300044658 Bacteria 1296
486 Ga0453683_0944648 3300044673 Bacteria 571
487 Ga0466965_0435424 3300044683 Bacteria 728
488 Ga0466966_0002874 3300044684 Bacteria 11339
489 Ga0466966_0134468 3300044684 Bacteria 1513
490 Ga0466966_0335687 3300044684 Bacteria 908
491 Ga0466961_0003361 3300044693 Bacteria 9986
492 Ga0466963_0194542 3300044694 Bacteria 1417
493 Ga0453684_0297230 3300044712 Bacteria 1836
494 Ga0453684_0412049 3300044712 Bacteria 1511
495 Ga0453684_0640441 3300044712 Bacteria 1161
496 Ga0466971_0000586 3300044719 Bacteria 14390
497 Ga0466970_0013079 3300044765 Bacteria 4252
498 Ga0466970_0080053 3300044765 Bacteria 1765
499 Ga0466957_0004597 3300044842 Bacteria 7714
500 Ga0466960_0137794 3300044901 Bacteria 1293
501 Ga0466959_0000060 3300045049 Bacteria 76590
502 Ga0466959_0651449 3300045049 Bacteria 707
503 Ga0451576_0072763 3300045051 Bacteria 3576
504 Ga0451576_0275135 3300045051 Bacteria 1760
505 Ga0466958_0001428 3300045836 Bacteria 11321
506 Ga0495590_0054938 3300046457 Bacteria 1391
507 Ga0495638_0174869 3300046460 Bacteria 1229
508 Ga0495650_0003992 3300046471 Bacteria 10361
509 Ga0495605_0082631 3300046474 Bacteria 1500
510 Ga0495606_0433630 3300046507 Bacteria 677
511 Ga0495610_0011872 3300046512 Bacteria 5291
512 Ga0495610_0063215 3300046512 Bacteria 1754
513 Ga0495616_0214048 3300046513 Bacteria 842
514 Ga0495620_0314476 3300046515 Bacteria 595
515 Ga0495628_0355406 3300046516 Bacteria 1076
516 Ga0495630_0858381 3300046517 Bacteria 692
517 Ga0495632_0008169 3300046519 Bacteria 6466
518 Ga0495632_0010554 3300046519 Bacteria 5455
519 Ga0495637_0139927 3300046520 Bacteria 919
520 Ga0495643_0008013 3300046522 Bacteria 6735
521 Ga0495643_0125809 3300046522 Bacteria 1291
522 Ga0495642_0078054 3300046528 Bacteria 1391
523 Ga0495642_0217410 3300046528 Bacteria 834
524 Ga0495652_0447252 3300046529 Bacteria 905
525 Ga0495654_0152004 3300046530 Bacteria 1023
526 Ga0495586_0420340 3300046535 Bacteria 770
527 Ga0495598_0011607 3300046537 Bacteria 2141
528 Ga0495621_0005161 3300046539 Bacteria 3734
529 Ga0495597_0004699 3300046542 Bacteria 7409
530 Ga0495597_0057252 3300046542 Bacteria 1706
531 Ga0495597_0297325 3300046542 Bacteria 627
532 Ga0495645_0249612 3300046543 Bacteria 1180
533 Ga0495668_0103975 3300046616 Bacteria 1554
534 Ga0495611_0013778 3300046648 Bacteria 3447
535 Ga0495625_0008189 3300046660 Bacteria 8949
536 Ga0495625_0012918 3300046660 Bacteria 6742
537 Ga0495625_0155573 3300046660 Bacteria 1534
538 Ga0495658_0109631 3300046683 Bacteria 1658
539 Ga0495658_0311035 3300046683 Bacteria 997
540 Ga0495658_0383963 3300046683 Bacteria 894
541 Ga0495669_0000001 3300046684 Bacteria 291866
542 Ga0495669_0035082 3300046684 Bacteria 2214
543 Ga0495669_0484695 3300046684 Bacteria 601
544 Ga0495671_0085257 3300046692 Bacteria 1548
545 Ga0495671_0311793 3300046692 Bacteria 756
546 Ga0495649_0004058 3300046694 Bacteria 9640
547 Ga0495660_0377967 3300046810 Bacteria 625
548 Ga0495687_001087 3300047443 Bacteria 26673
549 Ga0495687_033644 3300047443 Bacteria 2322
550 Ga0495677_0117681 3300047445 Bacteria 1012
551 Ga0495673_0091223 3300047469 Bacteria 1245
552 Ga0495686_0000902 3300047472 Bacteria 37377
553 Ga0496100_0029766 3300048903 Bacteria 3381
554 Ga0496101_0101156 3300048904 Bacteria 2158
555 Ga0496101_0577309 3300048904 Bacteria 889
556 Ga0496102_0001780 3300048905 Bacteria 18690
557 Ga0496102_0024399 3300048905 Bacteria 5376
558 Ga0496102_0060433 3300048905 Bacteria 3466
559 Ga0496103_0820791 3300048906 Bacteria 586
560 Ga0496104_0236210 3300048907 Bacteria 1740
561 Ga0496106_0079932 3300048909 Bacteria 2510
562 Ga0496108_0009257 3300048911 Bacteria 7968
563 Ga0496109_0048685 3300048912 Bacteria 3856
564 Ga0496109_0603948 3300048912 Bacteria 1033
565 Ga0496109_0887995 3300048912 Bacteria 829
566 Ga0496109_0951750 3300048912 Bacteria 797
567 Ga0496110_0186247 3300048913 Bacteria 1885
568 Ga0496112_0186065 3300048915 Bacteria 2040
569 Ga0496112_0262013 3300048915 Bacteria 1678
570 Ga0496113_0198381 3300048916 Bacteria 1595
571 Ga0496114_0030428 3300048917 Bacteria 4442
572 Ga0496114_0185745 3300048917 Bacteria 1817
573 Ga0496115_0000607 3300048918 Bacteria 27313
574 Ga0496115_0007666 3300048918 Bacteria 7955
575 Ga0496117_0050014 3300048920 Bacteria 2967
576 Ga0496121_0023861 3300048924 Bacteria 5870
577 Ga0496121_0777371 3300048924 Bacteria 566
578 Ga0496122_0083737 3300048925 Bacteria 2209
579 Ga0496123_0059398 3300048926 Bacteria 2472
580 Ga0496124_0000079 3300048927 Bacteria 212057
581 Ga0496124_0196604 3300048927 Bacteria 1538
582 Ga0496125_0003021 3300048928 Bacteria 21042
583 Ga0496125_0547291 3300048928 Bacteria 642
584 Ga0496125_0661057 3300048928 Bacteria 561
585 Ga0496126_0026814 3300048929 Bacteria 5517
586 Ga0496126_0971145 3300048929 Bacteria 639
587 Ga0501323_010732 3300049539 Bacteria 1096
588 Ga0501033_0565430 3300049570 Bacteria 782
589 Ga0501034_0157847 3300049571 Bacteria 2241
590 Ga0501034_0246624 3300049571 Bacteria 1731
591 Ga0501036_0933882 3300049572 Bacteria 711
592 Ga0501036_1120963 3300049572 Bacteria 642
593 Ga0501037_0075842 3300049573 Bacteria 2442
594 Ga0501037_0280206 3300049573 Bacteria 1162
595 Ga0501038_0129680 3300049574 Bacteria 2072
596 Ga0501043_0000108 3300049579 Bacteria 77329
597 Ga0501043_0115490 3300049579 Bacteria 2107
598 Ga0501046_0000050 3300049580 Bacteria 134922
599 Ga0501047_0000012 3300049581 Bacteria 368824
600 Ga0501047_0004960 3300049581 Bacteria 12498
601 Ga0501048_0000521 3300049582 Bacteria 27029
602 Ga0501067_0011183 3300049583 Bacteria 4965
603 Ga0501068_0271218 3300049584 Bacteria 1083
604 Ga0501069_0187855 3300049585 Bacteria 1195
605 Ga0501070_0714208 3300049586 Bacteria 792
606 Ga0501071_0810304 3300049587 Bacteria 722
607 Ga0501072_0003168 3300049588 Bacteria 12380
608 Ga0501072_0098114 3300049588 Bacteria 2329
609 Ga0501073_0013100 3300049589 Bacteria 6046
610 Ga0501074_0049878 3300049590 Bacteria 3022
611 Ga0501075_0219277 3300049591 Bacteria 1451
612 Ga0501076_0677045 3300049592 Bacteria 851
613 Ga0501077_0103399 3300049593 Bacteria 1805
614 Ga0501198_000030 3300049649 Bacteria 59540
615 Ga0501222_000047 3300049662 Bacteria 44574
616 Ga0501079_0027856 3300049741 Bacteria 4334
617 Ga0501079_0238683 3300049741 Bacteria 1420
618 Ga0501080_0147968 3300049742 Bacteria 2171
619 Ga0501081_0439574 3300049743 Bacteria 968
620 Ga0501035_0005859 3300049822 Bacteria 11581
621 Ga0501035_0211004 3300049822 Bacteria 1661
622 Ga0501044_0582085 3300049823 Bacteria 1014
623 Ga0501045_0315337 3300049824 Bacteria 1163
624 Ga0501045_0610643 3300049824 Bacteria 807
625 nmdc:mga03683_12840_c1 3300050489 Bacteria 3069
626 nmdc:mga03n38_846963_c1 3300050490 Bacteria 535
627 nmdc:mga00v17_117998_c1 3300050491 Bacteria 1688
628 nmdc:mga0yw44_280599_c1 3300050492 Bacteria 1113
629 nmdc:mga0k408_270946_c1 3300050493 Bacteria 1014
630 nmdc:mga0k408_3090_c1 3300050493 Bacteria 8816
631 nmdc:mga0k408_311471_c1 3300050493 Bacteria 940
632 nmdc:mga0k408_39231_c1 3300050493 Bacteria 2720
633 nmdc:mga0k408_417_c2 3300050493 Bacteria 21558
634 nmdc:mga0k408_725_c1 3300050493 Bacteria 18088
635 nmdc:mga06z11_142899_c1 3300050494 Bacteria 1354
636 nmdc:mga06z11_390529_c1 3300050494 Bacteria 837
637 nmdc:mga06z11_449297_c1 3300050494 Bacteria 779
638 nmdc:mga04h51_130520_c1 3300050495 Bacteria 944
639 nmdc:mga04h51_41706_c1 3300050495 Bacteria 1501
640 nmdc:mga04h51_69857_c1 3300050495 Bacteria 1224
641 nmdc:mga07m45_160_c1 3300050496 Bacteria 27032
642 nmdc:mga07m45_191726_c1 3300050496 Bacteria 1189
643 nmdc:mga07m45_196949_c1 3300050496 Bacteria 1172
644 nmdc:mga07m45_43396_c1 3300050496 Bacteria 2521
645 nmdc:mga07m45_6211_c1 3300050496 Bacteria 6030
646 nmdc:mga07m45_7544_c1 3300050496 Bacteria 5564
647 nmdc:mga07m45_9764_c1 3300050496 Bacteria 4992
648 nmdc:mga05p37_64684_c1 3300050507 Bacteria 4500
649 nmdc:mga0qj67_70852_c1 3300050509 Bacteria 2781
650 nmdc:mga06r32_351191_c1 3300050510 Bacteria 1459
651 nmdc:mga06r32_571990_c1 3300050510 Bacteria 1103
652 nmdc:mga08y16_751343_c1 3300050511 Bacteria 971
653 nmdc:mga0sz30_17553_c1 3300050516 Bacteria 2855
654 Ga0500635_0001608 3300053080 Bacteria 5440
655 Ga0495655_0059358 3300053083 Bacteria 1039
656 Ga0500578_0000537 3300053086 Bacteria 46023
657 Ga0500578_0056046 3300053086 Bacteria 2521
658 Ga0500644_0004699 3300053088 Bacteria 3427
659 Ga0500647_0003051 3300053091 Bacteria 6424
660 Ga0500583_0288271 3300053092 Bacteria 805
661 Ga0500651_0396466 3300053093 Bacteria 776
662 Ga0500572_028022 3300053111 Bacteria 1547
663 Ga0500593_000152 3300053117 Bacteria 27719
664 Ga0500597_064178 3300053120 Bacteria 1581
665 Ga0500607_056281 3300053121 Bacteria 2077
666 Ga0500642_0002803 3300053130 Bacteria 5170
667 Ga0500652_000361 3300053131 Bacteria 16332
668 Ga0500655_003842 3300053133 Bacteria 2712
669 Ga0500658_0010005 3300053134 Bacteria 3499
670 Ga0500658_0156803 3300053134 Bacteria 1029
671 Ga0500559_0053830 3300053136 Bacteria 1782
672 Ga0500559_0103509 3300053136 Bacteria 1314
673 Ga0500561_0019926 3300053137 Bacteria 1561
674 Ga0500561_0038360 3300053137 Bacteria 1251
675 Ga0500561_0041435 3300053137 Bacteria 1218
676 Ga0500568_0011426 3300053139 Bacteria 4122
677 Ga0500568_0014287 3300053139 Bacteria 3590
678 Ga0500577_0051585 3300053142 Bacteria 1547
679 Ga0500579_203344 3300053143 Bacteria 727
680 Ga0500589_194371 3300053147 Bacteria 785
681 Ga0500603_081034 3300053150 Bacteria 940
682 Ga0500616_0080640 3300053153 Bacteria 1636
683 Ga0500616_0173273 3300053153 Bacteria 978
684 Ga0500619_000004 3300053154 Bacteria 98915
685 Ga0500619_246664 3300053154 Bacteria 589
686 Ga0500622_0000423 3300053156 Bacteria 40034
687 Ga0500633_0186565 3300053160 Bacteria 777
688 Ga0500636_0004555 3300053177 Bacteria 7860
689 Ga0500636_0135965 3300053177 Bacteria 1365
690 Ga0500570_045471 3300053724 Bacteria 2256
691 Ga0500570_048548 3300053724 Bacteria 2157
692 Ga0500584_134496 3300053726 Bacteria 955
693 Ga0500645_002532 3300053730 Bacteria 8063
694 Ga0500587_012252 3300053739 Bacteria 1081
695 Ga0501084_0164674 3300054114 Bacteria 1871
696 Ga0590071_001450 3300059421 Bacteria 6254
697 Ga0590074_043912 3300059423 Bacteria 808
698 Ga0501082_0329576 3300060353 Bacteria 1330
699 Ga0501082_1078697 3300060353 Bacteria 702
700 Ga0466962_0001058 3300061719 Bacteria 12635

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_101486232 Ga0070660_1014862321 124
2 3300005548 Ga0070665_100997449 Ga0070665_1009974492 133
3 3300039447 Ga0436361_0511852 Ga0436361_0511852_3853_4278 133
4 3300026089 Ga0207648_11376382 Ga0207648_113763821 134
5 3300026121 Ga0207683_10337638 Ga0207683_103376382 134
6 iso_pu_bacteria 2894817345 2894819772 134
7 iso_pu_bacteria 2643221598 2644000050 136
8 3300037068 Ga0373925_1272001 Ga0373925_1272001_50_532 137
9 3300037471 Ga0395905_0233538 Ga0395905_0233538_909_1373 137
10 iso_pu_bacteria 2837651117 2837652698 137
11 3300005543 Ga0070672_100425536 Ga0070672_1004255362 138
12 3300005842 Ga0068858_100321144 Ga0068858_1003211443 138
13 3300025940 Ga0207691_10664794 Ga0207691_106647942 138
14 3300026035 Ga0207703_10549307 Ga0207703_105493072 138
15 3300041494 Ga0451837_0656693 Ga0451837_0656693_44_499 138
16 3300049581 Ga0501047_0004960 Ga0501047_0004960_7444_7884 138
17 3300049583 Ga0501067_0011183 Ga0501067_0011183_1637_2077 138
18 3300049588 Ga0501072_0003168 Ga0501072_0003168_7244_7684 138
19 3300049589 Ga0501073_0013100 Ga0501073_0013100_1579_2019 138
20 3300049590 Ga0501074_0049878 Ga0501074_0049878_1401_1841 138
21 3300049741 Ga0501079_0027856 Ga0501079_0027856_3264_3704 138
22 3300049742 Ga0501080_0147968 Ga0501080_0147968_1247_1687 138
23 3300053136 Ga0500559_0053830 Ga0500559_0053830_1001_1459 138
24 3300054114 Ga0501084_0164674 Ga0501084_0164674_339_779 138
25 3300060353 Ga0501082_1078697 Ga0501082_1078697_83_523 138
26 3300005338 Ga0068868_100586243 Ga0068868_1005862432 139
27 3300021361 Ga0213872_10024668 Ga0213872_100246682 139
28 3300021361 Ga0213872_10220729 Ga0213872_102207291 139
29 3300026023 Ga0207677_10666274 Ga0207677_106662741 139
30 3300035088 Ga0373940_0138048 Ga0373940_0138048_153_614 139
31 3300037312 Ga0395899_0000013 Ga0395899_0000013_360350_360793 139
32 3300039447 Ga0436361_0567912 Ga0436361_0567912_56_499 139
33 3300039447 Ga0436361_0973074 Ga0436361_0973074_1288_1731 139
34 3300039447 Ga0436361_1008726 Ga0436361_1008726_494_937 139
35 3300044683 Ga0466965_0435424 Ga0466965_0435424_100_543 139
36 3300044684 Ga0466966_0134468 Ga0466966_0134468_831_1274 139
37 3300044684 Ga0466966_0335687 Ga0466966_0335687_12_455 139
38 3300045051 Ga0451576_0275135 Ga0451576_0275135_177_638 139
39 3300046684 Ga0495669_0035082 Ga0495669_0035082_1093_1554 139
40 3300049572 Ga0501036_1120963 Ga0501036_1120963_42_500 139
41 3300049573 Ga0501037_0280206 Ga0501037_0280206_594_1052 139
42 3300049584 Ga0501068_0271218 Ga0501068_0271218_614_1072 139
43 3300049585 Ga0501069_0187855 Ga0501069_0187855_705_1163 139
44 3300049586 Ga0501070_0714208 Ga0501070_0714208_204_662 139
45 3300049587 Ga0501071_0810304 Ga0501071_0810304_99_557 139
46 3300049588 Ga0501072_0098114 Ga0501072_0098114_821_1279 139
47 3300049591 Ga0501075_0219277 Ga0501075_0219277_93_551 139
48 3300049592 Ga0501076_0677045 Ga0501076_0677045_302_760 139
49 3300049593 Ga0501077_0103399 Ga0501077_0103399_1063_1521 139
50 3300049741 Ga0501079_0238683 Ga0501079_0238683_657_1115 139
51 3300049743 Ga0501081_0439574 Ga0501081_0439574_131_589 139
52 3300049824 Ga0501045_0610643 Ga0501045_0610643_321_779 139
53 3300060353 Ga0501082_0329576 Ga0501082_0329576_657_1115 139
54 3300005327 Ga0070658_10117742 Ga0070658_101177424 140
55 3300005327 Ga0070658_10329543 Ga0070658_103295432 140
56 3300005327 Ga0070658_10535863 Ga0070658_105358631 140
57 3300005336 Ga0070680_100016657 Ga0070680_1000166575 140
58 3300005336 Ga0070680_100117530 Ga0070680_1001175304 140
59 3300005344 Ga0070661_100299687 Ga0070661_1002996872 140
60 3300005355 Ga0070671_100099089 Ga0070671_1000990892 140
61 3300005364 Ga0070673_100029285 Ga0070673_1000292855 140
62 3300005366 Ga0070659_100015408 Ga0070659_1000154086 140
63 3300005366 Ga0070659_101279782 Ga0070659_1012797821 140
64 3300005367 Ga0070667_100331610 Ga0070667_1003316102 140
65 3300005456 Ga0070678_100102871 Ga0070678_1001028712 140
66 3300005457 Ga0070662_100081290 Ga0070662_1000812902 140
67 3300005458 Ga0070681_10054252 Ga0070681_100542523 140
68 3300005458 Ga0070681_10063126 Ga0070681_100631263 140
69 3300005530 Ga0070679_100013942 Ga0070679_1000139424 140
70 3300005539 Ga0068853_100029981 Ga0068853_1000299814 140
71 3300005539 Ga0068853_100095928 Ga0068853_1000959282 140
72 3300005539 Ga0068853_100815956 Ga0068853_1008159561 140
73 3300005548 Ga0070665_100000327 Ga0070665_10000032751 140
74 3300005563 Ga0068855_100116069 Ga0068855_1001160694 140
75 3300005577 Ga0068857_101093259 Ga0068857_1010932592 140
76 3300005618 Ga0068864_100184243 Ga0068864_1001842432 140
77 3300005844 Ga0068862_100041852 Ga0068862_1000418521 140
78 3300006028 Ga0070717_10235061 Ga0070717_102350611 140
79 3300009093 Ga0105240_10012992 Ga0105240_100129929 140
80 3300009093 Ga0105240_10018555 Ga0105240_1001855510 140
81 3300009093 Ga0105240_10050283 Ga0105240_100502836 140
82 3300009093 Ga0105240_10263605 Ga0105240_102636053 140
83 3300009093 Ga0105240_11641934 Ga0105240_116419342 140
84 3300009098 Ga0105245_10019471 Ga0105245_100194716 140
85 3300009177 Ga0105248_10015263 Ga0105248_100152637 140
86 3300009545 Ga0105237_12115687 Ga0105237_121156871 140
87 3300009551 Ga0105238_10021552 Ga0105238_100215524 140
88 3300009551 Ga0105238_10044939 Ga0105238_100449394 140
89 3300010375 Ga0105239_10216562 Ga0105239_102165622 140
90 3300013104 Ga0157370_10407612 Ga0157370_104076122 140
91 3300013104 Ga0157370_10538377 Ga0157370_105383772 140
92 3300013105 Ga0157369_10740205 Ga0157369_107402052 140
93 3300013296 Ga0157374_12150638 Ga0157374_121506381 140
94 3300013297 Ga0157378_10261888 Ga0157378_102618882 140
95 3300013308 Ga0157375_10095126 Ga0157375_100951263 140
96 3300014325 Ga0163163_10171221 Ga0163163_101712213 140
97 3300014968 Ga0157379_10467459 Ga0157379_104674592 140
98 3300025903 Ga0207680_10221406 Ga0207680_102214062 140
99 3300025909 Ga0207705_10001301 Ga0207705_1000130125 140
100 3300025909 Ga0207705_10284910 Ga0207705_102849102 140
101 3300025912 Ga0207707_10044666 Ga0207707_100446663 140
102 3300025912 Ga0207707_10061291 Ga0207707_100612911 140
103 3300025913 Ga0207695_10000728 Ga0207695_1000072821 140
104 3300025913 Ga0207695_10002551 Ga0207695_1000255123 140
105 3300025913 Ga0207695_10014064 Ga0207695_100140649 140
106 3300025913 Ga0207695_10017230 Ga0207695_100172304 140
107 3300025917 Ga0207660_10032401 Ga0207660_100324013 140
108 3300025917 Ga0207660_10084746 Ga0207660_100847464 140
109 3300025919 Ga0207657_10004872 Ga0207657_100048729 140
110 3300025919 Ga0207657_10058952 Ga0207657_100589522 140
111 3300025919 Ga0207657_10433400 Ga0207657_104334001 140
112 3300025921 Ga0207652_10014009 Ga0207652_100140096 140
113 3300025921 Ga0207652_10723290 Ga0207652_107232902 140
114 3300025923 Ga0207681_10340000 Ga0207681_103400002 140
115 3300025924 Ga0207694_10017119 Ga0207694_100171195 140
116 3300025924 Ga0207694_10046881 Ga0207694_100468814 140
117 3300025925 Ga0207650_10194608 Ga0207650_101946083 140
118 3300025932 Ga0207690_10000294 Ga0207690_1000029428 140
119 3300025941 Ga0207711_10001005 Ga0207711_1000100510 140
120 3300025941 Ga0207711_11109109 Ga0207711_111091092 140
121 3300025949 Ga0207667_10006530 Ga0207667_100065306 140
122 3300025949 Ga0207667_10019379 Ga0207667_100193795 140
123 3300025960 Ga0207651_10034339 Ga0207651_100343393 140
124 3300025986 Ga0207658_10320768 Ga0207658_103207682 140
125 3300026041 Ga0207639_10079911 Ga0207639_100799113 140
126 3300026041 Ga0207639_10086256 Ga0207639_100862563 140
127 3300026041 Ga0207639_10651837 Ga0207639_106518372 140
128 3300026041 Ga0207639_10690553 Ga0207639_106905532 140
129 3300026088 Ga0207641_10041181 Ga0207641_100411814 140
130 3300026121 Ga0207683_10259656 Ga0207683_102596562 140
131 3300026142 Ga0207698_10315229 Ga0207698_103152292 140
132 3300028379 Ga0268266_10000064 Ga0268266_1000006457 140
133 3300028800 Ga0265338_10611835 Ga0265338_106118352 140
134 3300031247 Ga0265340_10023067 Ga0265340_100230674 140
135 3300031616 Ga0307508_10350083 Ga0307508_103500832 140
136 3300032168 Ga0316593_10039952 Ga0316593_100399523 140
137 3300035116 Ga0373945_0026066 Ga0373945_0026066_1536_2003 140
138 3300035695 Ga0373927_0000732 Ga0373927_0000732_9869_10336 140
139 3300036647 Ga0316582_0108050 Ga0316582_0108050_1165_1611 140
140 3300036647 Ga0316582_0207049 Ga0316582_0207049_243_689 140
141 3300036712 Ga0316584_0294569 Ga0316584_0294569_470_916 140
142 3300036712 Ga0316584_0347375 Ga0316584_0347375_506_952 140
143 3300037068 Ga0373925_0000039 Ga0373925_0000039_50502_50969 140
144 3300037418 Ga0395900_0129947 Ga0395900_0129947_1806_2258 140
145 3300046516 Ga0495628_0355406 Ga0495628_0355406_174_641 140
146 3300046517 Ga0495630_0858381 Ga0495630_0858381_118_585 140
147 3300046528 Ga0495642_0078054 Ga0495642_0078054_573_1037 140
148 3300046529 Ga0495652_0447252 Ga0495652_0447252_45_512 140
149 3300046535 Ga0495586_0420340 Ga0495586_0420340_94_561 140
150 3300046543 Ga0495645_0249612 Ga0495645_0249612_319_786 140
151 3300046616 Ga0495668_0103975 Ga0495668_0103975_940_1404 140
152 3300046648 Ga0495611_0013778 Ga0495611_0013778_389_853 140
153 3300046684 Ga0495669_0000001 Ga0495669_0000001_83845_84309 140
154 3300047445 Ga0495677_0117681 Ga0495677_0117681_419_883 140
155 3300048903 Ga0496100_0029766 Ga0496100_0029766_800_1264 140
156 3300048904 Ga0496101_0101156 Ga0496101_0101156_564_1028 140
157 3300048905 Ga0496102_0060433 Ga0496102_0060433_2315_2779 140
158 3300048906 Ga0496103_0820791 Ga0496103_0820791_57_521 140
159 3300048907 Ga0496104_0236210 Ga0496104_0236210_723_1187 140
160 3300048911 Ga0496108_0009257 Ga0496108_0009257_3567_4031 140
161 3300048912 Ga0496109_0048685 Ga0496109_0048685_2729_3193 140
162 3300048913 Ga0496110_0186247 Ga0496110_0186247_770_1234 140
163 3300048915 Ga0496112_0186065 Ga0496112_0186065_17_484 140
164 3300048915 Ga0496112_0262013 Ga0496112_0262013_38_502 140
165 3300048916 Ga0496113_0198381 Ga0496113_0198381_276_740 140
166 3300048918 Ga0496115_0000607 Ga0496115_0000607_19268_19735 140
167 3300048918 Ga0496115_0007666 Ga0496115_0007666_2511_2978 140
168 3300048924 Ga0496121_0777371 Ga0496121_0777371_85_549 140
169 3300053091 Ga0500647_0003051 Ga0500647_0003051_3294_3758 140
170 3300053111 Ga0500572_028022 Ga0500572_028022_358_822 140
171 3300053120 Ga0500597_064178 Ga0500597_064178_61_525 140
172 3300053150 Ga0500603_081034 Ga0500603_081034_430_897 140
173 3300053154 Ga0500619_246664 Ga0500619_246664_64_528 140
174 3300053177 Ga0500636_0135965 Ga0500636_0135965_727_1191 140
175 3300003320 rootH2_10067744 rootH2_100677445 141
176 3300003323 rootH1_10149653 rootH1_101496532 141
177 3300005334 Ga0068869_101011222 Ga0068869_1010112221 141
178 3300005455 Ga0070663_100467579 Ga0070663_1004675792 141
179 3300005457 Ga0070662_100577276 Ga0070662_1005772762 141
180 3300005614 Ga0068856_100111665 Ga0068856_1001116653 141
181 3300009098 Ga0105245_10220088 Ga0105245_102200883 141
182 3300009176 Ga0105242_11131663 Ga0105242_111316632 141
183 3300009553 Ga0105249_10599643 Ga0105249_105996431 141
184 3300013306 Ga0163162_10620307 Ga0163162_106203072 141
185 3300025927 Ga0207687_10184623 Ga0207687_101846232 141
186 3300025933 Ga0207706_10599818 Ga0207706_105998182 141
187 3300025961 Ga0207712_11522526 Ga0207712_115225261 141
188 3300026067 Ga0207678_10466618 Ga0207678_104666182 141
189 3300026078 Ga0207702_10582604 Ga0207702_105826042 141
190 3300029957 Ga0265324_10188597 Ga0265324_101885972 141
191 3300037471 Ga0395905_0000172 Ga0395905_0000172_19702_20175 141
192 3300037471 Ga0395905_0517028 Ga0395905_0517028_427_900 141
193 3300048912 Ga0496109_0887995 Ga0496109_0887995_293_751 141
194 3300048917 Ga0496114_0185745 Ga0496114_0185745_889_1347 141
195 3300049570 Ga0501033_0565430 Ga0501033_0565430_242_715 141
196 3300049579 Ga0501043_0115490 Ga0501043_0115490_1243_1716 141
197 3300049822 Ga0501035_0005859 Ga0501035_0005859_1302_1769 141
198 3300049822 Ga0501035_0211004 Ga0501035_0211004_847_1320 141
199 3300053080 Ga0500635_0001608 Ga0500635_0001608_1690_2157 141
200 3300053136 Ga0500559_0103509 Ga0500559_0103509_148_615 141
201 3300006846 Ga0075430_100007141 Ga0075430_10000714111 142
202 3300050509 nmdc:mga0qj67_70852_c1 nmdc:mga0qj67_70852_c1_1501_1956 142
203 3300050510 nmdc:mga06r32_571990_c1 nmdc:mga06r32_571990_c1_131_586 142
204 3300013307 Ga0157372_11158564 Ga0157372_111585642 144
205 3300049571 Ga0501034_0246624 Ga0501034_0246624_923_1393 144
206 3300005937 Ga0081455_10313754 Ga0081455_103137542 146
207 3300006847 Ga0075431_100024811 Ga0075431_1000248111 146
208 3300006847 Ga0075431_100149677 Ga0075431_1001496772 146
209 3300009094 Ga0111539_10314626 Ga0111539_103146262 146
210 3300009147 Ga0114129_10118791 Ga0114129_101187913 146
211 3300048912 Ga0496109_0603948 Ga0496109_0603948_10_483 146
212 3300050507 nmdc:mga05p37_64684_c1 nmdc:mga05p37_64684_c1_1258_1731 146
213 3300050510 nmdc:mga06r32_351191_c1 nmdc:mga06r32_351191_c1_242_715 146
214 3300050511 nmdc:mga08y16_751343_c1 nmdc:mga08y16_751343_c1_73_546 146
215 3300002987 JGI25159J45721_1007881 JGI25159J45721_10078814 147
216 3300003187 JGI25151J46595_10067274 JGI25151J46595_100672742 147
217 3300005262 Ga0065165_1000046 Ga0065165_1000046129 147
218 3300025284 Ga0209130_1003746 Ga0209130_10037466 147
219 3300025294 Ga0209025_1003819 Ga0209025_10038196 147
220 3300025302 Ga0207426_1014534 Ga0207426_10145343 147
221 iso_pu_bacteria 2643221736 2644746671 147
222 iso_pu_bacteria 2841760612 2841762702 147
223 iso_pu_bacteria 2844104063 2844110290 147
224 iso_pu_bacteria 2851182111 2851187138 147
225 iso_pu_bacteria 2851246043 2851251952 147
226 iso_pu_bacteria 8057529695 8057535248 147
227 3300025945 Ga0207679_11408055 Ga0207679_114080551 148
228 3300003187 JGI25151J46595_10000047 JGI25151J46595_1000004763 149
229 3300003771 Ga0055526_1000274 Ga0055526_100027440 149
230 3300003771 Ga0055526_1004542 Ga0055526_10045427 149
231 3300003775 Ga0055524_1000100 Ga0055524_100010090 149
232 3300003775 Ga0055524_1006673 Ga0055524_10066735 149
233 3300005445 Ga0070708_101560086 Ga0070708_1015600861 149
234 3300013250 Ga0171462_1011 Ga0171462_1011186 149
235 3300025291 Ga0209675_1000536 Ga0209675_10005366 149
236 3300025292 Ga0209676_1023653 Ga0209676_10236532 149
237 3300025294 Ga0209025_1000016 Ga0209025_1000016165 149
238 3300025294 Ga0209025_1043804 Ga0209025_10438042 149
239 3300025295 Ga0209564_1000023 Ga0209564_1000023256 149
240 3300025295 Ga0209564_1000035 Ga0209564_1000035284 149
241 3300025299 Ga0209256_1000025 Ga0209256_1000025162 149
242 3300025299 Ga0209256_1000262 Ga0209256_100026240 149
243 3300025304 Ga0209257_1040596 Ga0209257_10405962 149
244 3300028794 Ga0307515_10141336 Ga0307515_101413362 149
245 3300031456 Ga0307513_10702708 Ga0307513_107027082 149
246 3300031901 Ga0307406_10058574 Ga0307406_100585744 149
247 3300038705 Ga0237819_10957 Ga0237819_10957_587_1096 149
248 3300039145 Ga0237816_03719 Ga0237816_03719_205_714 149
249 3300046520 Ga0495637_0139927 Ga0495637_0139927_335_844 149
250 3300046522 Ga0495643_0125809 Ga0495643_0125809_459_968 149
251 3300046542 Ga0495597_0297325 Ga0495597_0297325_86_583 149
252 3300048904 Ga0496101_0577309 Ga0496101_0577309_71_580 149
253 3300048912 Ga0496109_0951750 Ga0496109_0951750_96_605 149
254 3300048920 Ga0496117_0050014 Ga0496117_0050014_1222_1746 149
255 3300048925 Ga0496122_0083737 Ga0496122_0083737_1069_1593 149
256 3300048926 Ga0496123_0059398 Ga0496123_0059398_489_1013 149
257 3300048927 Ga0496124_0196604 Ga0496124_0196604_121_630 149
258 3300048929 Ga0496126_0026814 Ga0496126_0026814_2560_3069 149
259 3300048929 Ga0496126_0971145 Ga0496126_0971145_31_540 149
260 3300049571 Ga0501034_0157847 Ga0501034_0157847_1286_1810 149
261 3300049573 Ga0501037_0075842 Ga0501037_0075842_1605_2129 149
262 3300049574 Ga0501038_0129680 Ga0501038_0129680_1300_1824 149
263 3300049823 Ga0501044_0582085 Ga0501044_0582085_276_800 149
264 3300053121 Ga0500607_056281 Ga0500607_056281_1451_1960 149
265 3300053137 Ga0500561_0041435 Ga0500561_0041435_128_637 149
266 3300053153 Ga0500616_0080640 Ga0500616_0080640_11_520 149
267 3300053177 Ga0500636_0004555 Ga0500636_0004555_1973_2482 149
268 iso_pu_bacteria 2643221733 2644728297 149
269 iso_pu_bacteria 2643221734 2644733263 149
270 iso_pu_bacteria 2818991467 2819717851 149
271 iso_pu_bacteria 2841911363 2841916193 149
272 iso_pu_bacteria 2841917233 2841921138 149
273 iso_pu_bacteria 2917699015 2917700766 149
274 3300044656 Ga0466969_0003620 Ga0466969_0003620_6120_6653 150
275 3300044684 Ga0466966_0002874 Ga0466966_0002874_8372_8905 150
276 3300044693 Ga0466961_0003361 Ga0466961_0003361_5837_6370 150
277 3300044694 Ga0466963_0194542 Ga0466963_0194542_485_1018 150
278 3300044719 Ga0466971_0000586 Ga0466971_0000586_8989_9522 150
279 3300044765 Ga0466970_0013079 Ga0466970_0013079_1826_2359 150
280 3300044842 Ga0466957_0004597 Ga0466957_0004597_4083_4616 150
281 3300045049 Ga0466959_0000060 Ga0466959_0000060_41405_41938 150
282 3300045836 Ga0466958_0001428 Ga0466958_0001428_10107_10640 150
283 3300061719 Ga0466962_0001058 Ga0466962_0001058_4102_4635 150
284 iso_pu_bacteria 2585428057 2587727804 150
285 iso_pu_bacteria 2585428058 2587733880 150
286 iso_pu_bacteria 2585428062 2587754481 150
287 iso_pu_bacteria 2588253510 2588292338 150
288 iso_pu_bacteria 2643221592 2643972579 150
289 iso_pu_bacteria 2643221625 2644138413 150
290 iso_pu_bacteria 2643221644 2644248305 150
291 iso_pu_bacteria 2643221648 2644273087 150
292 3300021361 Ga0213872_10000086 Ga0213872_1000008670 151
293 3300039447 Ga0436361_0874346 Ga0436361_0874346_1803_2276 151
294 3300039447 Ga0436361_0892385 Ga0436361_0892385_8317_8790 151
295 3300021361 Ga0213872_10000048 Ga0213872_1000004814 152
296 3300039447 Ga0436361_0943694 Ga0436361_0943694_72861_73337 152
297 3300026118 Ga0207675_100178236 Ga0207675_1001782363 153
298 3300032004 Ga0307414_11696264 Ga0307414_116962641 153
299 3300035170 Ga0373943_0338526 Ga0373943_0338526_64_525 153
300 3300035725 Ga0373947_0222831 Ga0373947_0222831_427_888 153
301 3300037068 Ga0373925_0004687 Ga0373925_0004687_5128_5589 153
302 3300042876 Ga0451577_0201049 Ga0451577_0201049_1015_1479 153
303 3300044673 Ga0453683_0944648 Ga0453683_0944648_86_547 153
304 3300044712 Ga0453684_0640441 Ga0453684_0640441_456_917 153
305 3300045051 Ga0451576_0072763 Ga0451576_0072763_251_712 153
306 3300046683 Ga0495658_0311035 Ga0495658_0311035_305_766 153
307 3300048927 Ga0496124_0000079 Ga0496124_0000079_151657_152118 153
308 3300048928 Ga0496125_0003021 Ga0496125_0003021_2067_2528 153
309 3300053083 Ga0495655_0059358 Ga0495655_0059358_49_510 153
310 3300002773 JGI25152J39213_1003184 JGI25152J39213_10031844 154
311 3300002774 JGI25150J39212_1011358 JGI25150J39212_10113582 154
312 3300003215 JGI25153J46596_10003416 JGI25153J46596_100034163 154
313 3300003215 JGI25153J46596_10003814 JGI25153J46596_100038142 154
314 3300003316 rootH1_10004001 rootH1_100040012 154
315 3300003323 rootH1_10003085 rootH1_1000308518 154
316 3300003759 Ga0055525_1000021 Ga0055525_100002197 154
317 3300003771 Ga0055526_1003449 Ga0055526_10034494 154
318 3300003775 Ga0055524_1000253 Ga0055524_10002533 154
319 3300003775 Ga0055524_1006902 Ga0055524_10069025 154
320 3300003791 Ga0055530_10012910 Ga0055530_100129102 154
321 3300003791 Ga0055530_10016972 Ga0055530_100169721 154
322 3300003792 Ga0055540_1000011 Ga0055540_1000011135 154
323 3300003794 Ga0055531_10000841 Ga0055531_1000084114 154
324 3300003794 Ga0055531_10007597 Ga0055531_100075973 154
325 3300004625 Ga0055543_1021852 Ga0055543_10218522 154
326 3300005262 Ga0065165_1000092 Ga0065165_1000092102 154
327 3300005262 Ga0065165_1002514 Ga0065165_10025142 154
328 3300005262 Ga0065165_1040895 Ga0065165_10408952 154
329 3300005331 Ga0070670_100000316 Ga0070670_10000031613 154
330 3300005333 Ga0070677_10085159 Ga0070677_100851592 154
331 3300005334 Ga0068869_100499330 Ga0068869_1004993301 154
332 3300005338 Ga0068868_100018706 Ga0068868_1000187064 154
333 3300005339 Ga0070660_100650170 Ga0070660_1006501701 154
334 3300005344 Ga0070661_100003441 Ga0070661_1000034418 154
335 3300005344 Ga0070661_100098901 Ga0070661_1000989012 154
336 3300005353 Ga0070669_100014753 Ga0070669_1000147535 154
337 3300005353 Ga0070669_100087143 Ga0070669_1000871433 154
338 3300005353 Ga0070669_100492479 Ga0070669_1004924792 154
339 3300005354 Ga0070675_100021440 Ga0070675_1000214402 154
340 3300005354 Ga0070675_100099423 Ga0070675_1000994232 154
341 3300005354 Ga0070675_100519340 Ga0070675_1005193402 154
342 3300005355 Ga0070671_100020520 Ga0070671_1000205202 154
343 3300005356 Ga0070674_100008892 Ga0070674_1000088922 154
344 3300005356 Ga0070674_100083373 Ga0070674_1000833732 154
345 3300005364 Ga0070673_100005627 Ga0070673_1000056272 154
346 3300005364 Ga0070673_100157990 Ga0070673_1001579902 154
347 3300005364 Ga0070673_100191134 Ga0070673_1001911342 154
348 3300005366 Ga0070659_100000414 Ga0070659_10000041425 154
349 3300005367 Ga0070667_100003744 Ga0070667_1000037441 154
350 3300005367 Ga0070667_100102848 Ga0070667_1001028482 154
351 3300005367 Ga0070667_100415500 Ga0070667_1004155002 154
352 3300005445 Ga0070708_100091905 Ga0070708_1000919054 154
353 3300005445 Ga0070708_100806973 Ga0070708_1008069731 154
354 3300005455 Ga0070663_100000288 Ga0070663_10000028820 154
355 3300005455 Ga0070663_100092489 Ga0070663_1000924892 154
356 3300005456 Ga0070678_100040094 Ga0070678_1000400943 154
357 3300005456 Ga0070678_100164633 Ga0070678_1001646333 154
358 3300005456 Ga0070678_100554348 Ga0070678_1005543481 154
359 3300005457 Ga0070662_100035026 Ga0070662_1000350264 154
360 3300005457 Ga0070662_100770099 Ga0070662_1007700992 154
361 3300005457 Ga0070662_100886986 Ga0070662_1008869862 154
362 3300005459 Ga0068867_100000018 Ga0068867_10000001817 154
363 3300005459 Ga0068867_100000712 Ga0068867_1000007123 154
364 3300005459 Ga0068867_100638880 Ga0068867_1006388801 154
365 3300005459 Ga0068867_100744418 Ga0068867_1007444182 154
366 3300005467 Ga0070706_100007035 Ga0070706_1000070353 154
367 3300005468 Ga0070707_100468705 Ga0070707_1004687052 154
368 3300005471 Ga0070698_100186433 Ga0070698_1001864333 154
369 3300005539 Ga0068853_100252485 Ga0068853_1002524853 154
370 3300005543 Ga0070672_100000206 Ga0070672_10000020619 154
371 3300005543 Ga0070672_100045348 Ga0070672_1000453483 154
372 3300005548 Ga0070665_100405347 Ga0070665_1004053472 154
373 3300005548 Ga0070665_101849886 Ga0070665_1018498862 154
374 3300005564 Ga0070664_100013581 Ga0070664_1000135818 154
375 3300005564 Ga0070664_100018046 Ga0070664_1000180462 154
376 3300005564 Ga0070664_100162347 Ga0070664_1001623473 154
377 3300005577 Ga0068857_100021161 Ga0068857_1000211615 154
378 3300005577 Ga0068857_101020747 Ga0068857_1010207472 154
379 3300005578 Ga0068854_100135522 Ga0068854_1001355222 154
380 3300005615 Ga0070702_100283635 Ga0070702_1002836352 154
381 3300005616 Ga0068852_100005610 Ga0068852_1000056104 154
382 3300005616 Ga0068852_100042576 Ga0068852_1000425764 154
383 3300005617 Ga0068859_100342955 Ga0068859_1003429553 154
384 3300005719 Ga0068861_101391081 Ga0068861_1013910811 154
385 3300005840 Ga0068870_10180713 Ga0068870_101807132 154
386 3300005843 Ga0068860_100044526 Ga0068860_1000445267 154
387 3300005843 Ga0068860_100902231 Ga0068860_1009022312 154
388 3300006042 Ga0075368_10034052 Ga0075368_100340523 154
389 3300006042 Ga0075368_10183265 Ga0075368_101832652 154
390 3300006048 Ga0075363_100014280 Ga0075363_1000142802 154
391 3300006048 Ga0075363_100049825 Ga0075363_1000498253 154
392 3300006048 Ga0075363_100208489 Ga0075363_1002084892 154
393 3300006051 Ga0075364_10134327 Ga0075364_101343272 154
394 3300006051 Ga0075364_10368715 Ga0075364_103687152 154
395 3300006177 Ga0075362_10002253 Ga0075362_100022535 154
396 3300006177 Ga0075362_10062132 Ga0075362_100621322 154
397 3300006177 Ga0075362_10251339 Ga0075362_102513392 154
398 3300006178 Ga0075367_10000848 Ga0075367_100008489 154
399 3300006178 Ga0075367_10015213 Ga0075367_100152132 154
400 3300006178 Ga0075367_10047448 Ga0075367_100474483 154
401 3300006178 Ga0075367_10356749 Ga0075367_103567492 154
402 3300006186 Ga0075369_10002971 Ga0075369_100029715 154
403 3300006186 Ga0075369_10022450 Ga0075369_100224502 154
404 3300006186 Ga0075369_10233888 Ga0075369_102338882 154
405 3300006195 Ga0075366_10030684 Ga0075366_100306842 154
406 3300006195 Ga0075366_10039649 Ga0075366_100396492 154
407 3300006195 Ga0075366_10083557 Ga0075366_100835571 154
408 3300006195 Ga0075366_10126518 Ga0075366_101265181 154
409 3300006195 Ga0075366_10174084 Ga0075366_101740842 154
410 3300006195 Ga0075366_10196770 Ga0075366_101967702 154
411 3300006195 Ga0075366_10767181 Ga0075366_107671812 154
412 3300006237 Ga0097621_100198506 Ga0097621_1001985063 154
413 3300006353 Ga0075370_10002309 Ga0075370_100023095 154
414 3300006353 Ga0075370_10003363 Ga0075370_100033638 154
415 3300006353 Ga0075370_10006079 Ga0075370_100060795 154
416 3300006353 Ga0075370_10047864 Ga0075370_100478642 154
417 3300006353 Ga0075370_10269571 Ga0075370_102695712 154
418 3300006881 Ga0068865_100044344 Ga0068865_1000443443 154
419 3300006931 Ga0097620_100343001 Ga0097620_1003430013 154
420 3300006942 Ga0099824_1038383 Ga0099824_10383832 154
421 3300006944 Ga0099823_1002588 Ga0099823_10025887 154
422 3300006946 Ga0079104_1000040 Ga0079104_1000040150 154
423 3300009093 Ga0105240_10006664 Ga0105240_1000666412 154
424 3300009093 Ga0105240_10526827 Ga0105240_105268272 154
425 3300009094 Ga0111539_12099261 Ga0111539_120992611 154
426 3300009098 Ga0105245_10363626 Ga0105245_103636262 154
427 3300009148 Ga0105243_10040230 Ga0105243_100402303 154
428 3300009148 Ga0105243_10171020 Ga0105243_101710202 154
429 3300009148 Ga0105243_10317841 Ga0105243_103178412 154
430 3300009148 Ga0105243_10891390 Ga0105243_108913902 154
431 3300009174 Ga0105241_10208010 Ga0105241_102080102 154
432 3300009174 Ga0105241_10438568 Ga0105241_104385683 154
433 3300009545 Ga0105237_10003122 Ga0105237_1000312217 154
434 3300009545 Ga0105237_10023165 Ga0105237_100231659 154
435 3300009551 Ga0105238_10051787 Ga0105238_100517874 154
436 3300009551 Ga0105238_10451673 Ga0105238_104516732 154
437 3300010375 Ga0105239_10000563 Ga0105239_100005636 154
438 3300010375 Ga0105239_10026325 Ga0105239_100263256 154
439 3300010375 Ga0105239_13222042 Ga0105239_132220421 154
440 3300013296 Ga0157374_10534134 Ga0157374_105341342 154
441 3300013306 Ga0163162_10266438 Ga0163162_102664384 154
442 3300013306 Ga0163162_12423241 Ga0163162_124232411 154
443 3300013308 Ga0157375_10155596 Ga0157375_101555962 154
444 3300013308 Ga0157375_10410485 Ga0157375_104104852 154
445 3300014326 Ga0157380_11437095 Ga0157380_114370952 154
446 3300014326 Ga0157380_11851205 Ga0157380_118512052 154
447 3300014326 Ga0157380_12606719 Ga0157380_126067191 154
448 3300014745 Ga0157377_10000051 Ga0157377_100000515 154
449 3300014745 Ga0157377_10823948 Ga0157377_108239481 154
450 3300014969 Ga0157376_11986851 Ga0157376_119868511 154
451 3300017792 Ga0163161_10003613 Ga0163161_100036138 154
452 3300021361 Ga0213872_10000046 Ga0213872_1000004631 154
453 3300021361 Ga0213872_10000090 Ga0213872_1000009013 154
454 3300021361 Ga0213872_10216111 Ga0213872_102161111 154
455 3300025230 Ga0209563_100005 Ga0209563_100005230 154
456 3300025245 Ga0207425_1001899 Ga0207425_10018994 154
457 3300025245 Ga0207425_1070726 Ga0207425_10707262 154
458 3300025258 Ga0209129_1000124 Ga0209129_10001244 154
459 3300025263 Ga0209565_1021127 Ga0209565_10211273 154
460 3300025273 Ga0209673_1040424 Ga0209673_10404242 154
461 3300025295 Ga0209564_1000057 Ga0209564_1000057117 154
462 3300025297 Ga0209758_1000214 Ga0209758_100021487 154
463 3300025297 Ga0209758_1000232 Ga0209758_100023286 154
464 3300025298 Ga0209050_1000376 Ga0209050_100037612 154
465 3300025298 Ga0209050_1001215 Ga0209050_100121510 154
466 3300025298 Ga0209050_1008356 Ga0209050_10083566 154
467 3300025299 Ga0209256_1000113 Ga0209256_1000113153 154
468 3300025303 Ga0209051_1000020 Ga0209051_1000020135 154
469 3300025304 Ga0209257_1000085 Ga0209257_1000085135 154
470 3300025304 Ga0209257_1013523 Ga0209257_10135232 154
471 3300025304 Ga0209257_1032608 Ga0209257_10326083 154
472 3300025893 Ga0207682_10000269 Ga0207682_1000026921 154
473 3300025893 Ga0207682_10010445 Ga0207682_100104454 154
474 3300025899 Ga0207642_10187481 Ga0207642_101874812 154
475 3300025907 Ga0207645_10048409 Ga0207645_100484093 154
476 3300025907 Ga0207645_10336406 Ga0207645_103364062 154
477 3300025908 Ga0207643_10149855 Ga0207643_101498553 154
478 3300025908 Ga0207643_10258548 Ga0207643_102585482 154
479 3300025910 Ga0207684_10000871 Ga0207684_1000087124 154
480 3300025913 Ga0207695_10021053 Ga0207695_1002105310 154
481 3300025913 Ga0207695_10105580 Ga0207695_101055804 154
482 3300025914 Ga0207671_10005735 Ga0207671_100057355 154
483 3300025914 Ga0207671_10102303 Ga0207671_101023032 154
484 3300025919 Ga0207657_10079911 Ga0207657_100799113 154
485 3300025919 Ga0207657_10373856 Ga0207657_103738562 154
486 3300025920 Ga0207649_10004702 Ga0207649_100047028 154
487 3300025920 Ga0207649_10154689 Ga0207649_101546892 154
488 3300025923 Ga0207681_10012357 Ga0207681_100123574 154
489 3300025923 Ga0207681_10077266 Ga0207681_100772662 154
490 3300025923 Ga0207681_10546601 Ga0207681_105466012 154
491 3300025924 Ga0207694_10162481 Ga0207694_101624813 154
492 3300025925 Ga0207650_10000172 Ga0207650_1000017261 154
493 3300025925 Ga0207650_10433211 Ga0207650_104332112 154
494 3300025926 Ga0207659_10000066 Ga0207659_1000006622 154
495 3300025926 Ga0207659_10352282 Ga0207659_103522822 154
496 3300025927 Ga0207687_10264631 Ga0207687_102646312 154
497 3300025927 Ga0207687_10368975 Ga0207687_103689752 154
498 3300025931 Ga0207644_10017947 Ga0207644_100179472 154
499 3300025931 Ga0207644_10343913 Ga0207644_103439132 154
500 3300025932 Ga0207690_10000990 Ga0207690_1000099014 154
501 3300025933 Ga0207706_10046461 Ga0207706_100464614 154
502 3300025933 Ga0207706_10428628 Ga0207706_104286282 154
503 3300025935 Ga0207709_10000889 Ga0207709_1000088925 154
504 3300025937 Ga0207669_10026021 Ga0207669_100260215 154
505 3300025937 Ga0207669_10111764 Ga0207669_101117641 154
506 3300025937 Ga0207669_10217891 Ga0207669_102178912 154
507 3300025938 Ga0207704_10403934 Ga0207704_104039342 154
508 3300025940 Ga0207691_10000265 Ga0207691_1000026522 154
509 3300025940 Ga0207691_10009413 Ga0207691_100094134 154
510 3300025940 Ga0207691_10064013 Ga0207691_100640133 154
511 3300025942 Ga0207689_10175883 Ga0207689_101758832 154
512 3300025945 Ga0207679_10006650 Ga0207679_100066503 154
513 3300025945 Ga0207679_10011841 Ga0207679_100118413 154
514 3300025945 Ga0207679_10271021 Ga0207679_102710212 154
515 3300025960 Ga0207651_10129420 Ga0207651_101294202 154
516 3300025960 Ga0207651_10140082 Ga0207651_101400822 154
517 3300025960 Ga0207651_10273466 Ga0207651_102734662 154
518 3300025972 Ga0207668_10488555 Ga0207668_104885552 154
519 3300025986 Ga0207658_10031651 Ga0207658_100316513 154
520 3300025986 Ga0207658_10079771 Ga0207658_100797714 154
521 3300025986 Ga0207658_10207290 Ga0207658_102072901 154
522 3300025986 Ga0207658_10269678 Ga0207658_102696782 154
523 3300025986 Ga0207658_10912347 Ga0207658_109123472 154
524 3300026023 Ga0207677_10064156 Ga0207677_100641563 154
525 3300026023 Ga0207677_10357805 Ga0207677_103578052 154
526 3300026035 Ga0207703_10754915 Ga0207703_107549152 154
527 3300026067 Ga0207678_10001406 Ga0207678_1000140621 154
528 3300026067 Ga0207678_10151853 Ga0207678_101518533 154
529 3300026067 Ga0207678_10300228 Ga0207678_103002282 154
530 3300026089 Ga0207648_10000060 Ga0207648_1000006084 154
531 3300026089 Ga0207648_10044482 Ga0207648_100444824 154
532 3300026089 Ga0207648_10126026 Ga0207648_101260262 154
533 3300026089 Ga0207648_10200534 Ga0207648_102005343 154
534 3300026089 Ga0207648_10280613 Ga0207648_102806133 154
535 3300026095 Ga0207676_10117777 Ga0207676_101177772 154
536 3300026116 Ga0207674_10018423 Ga0207674_100184235 154
537 3300026116 Ga0207674_10424112 Ga0207674_104241122 154
538 3300026118 Ga0207675_100699016 Ga0207675_1006990161 154
539 3300026118 Ga0207675_101231684 Ga0207675_1012316842 154
540 3300026121 Ga0207683_10065460 Ga0207683_100654603 154
541 3300026121 Ga0207683_10114077 Ga0207683_101140774 154
542 3300026121 Ga0207683_10478185 Ga0207683_104781852 154
543 3300026142 Ga0207698_10003996 Ga0207698_100039968 154
544 3300026142 Ga0207698_10039287 Ga0207698_100392874 154
545 3300027111 Ga0209281_1000074 Ga0209281_1000074228 154
546 3300027866 Ga0209813_10036427 Ga0209813_100364272 154
547 3300028379 Ga0268266_10108959 Ga0268266_101089592 154
548 3300028379 Ga0268266_10675334 Ga0268266_106753342 154
549 3300028379 Ga0268266_11399608 Ga0268266_113996082 154
550 3300028786 Ga0307517_10000499 Ga0307517_1000049928 154
551 3300028786 Ga0307517_10234865 Ga0307517_102348652 154
552 3300028786 Ga0307517_10274665 Ga0307517_102746652 154
553 3300028794 Ga0307515_10000366 Ga0307515_1000036614 154
554 3300028794 Ga0307515_10001653 Ga0307515_1000165341 154
555 3300028794 Ga0307515_10124341 Ga0307515_101243413 154
556 3300028794 Ga0307515_10251358 Ga0307515_102513582 154
557 3300028794 Ga0307515_10283422 Ga0307515_102834222 154
558 3300030522 Ga0307512_10065820 Ga0307512_100658202 154
559 3300031250 Ga0265331_10009064 Ga0265331_100090649 154
560 3300031251 Ga0265327_10000028 Ga0265327_10000028299 154
561 3300031456 Ga0307513_10067533 Ga0307513_100675334 154
562 3300031456 Ga0307513_10085924 Ga0307513_100859243 154
563 3300031456 Ga0307513_10130895 Ga0307513_101308953 154
564 3300031456 Ga0307513_10392945 Ga0307513_103929452 154
565 3300031548 Ga0307408_100120045 Ga0307408_1001200453 154
566 3300031548 Ga0307408_100148194 Ga0307408_1001481942 154
567 3300031548 Ga0307408_101519866 Ga0307408_1015198662 154
568 3300031616 Ga0307508_10000194 Ga0307508_1000019449 154
569 3300031616 Ga0307508_10025639 Ga0307508_100256394 154
570 3300031649 Ga0307514_10023006 Ga0307514_100230064 154
571 3300031649 Ga0307514_10080658 Ga0307514_100806583 154
572 3300031730 Ga0307516_10001561 Ga0307516_1000156114 154
573 3300031730 Ga0307516_10002583 Ga0307516_1000258311 154
574 3300031730 Ga0307516_10044992 Ga0307516_100449925 154
575 3300031730 Ga0307516_10075203 Ga0307516_100752032 154
576 3300031730 Ga0307516_10445659 Ga0307516_104456592 154
577 3300031730 Ga0307516_10597004 Ga0307516_105970042 154
578 3300031911 Ga0307412_11288395 Ga0307412_112883952 154
579 3300032004 Ga0307414_10154051 Ga0307414_101540513 154
580 3300032005 Ga0307411_11079297 Ga0307411_110792972 154
581 3300033179 Ga0307507_10172037 Ga0307507_101720372 154
582 3300033180 Ga0307510_10394286 Ga0307510_103942862 154
583 3300034957 Ga0373938_0018338 Ga0373938_0018338_896_1360 154
584 3300035117 Ga0373953_0261981 Ga0373953_0261981_108_590 154
585 3300036401 Ga0373937_0103288 Ga0373937_0103288_1112_1594 154
586 3300039447 Ga0436361_0042216 Ga0436361_0042216_5268_5732 154
587 3300039447 Ga0436361_0633280 Ga0436361_0633280_75547_76011 154
588 3300039447 Ga0436361_0661766 Ga0436361_0661766_37053_37517 154
589 3300039447 Ga0436361_0692684 Ga0436361_0692684_122183_122647 154
590 3300041443 Ga0451789_0772919 Ga0451789_0772919_1191_1655 154
591 3300041451 Ga0451791_1786793 Ga0451791_1786793_267_731 154
592 3300041452 Ga0451793_1319808 Ga0451793_1319808_246_710 154
593 3300041453 Ga0451797_0349248 Ga0451797_0349248_18_482 154
594 3300041453 Ga0451797_0494721 Ga0451797_0494721_37_501 154
595 3300041453 Ga0451797_0636430 Ga0451797_0636430_261_860 154
596 3300041456 Ga0451795_0259599 Ga0451795_0259599_125_607 154
597 3300041456 Ga0451795_0766554 Ga0451795_0766554_692_1156 154
598 3300041459 Ga0451800_0252204 Ga0451800_0252204_831_1295 154
599 3300041459 Ga0451800_1634667 Ga0451800_1634667_441_905 154
600 3300041486 Ga0451807_2396062 Ga0451807_2396062_11_475 154
601 3300041498 Ga0451841_1304204 Ga0451841_1304204_515_979 154
602 3300041507 Ga0451851_0101857 Ga0451851_0101857_30_494 154
603 3300041509 Ga0451843_0764763 Ga0451843_0764763_34_498 154
604 3300041511 Ga0451855_0947765 Ga0451855_0947765_150_614 154
605 3300041512 Ga0451853_0482874 Ga0451853_0482874_128_592 154
606 3300041512 Ga0451853_1144964 Ga0451853_1144964_681_1145 154
607 3300041997 Ga0439431_0005195 Ga0439431_0005195_1675_2139 154
608 3300042121 Ga0450919_000139 Ga0450919_000139_4420_4884 154
609 3300042126 Ga0450888_002426 Ga0450888_002426_748_1212 154
610 3300042157 Ga0439458_0006248 Ga0439458_0006248_955_1419 154
611 3300042531 Ga0450918_005133 Ga0450918_005133_1392_1856 154
612 3300042876 Ga0451577_0018787 Ga0451577_0018787_5166_5630 154
613 3300042876 Ga0451577_0022716 Ga0451577_0022716_5075_5539 154
614 3300042876 Ga0451577_0086132 Ga0451577_0086132_128_592 154
615 3300042876 Ga0451577_0631265 Ga0451577_0631265_16_480 154
616 3300044658 Ga0466972_0110957 Ga0466972_0110957_361_825 154
617 3300044712 Ga0453684_0297230 Ga0453684_0297230_739_1203 154
618 3300044712 Ga0453684_0412049 Ga0453684_0412049_486_950 154
619 3300044765 Ga0466970_0080053 Ga0466970_0080053_358_822 154
620 3300044901 Ga0466960_0137794 Ga0466960_0137794_381_845 154
621 3300045049 Ga0466959_0651449 Ga0466959_0651449_17_481 154
622 3300046457 Ga0495590_0054938 Ga0495590_0054938_268_732 154
623 3300046460 Ga0495638_0174869 Ga0495638_0174869_623_1087 154
624 3300046471 Ga0495650_0003992 Ga0495650_0003992_1279_1743 154
625 3300046474 Ga0495605_0082631 Ga0495605_0082631_437_901 154
626 3300046507 Ga0495606_0433630 Ga0495606_0433630_118_582 154
627 3300046512 Ga0495610_0011872 Ga0495610_0011872_3166_3630 154
628 3300046512 Ga0495610_0063215 Ga0495610_0063215_981_1445 154
629 3300046513 Ga0495616_0214048 Ga0495616_0214048_42_506 154
630 3300046515 Ga0495620_0314476 Ga0495620_0314476_19_483 154
631 3300046519 Ga0495632_0008169 Ga0495632_0008169_3805_4269 154
632 3300046519 Ga0495632_0010554 Ga0495632_0010554_3641_4105 154
633 3300046522 Ga0495643_0008013 Ga0495643_0008013_4799_5263 154
634 3300046528 Ga0495642_0217410 Ga0495642_0217410_313_777 154
635 3300046530 Ga0495654_0152004 Ga0495654_0152004_247_711 154
636 3300046537 Ga0495598_0011607 Ga0495598_0011607_809_1273 154
637 3300046539 Ga0495621_0005161 Ga0495621_0005161_1252_1716 154
638 3300046542 Ga0495597_0004699 Ga0495597_0004699_4548_5012 154
639 3300046542 Ga0495597_0057252 Ga0495597_0057252_354_818 154
640 3300046660 Ga0495625_0008189 Ga0495625_0008189_3342_3806 154
641 3300046660 Ga0495625_0012918 Ga0495625_0012918_2960_3424 154
642 3300046660 Ga0495625_0155573 Ga0495625_0155573_155_637 154
643 3300046683 Ga0495658_0109631 Ga0495658_0109631_253_717 154
644 3300046683 Ga0495658_0383963 Ga0495658_0383963_194_676 154
645 3300046684 Ga0495669_0484695 Ga0495669_0484695_40_504 154
646 3300046692 Ga0495671_0085257 Ga0495671_0085257_1003_1485 154
647 3300046692 Ga0495671_0311793 Ga0495671_0311793_207_671 154
648 3300046694 Ga0495649_0004058 Ga0495649_0004058_2927_3391 154
649 3300046810 Ga0495660_0377967 Ga0495660_0377967_45_509 154
650 3300047443 Ga0495687_001087 Ga0495687_001087_19452_19916 154
651 3300047443 Ga0495687_033644 Ga0495687_033644_1141_1605 154
652 3300047469 Ga0495673_0091223 Ga0495673_0091223_198_680 154
653 3300047472 Ga0495686_0000902 Ga0495686_0000902_2580_3044 154
654 3300048905 Ga0496102_0001780 Ga0496102_0001780_11298_11762 154
655 3300048905 Ga0496102_0024399 Ga0496102_0024399_4071_4535 154
656 3300048909 Ga0496106_0079932 Ga0496106_0079932_1188_1670 154
657 3300048917 Ga0496114_0030428 Ga0496114_0030428_748_1212 154
658 3300048924 Ga0496121_0023861 Ga0496121_0023861_1221_1685 154
659 3300048928 Ga0496125_0547291 Ga0496125_0547291_101_565 154
660 3300048928 Ga0496125_0661057 Ga0496125_0661057_29_493 154
661 3300049539 Ga0501323_010732 Ga0501323_010732_219_683 154
662 3300049572 Ga0501036_0933882 Ga0501036_0933882_97_561 154
663 3300049579 Ga0501043_0000108 Ga0501043_0000108_43456_43920 154
664 3300049580 Ga0501046_0000050 Ga0501046_0000050_33448_33912 154
665 3300049581 Ga0501047_0000012 Ga0501047_0000012_334920_335384 154
666 3300049582 Ga0501048_0000521 Ga0501048_0000521_17210_17674 154
667 3300049649 Ga0501198_000030 Ga0501198_000030_1828_2292 154
668 3300049662 Ga0501222_000047 Ga0501222_000047_1794_2258 154
669 3300049824 Ga0501045_0315337 Ga0501045_0315337_77_541 154
670 3300050489 nmdc:mga03683_12840_c1 nmdc:mga03683_12840_c1_2546_3010 154
671 3300050490 nmdc:mga03n38_846963_c1 nmdc:mga03n38_846963_c1_25_489 154
672 3300050491 nmdc:mga00v17_117998_c1 nmdc:mga00v17_117998_c1_120_584 154
673 3300050492 nmdc:mga0yw44_280599_c1 nmdc:mga0yw44_280599_c1_168_632 154
674 3300050493 nmdc:mga0k408_270946_c1 nmdc:mga0k408_270946_c1_424_888 154
675 3300050493 nmdc:mga0k408_3090_c1 nmdc:mga0k408_3090_c1_1104_1568 154
676 3300050493 nmdc:mga0k408_311471_c1 nmdc:mga0k408_311471_c1_437_901 154
677 3300050493 nmdc:mga0k408_39231_c1 nmdc:mga0k408_39231_c1_2207_2671 154
678 3300050493 nmdc:mga0k408_417_c2 nmdc:mga0k408_417_c2_2061_2525 154
679 3300050493 nmdc:mga0k408_725_c1 nmdc:mga0k408_725_c1_2154_2618 154
680 3300050494 nmdc:mga06z11_142899_c1 nmdc:mga06z11_142899_c1_729_1193 154
681 3300050494 nmdc:mga06z11_390529_c1 nmdc:mga06z11_390529_c1_188_652 154
682 3300050494 nmdc:mga06z11_449297_c1 nmdc:mga06z11_449297_c1_163_627 154
683 3300050495 nmdc:mga04h51_130520_c1 nmdc:mga04h51_130520_c1_261_725 154
684 3300050495 nmdc:mga04h51_41706_c1 nmdc:mga04h51_41706_c1_384_848 154
685 3300050495 nmdc:mga04h51_69857_c1 nmdc:mga04h51_69857_c1_746_1210 154
686 3300050496 nmdc:mga07m45_160_c1 nmdc:mga07m45_160_c1_18416_18880 154
687 3300050496 nmdc:mga07m45_191726_c1 nmdc:mga07m45_191726_c1_430_894 154
688 3300050496 nmdc:mga07m45_196949_c1 nmdc:mga07m45_196949_c1_261_725 154
689 3300050496 nmdc:mga07m45_43396_c1 nmdc:mga07m45_43396_c1_1841_2305 154
690 3300050496 nmdc:mga07m45_6211_c1 nmdc:mga07m45_6211_c1_4421_4885 154
691 3300050496 nmdc:mga07m45_7544_c1 nmdc:mga07m45_7544_c1_3867_4331 154
692 3300050496 nmdc:mga07m45_9764_c1 nmdc:mga07m45_9764_c1_2420_2884 154
693 3300050516 nmdc:mga0sz30_17553_c1 nmdc:mga0sz30_17553_c1_1248_1712 154
694 3300053086 Ga0500578_0000537 Ga0500578_0000537_42405_42869 154
695 3300053086 Ga0500578_0056046 Ga0500578_0056046_1283_1765 154
696 3300053088 Ga0500644_0004699 Ga0500644_0004699_2141_2605 154
697 3300053092 Ga0500583_0288271 Ga0500583_0288271_138_602 154
698 3300053093 Ga0500651_0396466 Ga0500651_0396466_156_620 154
699 3300053117 Ga0500593_000152 Ga0500593_000152_3029_3493 154
700 3300053130 Ga0500642_0002803 Ga0500642_0002803_940_1404 154
701 3300053131 Ga0500652_000361 Ga0500652_000361_3324_3788 154
702 3300053133 Ga0500655_003842 Ga0500655_003842_1688_2152 154
703 3300053134 Ga0500658_0010005 Ga0500658_0010005_2828_3292 154
704 3300053134 Ga0500658_0156803 Ga0500658_0156803_267_731 154
705 3300053137 Ga0500561_0019926 Ga0500561_0019926_585_1049 154
706 3300053137 Ga0500561_0038360 Ga0500561_0038360_761_1240 154
707 3300053139 Ga0500568_0011426 Ga0500568_0011426_388_852 154
708 3300053139 Ga0500568_0014287 Ga0500568_0014287_1091_1555 154
709 3300053142 Ga0500577_0051585 Ga0500577_0051585_859_1323 154
710 3300053143 Ga0500579_203344 Ga0500579_203344_116_580 154
711 3300053147 Ga0500589_194371 Ga0500589_194371_299_763 154
712 3300053153 Ga0500616_0173273 Ga0500616_0173273_477_941 154
713 3300053154 Ga0500619_000004 Ga0500619_000004_69648_70112 154
714 3300053156 Ga0500622_0000423 Ga0500622_0000423_37873_38337 154
715 3300053160 Ga0500633_0186565 Ga0500633_0186565_196_678 154
716 3300053724 Ga0500570_045471 Ga0500570_045471_134_598 154
717 3300053724 Ga0500570_048548 Ga0500570_048548_310_774 154
718 3300053726 Ga0500584_134496 Ga0500584_134496_407_871 154
719 3300053730 Ga0500645_002532 Ga0500645_002532_6851_7333 154
720 3300053739 Ga0500587_012252 Ga0500587_012252_431_895 154
721 3300059421 Ga0590071_001450 Ga0590071_001450_3403_3882 154
722 3300059423 Ga0590074_043912 Ga0590074_043912_79_558 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

26

168

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a4f-assembly1.cif.gz_AI aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9928 14 87
7a4f-assembly1.cif.gz_AC aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9825 14 87
7a4h-assembly1.cif.gz_BB aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9817 13 81
7a4h-assembly1.cif.gz_BK aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9786 13 81
7a4h-assembly1.cif.gz_BL aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9785 13 81
ID Description Score Start End Superfamily
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9668 13 152 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9667 12 154 3.40.50.960
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9532 9 151 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9517 11 147 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9354 12 154 3.40.50.960
ID Description Score Start End GO Terms
AF-G4QCK0-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9894 13 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A077DE93-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9892 13 154 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A2G8SWT9-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9889 13 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A6N0ZF49-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9887 13 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A7X7CUF1-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9885 13 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Feature Viewer

pLDDT pTM Quality
93.43 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map