F477438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 393 | 700 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0003620|Ga0466969_0003620_6120_6653 |
| Length | 177 |
| Sequence | LSARAKALLSRISLFKGKRLLSQEQPLRLLIVESRFYDDIADELLAGARDALEAHGVDYDVVTVPGAFEIPAAIAMAEDAAHRPMGKAYDGYVALGCVIRGETTHYDYVCNESARGLMELSYTQRLAIGYGILTVEDEAQAWARARRSEGDKGGTVAKVCLSMIALRKSLMEGSVNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 11 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 12 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 13 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 14 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 15 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 16 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 17 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 18 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 19 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 20 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 21 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 22 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 23 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 24 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 97 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 202 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 226 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 236 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 237 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 238 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 239 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 242 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 243 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 244 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 245 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 337 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 358 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 362 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 376 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 377 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 378 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 382 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 383 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 385 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 386 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 393 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.54 |
| Metatranscriptomes | 0.28 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.5 |
| Nodule | 1.52 |
| Rhizoplane | 4.57 |
| Rhizosphere | 64.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003184 | 3300002773 | Bacteria | 5710 |
| 2 | JGI25150J39212_1011358 | 3300002774 | Bacteria | 1618 |
| 3 | JGI25159J45721_1007881 | 3300002987 | Bacteria | 2995 |
| 4 | JGI25151J46595_10000047 | 3300003187 | Bacteria | 166938 |
| 5 | JGI25151J46595_10067274 | 3300003187 | Bacteria | 1105 |
| 6 | JGI25153J46596_10003416 | 3300003215 | Bacteria | 8884 |
| 7 | JGI25153J46596_10003814 | 3300003215 | Bacteria | 8317 |
| 8 | rootH1_10004001 | 3300003316 | Bacteria | 4240 |
| 9 | rootH1_10004001 | 3300003323 | Bacteria | 7650 |
| 10 | rootH2_10067744 | 3300003320 | Bacteria | 4726 |
| 11 | rootH1_10003085 | 3300003323 | Bacteria | 20562 |
| 12 | rootH1_10149653 | 3300003323 | Bacteria | 2123 |
| 13 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 14 | Ga0055526_1000274 | 3300003771 | Bacteria | 43546 |
| 15 | Ga0055526_1003449 | 3300003771 | Bacteria | 10032 |
| 16 | Ga0055526_1004542 | 3300003771 | Bacteria | 8297 |
| 17 | Ga0055524_1000100 | 3300003775 | Bacteria | 107020 |
| 18 | Ga0055524_1000253 | 3300003775 | Bacteria | 55038 |
| 19 | Ga0055524_1006673 | 3300003775 | Bacteria | 4987 |
| 20 | Ga0055524_1006902 | 3300003775 | Bacteria | 4888 |
| 21 | Ga0055530_10012910 | 3300003791 | Bacteria | 2885 |
| 22 | Ga0055530_10016972 | 3300003791 | Bacteria | 2296 |
| 23 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 24 | Ga0055531_10000841 | 3300003794 | Bacteria | 25310 |
| 25 | Ga0055531_10007597 | 3300003794 | Bacteria | 5877 |
| 26 | Ga0055543_1021852 | 3300004625 | Bacteria | 1165 |
| 27 | Ga0065165_1000046 | 3300005262 | Bacteria | 198873 |
| 28 | Ga0065165_1000092 | 3300005262 | Bacteria | 148435 |
| 29 | Ga0065165_1002514 | 3300005262 | Bacteria | 15295 |
| 30 | Ga0065165_1040895 | 3300005262 | Bacteria | 1379 |
| 31 | Ga0070658_10117742 | 3300005327 | Bacteria | 2206 |
| 32 | Ga0070658_10329543 | 3300005327 | Bacteria | 1304 |
| 33 | Ga0070658_10535863 | 3300005327 | Bacteria | 1013 |
| 34 | Ga0070670_100000316 | 3300005331 | Bacteria | 41464 |
| 35 | Ga0070677_10085159 | 3300005333 | Bacteria | 1362 |
| 36 | Ga0068869_100499330 | 3300005334 | Bacteria | 1015 |
| 37 | Ga0068869_101011222 | 3300005334 | Bacteria | 724 |
| 38 | Ga0070680_100016657 | 3300005336 | Bacteria | 5787 |
| 39 | Ga0070680_100117530 | 3300005336 | Bacteria | 2217 |
| 40 | Ga0068868_100018706 | 3300005338 | Bacteria | 5184 |
| 41 | Ga0068868_100586243 | 3300005338 | Bacteria | 986 |
| 42 | Ga0070660_100650170 | 3300005339 | Bacteria | 883 |
| 43 | Ga0070660_101486232 | 3300005339 | Bacteria | 576 |
| 44 | Ga0070661_100003441 | 3300005344 | Bacteria | 10933 |
| 45 | Ga0070661_100098901 | 3300005344 | Bacteria | 2167 |
| 46 | Ga0070661_100299687 | 3300005344 | Bacteria | 1251 |
| 47 | Ga0070669_100014753 | 3300005353 | Bacteria | 5563 |
| 48 | Ga0070669_100087143 | 3300005353 | Bacteria | 2334 |
| 49 | Ga0070669_100492479 | 3300005353 | Bacteria | 1016 |
| 50 | Ga0070675_100021440 | 3300005354 | Bacteria | 5163 |
| 51 | Ga0070675_100099423 | 3300005354 | Bacteria | 2449 |
| 52 | Ga0070675_100519340 | 3300005354 | Bacteria | 1074 |
| 53 | Ga0070671_100020520 | 3300005355 | Bacteria | 5389 |
| 54 | Ga0070671_100099089 | 3300005355 | Bacteria | 2444 |
| 55 | Ga0070674_100008892 | 3300005356 | Bacteria | 5997 |
| 56 | Ga0070674_100083373 | 3300005356 | Bacteria | 2289 |
| 57 | Ga0070673_100005627 | 3300005364 | Bacteria | 8040 |
| 58 | Ga0070673_100029285 | 3300005364 | Bacteria | 4105 |
| 59 | Ga0070673_100157990 | 3300005364 | Bacteria | 1926 |
| 60 | Ga0070673_100191134 | 3300005364 | Bacteria | 1759 |
| 61 | Ga0070659_100000414 | 3300005366 | Bacteria | 32437 |
| 62 | Ga0070659_100015408 | 3300005366 | Bacteria | 5726 |
| 63 | Ga0070659_101279782 | 3300005366 | Bacteria | 650 |
| 64 | Ga0070667_100003744 | 3300005367 | Bacteria | 12915 |
| 65 | Ga0070667_100102848 | 3300005367 | Bacteria | 2469 |
| 66 | Ga0070667_100331610 | 3300005367 | Bacteria | 1375 |
| 67 | Ga0070667_100415500 | 3300005367 | Bacteria | 1226 |
| 68 | Ga0070708_100091905 | 3300005445 | Bacteria | 2764 |
| 69 | Ga0070708_100806973 | 3300005445 | Bacteria | 882 |
| 70 | Ga0070708_101560086 | 3300005445 | Bacteria | 615 |
| 71 | Ga0070663_100000288 | 3300005455 | Bacteria | 25697 |
| 72 | Ga0070663_100092489 | 3300005455 | Bacteria | 2243 |
| 73 | Ga0070663_100467579 | 3300005455 | Bacteria | 1042 |
| 74 | Ga0070678_100040094 | 3300005456 | Bacteria | 3311 |
| 75 | Ga0070678_100102871 | 3300005456 | Bacteria | 2218 |
| 76 | Ga0070678_100164633 | 3300005456 | Bacteria | 1800 |
| 77 | Ga0070678_100554348 | 3300005456 | Bacteria | 1021 |
| 78 | Ga0070662_100035026 | 3300005457 | Bacteria | 3543 |
| 79 | Ga0070662_100081290 | 3300005457 | Bacteria | 2414 |
| 80 | Ga0070662_100577276 | 3300005457 | Bacteria | 944 |
| 81 | Ga0070662_100770099 | 3300005457 | Bacteria | 817 |
| 82 | Ga0070662_100886986 | 3300005457 | Bacteria | 761 |
| 83 | Ga0070681_10054252 | 3300005458 | Bacteria | 3993 |
| 84 | Ga0070681_10063126 | 3300005458 | Bacteria | 3677 |
| 85 | Ga0068867_100000018 | 3300005459 | Bacteria | 102056 |
| 86 | Ga0068867_100000712 | 3300005459 | Bacteria | 22179 |
| 87 | Ga0068867_100638880 | 3300005459 | Bacteria | 932 |
| 88 | Ga0068867_100744418 | 3300005459 | Bacteria | 869 |
| 89 | Ga0070706_100007035 | 3300005467 | Bacteria | 10608 |
| 90 | Ga0070707_100468705 | 3300005468 | Bacteria | 1220 |
| 91 | Ga0070698_100186433 | 3300005471 | Bacteria | 2012 |
| 92 | Ga0070679_100013942 | 3300005530 | Bacteria | 7702 |
| 93 | Ga0068853_100029981 | 3300005539 | Bacteria | 4591 |
| 94 | Ga0068853_100095928 | 3300005539 | Bacteria | 2616 |
| 95 | Ga0068853_100252485 | 3300005539 | Bacteria | 1619 |
| 96 | Ga0068853_100815956 | 3300005539 | Bacteria | 894 |
| 97 | Ga0070672_100000206 | 3300005543 | Bacteria | 32562 |
| 98 | Ga0070672_100045348 | 3300005543 | Bacteria | 3400 |
| 99 | Ga0070672_100425536 | 3300005543 | Bacteria | 1141 |
| 100 | Ga0070665_100000327 | 3300005548 | Bacteria | 73382 |
| 101 | Ga0070665_100405347 | 3300005548 | Bacteria | 1372 |
| 102 | Ga0070665_100997449 | 3300005548 | Bacteria | 850 |
| 103 | Ga0070665_101849886 | 3300005548 | Bacteria | 610 |
| 104 | Ga0068855_100116069 | 3300005563 | Bacteria | 3068 |
| 105 | Ga0070664_100013581 | 3300005564 | Bacteria | 6634 |
| 106 | Ga0070664_100018046 | 3300005564 | Bacteria | 5793 |
| 107 | Ga0070664_100162347 | 3300005564 | Bacteria | 1977 |
| 108 | Ga0068857_100021161 | 3300005577 | Bacteria | 5724 |
| 109 | Ga0068857_101020747 | 3300005577 | Bacteria | 797 |
| 110 | Ga0068857_101093259 | 3300005577 | Bacteria | 770 |
| 111 | Ga0068854_100135522 | 3300005578 | Bacteria | 1884 |
| 112 | Ga0068856_100111665 | 3300005614 | Bacteria | 2731 |
| 113 | Ga0070702_100283635 | 3300005615 | Bacteria | 1138 |
| 114 | Ga0068852_100005610 | 3300005616 | Bacteria | 9001 |
| 115 | Ga0068852_100042576 | 3300005616 | Bacteria | 3844 |
| 116 | Ga0068859_100342955 | 3300005617 | Bacteria | 1588 |
| 117 | Ga0068864_100184243 | 3300005618 | Bacteria | 1910 |
| 118 | Ga0068861_101391081 | 3300005719 | Bacteria | 685 |
| 119 | Ga0068870_10180713 | 3300005840 | Bacteria | 1266 |
| 120 | Ga0068858_100321144 | 3300005842 | Bacteria | 1480 |
| 121 | Ga0068860_100044526 | 3300005843 | Bacteria | 4230 |
| 122 | Ga0068860_100902231 | 3300005843 | Bacteria | 900 |
| 123 | Ga0068862_100041852 | 3300005844 | Bacteria | 3900 |
| 124 | Ga0081455_10313754 | 3300005937 | Bacteria | 1120 |
| 125 | Ga0070717_10235061 | 3300006028 | Bacteria | 1614 |
| 126 | Ga0075368_10034052 | 3300006042 | Bacteria | 1984 |
| 127 | Ga0075368_10183265 | 3300006042 | Bacteria | 883 |
| 128 | Ga0075363_100014280 | 3300006048 | Bacteria | 3875 |
| 129 | Ga0075363_100049825 | 3300006048 | Bacteria | 2231 |
| 130 | Ga0075363_100208489 | 3300006048 | Bacteria | 1118 |
| 131 | Ga0075364_10134327 | 3300006051 | Bacteria | 1662 |
| 132 | Ga0075364_10368715 | 3300006051 | Bacteria | 979 |
| 133 | Ga0075362_10002253 | 3300006177 | Bacteria | 6422 |
| 134 | Ga0075362_10062132 | 3300006177 | Bacteria | 1692 |
| 135 | Ga0075362_10251339 | 3300006177 | Bacteria | 869 |
| 136 | Ga0075367_10000848 | 3300006178 | Bacteria | 12173 |
| 137 | Ga0075367_10015213 | 3300006178 | Bacteria | 4177 |
| 138 | Ga0075367_10047448 | 3300006178 | Bacteria | 2527 |
| 139 | Ga0075367_10356749 | 3300006178 | Bacteria | 923 |
| 140 | Ga0075369_10002971 | 3300006186 | Bacteria | 6127 |
| 141 | Ga0075369_10022450 | 3300006186 | Bacteria | 2603 |
| 142 | Ga0075369_10233888 | 3300006186 | Bacteria | 852 |
| 143 | Ga0075366_10030684 | 3300006195 | Bacteria | 3161 |
| 144 | Ga0075366_10039649 | 3300006195 | Bacteria | 2784 |
| 145 | Ga0075366_10083557 | 3300006195 | Bacteria | 1908 |
| 146 | Ga0075366_10126518 | 3300006195 | Bacteria | 1541 |
| 147 | Ga0075366_10174084 | 3300006195 | Bacteria | 1306 |
| 148 | Ga0075366_10196770 | 3300006195 | Bacteria | 1225 |
| 149 | Ga0075366_10767181 | 3300006195 | Bacteria | 599 |
| 150 | Ga0097621_100198506 | 3300006237 | Bacteria | 1740 |
| 151 | Ga0075370_10002309 | 3300006353 | Bacteria | 8796 |
| 152 | Ga0075370_10003363 | 3300006353 | Bacteria | 7605 |
| 153 | Ga0075370_10006079 | 3300006353 | Bacteria | 6050 |
| 154 | Ga0075370_10047864 | 3300006353 | Bacteria | 2421 |
| 155 | Ga0075370_10269571 | 3300006353 | Bacteria | 1010 |
| 156 | Ga0075430_100007141 | 3300006846 | Bacteria | 9423 |
| 157 | Ga0075431_100024811 | 3300006847 | Bacteria | 6147 |
| 158 | Ga0075431_100149677 | 3300006847 | Bacteria | 2404 |
| 159 | Ga0068865_100044344 | 3300006881 | Bacteria | 3043 |
| 160 | Ga0097620_100343001 | 3300006931 | Bacteria | 1588 |
| 161 | Ga0099824_1038383 | 3300006942 | Bacteria | 1278 |
| 162 | Ga0099823_1002588 | 3300006944 | Bacteria | 16426 |
| 163 | Ga0079104_1000040 | 3300006946 | Bacteria | 187962 |
| 164 | Ga0105240_10006664 | 3300009093 | Bacteria | 16933 |
| 165 | Ga0105240_10012992 | 3300009093 | Bacteria | 11468 |
| 166 | Ga0105240_10018555 | 3300009093 | Bacteria | 9337 |
| 167 | Ga0105240_10050283 | 3300009093 | Bacteria | 5256 |
| 168 | Ga0105240_10263605 | 3300009093 | Bacteria | 1987 |
| 169 | Ga0105240_10526827 | 3300009093 | Bacteria | 1310 |
| 170 | Ga0105240_11641934 | 3300009093 | Bacteria | 672 |
| 171 | Ga0111539_10314626 | 3300009094 | Bacteria | 1822 |
| 172 | Ga0111539_12099261 | 3300009094 | Bacteria | 655 |
| 173 | Ga0105245_10019471 | 3300009098 | Bacteria | 5946 |
| 174 | Ga0105245_10220088 | 3300009098 | Bacteria | 1831 |
| 175 | Ga0105245_10363626 | 3300009098 | Bacteria | 1437 |
| 176 | Ga0114129_10118791 | 3300009147 | Bacteria | 3642 |
| 177 | Ga0105243_10040230 | 3300009148 | Bacteria | 3649 |
| 178 | Ga0105243_10171020 | 3300009148 | Bacteria | 1882 |
| 179 | Ga0105243_10317841 | 3300009148 | Bacteria | 1418 |
| 180 | Ga0105243_10891390 | 3300009148 | Bacteria | 884 |
| 181 | Ga0105241_10208010 | 3300009174 | Bacteria | 1638 |
| 182 | Ga0105241_10438568 | 3300009174 | Bacteria | 1153 |
| 183 | Ga0105242_11131663 | 3300009176 | Bacteria | 798 |
| 184 | Ga0105248_10015263 | 3300009177 | Bacteria | 8467 |
| 185 | Ga0105237_10003122 | 3300009545 | Bacteria | 19945 |
| 186 | Ga0105237_10023165 | 3300009545 | Bacteria | 6366 |
| 187 | Ga0105237_12115687 | 3300009545 | Bacteria | 572 |
| 188 | Ga0105238_10021552 | 3300009551 | Bacteria | 6563 |
| 189 | Ga0105238_10044939 | 3300009551 | Bacteria | 4464 |
| 190 | Ga0105238_10051787 | 3300009551 | Bacteria | 4128 |
| 191 | Ga0105238_10451673 | 3300009551 | Bacteria | 1282 |
| 192 | Ga0105249_10599643 | 3300009553 | Bacteria | 1156 |
| 193 | Ga0105239_10000563 | 3300010375 | Bacteria | 53173 |
| 194 | Ga0105239_10026325 | 3300010375 | Bacteria | 6401 |
| 195 | Ga0105239_10216562 | 3300010375 | Bacteria | 2147 |
| 196 | Ga0105239_13222042 | 3300010375 | Bacteria | 531 |
| 197 | Ga0157370_10407612 | 3300013104 | Bacteria | 1251 |
| 198 | Ga0157370_10538377 | 3300013104 | Bacteria | 1071 |
| 199 | Ga0157369_10740205 | 3300013105 | Bacteria | 1012 |
| 200 | Ga0171462_1011 | 3300013250 | Bacteria | 229282 |
| 201 | Ga0157374_10534134 | 3300013296 | Bacteria | 1180 |
| 202 | Ga0157374_12150638 | 3300013296 | Bacteria | 585 |
| 203 | Ga0157378_10261888 | 3300013297 | Bacteria | 1659 |
| 204 | Ga0163162_10266438 | 3300013306 | Bacteria | 1844 |
| 205 | Ga0163162_10620307 | 3300013306 | Bacteria | 1207 |
| 206 | Ga0163162_12423241 | 3300013306 | Bacteria | 603 |
| 207 | Ga0157372_11158564 | 3300013307 | Bacteria | 894 |
| 208 | Ga0157375_10095126 | 3300013308 | Bacteria | 3049 |
| 209 | Ga0157375_10155596 | 3300013308 | Bacteria | 2425 |
| 210 | Ga0157375_10410485 | 3300013308 | Bacteria | 1520 |
| 211 | Ga0163163_10171221 | 3300014325 | Bacteria | 2218 |
| 212 | Ga0157380_11437095 | 3300014326 | Bacteria | 741 |
| 213 | Ga0157380_11851205 | 3300014326 | Bacteria | 663 |
| 214 | Ga0157380_12606719 | 3300014326 | Bacteria | 572 |
| 215 | Ga0157377_10000051 | 3300014745 | Bacteria | 90204 |
| 216 | Ga0157377_10823948 | 3300014745 | Bacteria | 686 |
| 217 | Ga0157379_10467459 | 3300014968 | Bacteria | 1166 |
| 218 | Ga0157376_11986851 | 3300014969 | Bacteria | 619 |
| 219 | Ga0163161_10003613 | 3300017792 | Bacteria | 10852 |
| 220 | Ga0213872_10000046 | 3300021361 | Bacteria | 109934 |
| 221 | Ga0213872_10000048 | 3300021361 | Bacteria | 109712 |
| 222 | Ga0213872_10000086 | 3300021361 | Bacteria | 84955 |
| 223 | Ga0213872_10000090 | 3300021361 | Bacteria | 83813 |
| 224 | Ga0213872_10024668 | 3300021361 | Bacteria | 2766 |
| 225 | Ga0213872_10216111 | 3300021361 | Bacteria | 817 |
| 226 | Ga0213872_10220729 | 3300021361 | Bacteria | 807 |
| 227 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 228 | Ga0207425_1001899 | 3300025245 | Bacteria | 7953 |
| 229 | Ga0207425_1070726 | 3300025245 | Bacteria | 598 |
| 230 | Ga0209129_1000124 | 3300025258 | Bacteria | 133610 |
| 231 | Ga0209565_1021127 | 3300025263 | Bacteria | 1364 |
| 232 | Ga0209673_1040424 | 3300025273 | Bacteria | 1334 |
| 233 | Ga0209130_1003746 | 3300025284 | Bacteria | 6211 |
| 234 | Ga0209675_1000536 | 3300025291 | Bacteria | 27786 |
| 235 | Ga0209676_1023653 | 3300025292 | Bacteria | 2006 |
| 236 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 237 | Ga0209025_1003819 | 3300025294 | Bacteria | 13753 |
| 238 | Ga0209025_1043804 | 3300025294 | Bacteria | 1879 |
| 239 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 240 | Ga0209564_1000035 | 3300025295 | Bacteria | 442446 |
| 241 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 242 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 243 | Ga0209758_1000232 | 3300025297 | Bacteria | 117382 |
| 244 | Ga0209050_1000376 | 3300025298 | Bacteria | 84318 |
| 245 | Ga0209050_1001215 | 3300025298 | Bacteria | 30104 |
| 246 | Ga0209050_1008356 | 3300025298 | Bacteria | 5553 |
| 247 | Ga0209256_1000025 | 3300025299 | Bacteria | 442449 |
| 248 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 249 | Ga0209256_1000262 | 3300025299 | Bacteria | 93226 |
| 250 | Ga0207426_1014534 | 3300025302 | Bacteria | 2881 |
| 251 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 252 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 253 | Ga0209257_1013523 | 3300025304 | Bacteria | 3619 |
| 254 | Ga0209257_1032608 | 3300025304 | Bacteria | 1649 |
| 255 | Ga0209257_1040596 | 3300025304 | Bacteria | 1387 |
| 256 | Ga0207682_10000269 | 3300025893 | Bacteria | 23507 |
| 257 | Ga0207682_10010445 | 3300025893 | Bacteria | 3639 |
| 258 | Ga0207642_10187481 | 3300025899 | Bacteria | 1132 |
| 259 | Ga0207680_10221406 | 3300025903 | Bacteria | 1298 |
| 260 | Ga0207645_10048409 | 3300025907 | Bacteria | 2714 |
| 261 | Ga0207645_10336406 | 3300025907 | Bacteria | 1009 |
| 262 | Ga0207643_10149855 | 3300025908 | Bacteria | 1398 |
| 263 | Ga0207643_10258548 | 3300025908 | Bacteria | 1074 |
| 264 | Ga0207705_10001301 | 3300025909 | Bacteria | 20026 |
| 265 | Ga0207705_10284910 | 3300025909 | Bacteria | 1265 |
| 266 | Ga0207684_10000871 | 3300025910 | Bacteria | 34446 |
| 267 | Ga0207707_10044666 | 3300025912 | Bacteria | 3862 |
| 268 | Ga0207707_10061291 | 3300025912 | Bacteria | 3273 |
| 269 | Ga0207695_10000728 | 3300025913 | Bacteria | 63935 |
| 270 | Ga0207695_10002551 | 3300025913 | Bacteria | 26766 |
| 271 | Ga0207695_10014064 | 3300025913 | Bacteria | 9503 |
| 272 | Ga0207695_10017230 | 3300025913 | Bacteria | 8414 |
| 273 | Ga0207695_10021053 | 3300025913 | Bacteria | 7449 |
| 274 | Ga0207695_10105580 | 3300025913 | Bacteria | 2804 |
| 275 | Ga0207671_10005735 | 3300025914 | Bacteria | 11318 |
| 276 | Ga0207671_10102303 | 3300025914 | Bacteria | 2171 |
| 277 | Ga0207660_10032401 | 3300025917 | Bacteria | 3607 |
| 278 | Ga0207660_10084746 | 3300025917 | Bacteria | 2336 |
| 279 | Ga0207657_10004872 | 3300025919 | Bacteria | 14126 |
| 280 | Ga0207657_10058952 | 3300025919 | Bacteria | 3301 |
| 281 | Ga0207657_10079911 | 3300025919 | Bacteria | 2750 |
| 282 | Ga0207657_10373856 | 3300025919 | Bacteria | 1123 |
| 283 | Ga0207657_10433400 | 3300025919 | Bacteria | 1032 |
| 284 | Ga0207649_10004702 | 3300025920 | Bacteria | 7388 |
| 285 | Ga0207649_10154689 | 3300025920 | Bacteria | 1583 |
| 286 | Ga0207652_10014009 | 3300025921 | Bacteria | 6492 |
| 287 | Ga0207652_10723290 | 3300025921 | Bacteria | 887 |
| 288 | Ga0207681_10012357 | 3300025923 | Bacteria | 5268 |
| 289 | Ga0207681_10077266 | 3300025923 | Bacteria | 2340 |
| 290 | Ga0207681_10340000 | 3300025923 | Bacteria | 1199 |
| 291 | Ga0207681_10546601 | 3300025923 | Bacteria | 953 |
| 292 | Ga0207694_10017119 | 3300025924 | Bacteria | 5476 |
| 293 | Ga0207694_10046881 | 3300025924 | Bacteria | 3341 |
| 294 | Ga0207694_10162481 | 3300025924 | Bacteria | 1805 |
| 295 | Ga0207650_10000172 | 3300025925 | Bacteria | 76270 |
| 296 | Ga0207650_10194608 | 3300025925 | Bacteria | 1622 |
| 297 | Ga0207650_10433211 | 3300025925 | Bacteria | 1092 |
| 298 | Ga0207659_10000066 | 3300025926 | Bacteria | 66468 |
| 299 | Ga0207659_10352282 | 3300025926 | Bacteria | 1222 |
| 300 | Ga0207687_10184623 | 3300025927 | Bacteria | 1618 |
| 301 | Ga0207687_10264631 | 3300025927 | Bacteria | 1372 |
| 302 | Ga0207687_10368975 | 3300025927 | Bacteria | 1173 |
| 303 | Ga0207644_10017947 | 3300025931 | Bacteria | 4784 |
| 304 | Ga0207644_10343913 | 3300025931 | Bacteria | 1210 |
| 305 | Ga0207690_10000294 | 3300025932 | Bacteria | 35162 |
| 306 | Ga0207690_10000990 | 3300025932 | Bacteria | 18184 |
| 307 | Ga0207706_10046461 | 3300025933 | Bacteria | 3844 |
| 308 | Ga0207706_10428628 | 3300025933 | Bacteria | 1145 |
| 309 | Ga0207706_10599818 | 3300025933 | Bacteria | 946 |
| 310 | Ga0207709_10000889 | 3300025935 | Bacteria | 22596 |
| 311 | Ga0207669_10026021 | 3300025937 | Bacteria | 3174 |
| 312 | Ga0207669_10111764 | 3300025937 | Bacteria | 1833 |
| 313 | Ga0207669_10217891 | 3300025937 | Bacteria | 1398 |
| 314 | Ga0207704_10403934 | 3300025938 | Bacteria | 1079 |
| 315 | Ga0207691_10000265 | 3300025940 | Bacteria | 51755 |
| 316 | Ga0207691_10009413 | 3300025940 | Bacteria | 9384 |
| 317 | Ga0207691_10064013 | 3300025940 | Bacteria | 3333 |
| 318 | Ga0207691_10664794 | 3300025940 | Bacteria | 880 |
| 319 | Ga0207711_10001005 | 3300025941 | Bacteria | 27049 |
| 320 | Ga0207711_11109109 | 3300025941 | Bacteria | 732 |
| 321 | Ga0207689_10175883 | 3300025942 | Bacteria | 1765 |
| 322 | Ga0207679_10006650 | 3300025945 | Bacteria | 7318 |
| 323 | Ga0207679_10011841 | 3300025945 | Bacteria | 5670 |
| 324 | Ga0207679_10271021 | 3300025945 | Bacteria | 1452 |
| 325 | Ga0207679_11408055 | 3300025945 | Bacteria | 640 |
| 326 | Ga0207667_10006530 | 3300025949 | Bacteria | 14103 |
| 327 | Ga0207667_10019379 | 3300025949 | Bacteria | 7597 |
| 328 | Ga0207651_10034339 | 3300025960 | Bacteria | 3284 |
| 329 | Ga0207651_10129420 | 3300025960 | Bacteria | 1929 |
| 330 | Ga0207651_10140082 | 3300025960 | Bacteria | 1867 |
| 331 | Ga0207651_10273466 | 3300025960 | Bacteria | 1392 |
| 332 | Ga0207712_11522526 | 3300025961 | Bacteria | 599 |
| 333 | Ga0207668_10488555 | 3300025972 | Bacteria | 1057 |
| 334 | Ga0207658_10031651 | 3300025986 | Bacteria | 3758 |
| 335 | Ga0207658_10079771 | 3300025986 | Bacteria | 2505 |
| 336 | Ga0207658_10207290 | 3300025986 | Bacteria | 1641 |
| 337 | Ga0207658_10269678 | 3300025986 | Bacteria | 1454 |
| 338 | Ga0207658_10320768 | 3300025986 | Bacteria | 1341 |
| 339 | Ga0207658_10912347 | 3300025986 | Bacteria | 800 |
| 340 | Ga0207677_10064156 | 3300026023 | Bacteria | 2557 |
| 341 | Ga0207677_10357805 | 3300026023 | Bacteria | 1225 |
| 342 | Ga0207677_10666274 | 3300026023 | Bacteria | 920 |
| 343 | Ga0207703_10549307 | 3300026035 | Bacteria | 1089 |
| 344 | Ga0207703_10754915 | 3300026035 | Bacteria | 927 |
| 345 | Ga0207639_10079911 | 3300026041 | Bacteria | 2585 |
| 346 | Ga0207639_10086256 | 3300026041 | Bacteria | 2499 |
| 347 | Ga0207639_10651837 | 3300026041 | Bacteria | 974 |
| 348 | Ga0207639_10690553 | 3300026041 | Bacteria | 946 |
| 349 | Ga0207678_10001406 | 3300026067 | Bacteria | 22142 |
| 350 | Ga0207678_10151853 | 3300026067 | Bacteria | 1978 |
| 351 | Ga0207678_10300228 | 3300026067 | Bacteria | 1380 |
| 352 | Ga0207678_10466618 | 3300026067 | Bacteria | 1098 |
| 353 | Ga0207702_10582604 | 3300026078 | Bacteria | 1097 |
| 354 | Ga0207641_10041181 | 3300026088 | Bacteria | 3871 |
| 355 | Ga0207648_10000060 | 3300026089 | Bacteria | 102225 |
| 356 | Ga0207648_10044482 | 3300026089 | Bacteria | 3895 |
| 357 | Ga0207648_10126026 | 3300026089 | Bacteria | 2253 |
| 358 | Ga0207648_10200534 | 3300026089 | Bacteria | 1769 |
| 359 | Ga0207648_10280613 | 3300026089 | Bacteria | 1490 |
| 360 | Ga0207648_11376382 | 3300026089 | Bacteria | 663 |
| 361 | Ga0207676_10117777 | 3300026095 | Bacteria | 2234 |
| 362 | Ga0207674_10018423 | 3300026116 | Bacteria | 7588 |
| 363 | Ga0207674_10424112 | 3300026116 | Bacteria | 1285 |
| 364 | Ga0207675_100178236 | 3300026118 | Bacteria | 2034 |
| 365 | Ga0207675_100699016 | 3300026118 | Bacteria | 1023 |
| 366 | Ga0207675_101231684 | 3300026118 | Bacteria | 769 |
| 367 | Ga0207683_10065460 | 3300026121 | Bacteria | 3205 |
| 368 | Ga0207683_10114077 | 3300026121 | Bacteria | 2421 |
| 369 | Ga0207683_10259656 | 3300026121 | Bacteria | 1586 |
| 370 | Ga0207683_10337638 | 3300026121 | Bacteria | 1381 |
| 371 | Ga0207683_10478185 | 3300026121 | Bacteria | 1149 |
| 372 | Ga0207698_10003996 | 3300026142 | Bacteria | 8945 |
| 373 | Ga0207698_10039287 | 3300026142 | Bacteria | 3504 |
| 374 | Ga0207698_10315229 | 3300026142 | Bacteria | 1462 |
| 375 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 376 | Ga0209813_10036427 | 3300027866 | Bacteria | 1478 |
| 377 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 378 | Ga0268266_10108959 | 3300028379 | Bacteria | 2452 |
| 379 | Ga0268266_10675334 | 3300028379 | Bacteria | 995 |
| 380 | Ga0268266_11399608 | 3300028379 | Bacteria | 675 |
| 381 | Ga0307517_10000499 | 3300028786 | Bacteria | 67326 |
| 382 | Ga0307517_10234865 | 3300028786 | Bacteria | 1095 |
| 383 | Ga0307517_10274665 | 3300028786 | Bacteria | 966 |
| 384 | Ga0307515_10000366 | 3300028794 | Bacteria | 111195 |
| 385 | Ga0307515_10001653 | 3300028794 | Bacteria | 49625 |
| 386 | Ga0307515_10124341 | 3300028794 | Bacteria | 2895 |
| 387 | Ga0307515_10141336 | 3300028794 | Bacteria | 2580 |
| 388 | Ga0307515_10251358 | 3300028794 | Bacteria | 1520 |
| 389 | Ga0307515_10283422 | 3300028794 | Bacteria | 1361 |
| 390 | Ga0265338_10611835 | 3300028800 | Bacteria | 758 |
| 391 | Ga0265324_10188597 | 3300029957 | Bacteria | 700 |
| 392 | Ga0307512_10065820 | 3300030522 | Bacteria | 2743 |
| 393 | Ga0265340_10023067 | 3300031247 | Bacteria | 3175 |
| 394 | Ga0265331_10009064 | 3300031250 | Bacteria | 5619 |
| 395 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 396 | Ga0307513_10067533 | 3300031456 | Bacteria | 3750 |
| 397 | Ga0307513_10085924 | 3300031456 | Bacteria | 3227 |
| 398 | Ga0307513_10130895 | 3300031456 | Bacteria | 2455 |
| 399 | Ga0307513_10392945 | 3300031456 | Bacteria | 1123 |
| 400 | Ga0307513_10702708 | 3300031456 | Bacteria | 717 |
| 401 | Ga0307408_100120045 | 3300031548 | Bacteria | 2035 |
| 402 | Ga0307408_100148194 | 3300031548 | Bacteria | 1850 |
| 403 | Ga0307408_101519866 | 3300031548 | Bacteria | 634 |
| 404 | Ga0307508_10000194 | 3300031616 | Bacteria | 73425 |
| 405 | Ga0307508_10025639 | 3300031616 | Bacteria | 5342 |
| 406 | Ga0307508_10350083 | 3300031616 | Bacteria | 1069 |
| 407 | Ga0307514_10023006 | 3300031649 | Bacteria | 5059 |
| 408 | Ga0307514_10080658 | 3300031649 | Bacteria | 2407 |
| 409 | Ga0307516_10001561 | 3300031730 | Bacteria | 31504 |
| 410 | Ga0307516_10002583 | 3300031730 | Bacteria | 24044 |
| 411 | Ga0307516_10044992 | 3300031730 | Bacteria | 4363 |
| 412 | Ga0307516_10075203 | 3300031730 | Bacteria | 3232 |
| 413 | Ga0307516_10445659 | 3300031730 | Bacteria | 951 |
| 414 | Ga0307516_10597004 | 3300031730 | Bacteria | 758 |
| 415 | Ga0307406_10058574 | 3300031901 | Bacteria | 2476 |
| 416 | Ga0307412_11288395 | 3300031911 | Bacteria | 657 |
| 417 | Ga0307414_10154051 | 3300032004 | Bacteria | 1817 |
| 418 | Ga0307414_11696264 | 3300032004 | Bacteria | 589 |
| 419 | Ga0307411_11079297 | 3300032005 | Bacteria | 723 |
| 420 | Ga0316593_10039952 | 3300032168 | Bacteria | 1558 |
| 421 | Ga0307507_10172037 | 3300033179 | Bacteria | 1571 |
| 422 | Ga0307510_10394286 | 3300033180 | Bacteria | 828 |
| 423 | Ga0373938_0018338 | 3300034957 | Bacteria | 1387 |
| 424 | Ga0373940_0138048 | 3300035088 | Bacteria | 769 |
| 425 | Ga0373945_0026066 | 3300035116 | Bacteria | 2035 |
| 426 | Ga0373953_0261981 | 3300035117 | Bacteria | 752 |
| 427 | Ga0373943_0338526 | 3300035170 | Bacteria | 860 |
| 428 | Ga0373927_0000732 | 3300035695 | Bacteria | 25058 |
| 429 | Ga0373947_0222831 | 3300035725 | Bacteria | 1240 |
| 430 | Ga0373937_0103288 | 3300036401 | Bacteria | 2647 |
| 431 | Ga0316582_0108050 | 3300036647 | Bacteria | 1849 |
| 432 | Ga0316582_0207049 | 3300036647 | Bacteria | 1339 |
| 433 | Ga0316584_0294569 | 3300036712 | Bacteria | 1176 |
| 434 | Ga0316584_0347375 | 3300036712 | Bacteria | 1066 |
| 435 | Ga0373925_0000039 | 3300037068 | Bacteria | 138537 |
| 436 | Ga0373925_0004687 | 3300037068 | Bacteria | 10318 |
| 437 | Ga0373925_1272001 | 3300037068 | Bacteria | 604 |
| 438 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 439 | Ga0395900_0129947 | 3300037418 | Bacteria | 2582 |
| 440 | Ga0395905_0000172 | 3300037471 | Bacteria | 105228 |
| 441 | Ga0395905_0233538 | 3300037471 | Bacteria | 1719 |
| 442 | Ga0395905_0517028 | 3300037471 | Bacteria | 1094 |
| 443 | Ga0237819_10957 | 3300038705 | Bacteria | 1166 |
| 444 | Ga0237816_03719 | 3300039145 | Bacteria | 1098 |
| 445 | Ga0436361_0042216 | 3300039447 | Bacteria | 6380 |
| 446 | Ga0436361_0511852 | 3300039447 | Bacteria | 4509 |
| 447 | Ga0436361_0567912 | 3300039447 | Bacteria | 1106 |
| 448 | Ga0436361_0633280 | 3300039447 | Bacteria | 103480 |
| 449 | Ga0436361_0661766 | 3300039447 | Bacteria | 37529 |
| 450 | Ga0436361_0692684 | 3300039447 | Bacteria | 133303 |
| 451 | Ga0436361_0874346 | 3300039447 | Bacteria | 6661 |
| 452 | Ga0436361_0892385 | 3300039447 | Bacteria | 12235 |
| 453 | Ga0436361_0943694 | 3300039447 | Bacteria | 119574 |
| 454 | Ga0436361_0973074 | 3300039447 | Bacteria | 1837 |
| 455 | Ga0436361_1008726 | 3300039447 | Bacteria | 1685 |
| 456 | Ga0451789_0772919 | 3300041443 | Bacteria | 2283 |
| 457 | Ga0451791_1786793 | 3300041451 | Bacteria | 1076 |
| 458 | Ga0451793_1319808 | 3300041452 | Bacteria | 1432 |
| 459 | Ga0451797_0349248 | 3300041453 | Bacteria | 675 |
| 460 | Ga0451797_0494721 | 3300041453 | Bacteria | 529 |
| 461 | Ga0451797_0636430 | 3300041453 | Bacteria | 893 |
| 462 | Ga0451795_0259599 | 3300041456 | Bacteria | 716 |
| 463 | Ga0451795_0766554 | 3300041456 | Bacteria | 1963 |
| 464 | Ga0451800_0252204 | 3300041459 | Bacteria | 2246 |
| 465 | Ga0451800_1634667 | 3300041459 | Bacteria | 1967 |
| 466 | Ga0451807_2396062 | 3300041486 | Bacteria | 551 |
| 467 | Ga0451837_0656693 | 3300041494 | Bacteria | 717 |
| 468 | Ga0451841_1304204 | 3300041498 | Bacteria | 1217 |
| 469 | Ga0451851_0101857 | 3300041507 | Bacteria | 545 |
| 470 | Ga0451843_0764763 | 3300041509 | Bacteria | 674 |
| 471 | Ga0451855_0947765 | 3300041511 | Bacteria | 1493 |
| 472 | Ga0451853_0482874 | 3300041512 | Bacteria | 848 |
| 473 | Ga0451853_1144964 | 3300041512 | Bacteria | 1810 |
| 474 | Ga0439431_0005195 | 3300041997 | Bacteria | 2869 |
| 475 | Ga0450919_000139 | 3300042121 | Bacteria | 7504 |
| 476 | Ga0450888_002426 | 3300042126 | Bacteria | 1842 |
| 477 | Ga0439458_0006248 | 3300042157 | Bacteria | 2658 |
| 478 | Ga0450918_005133 | 3300042531 | Bacteria | 2358 |
| 479 | Ga0451577_0018787 | 3300042876 | Bacteria | 6359 |
| 480 | Ga0451577_0022716 | 3300042876 | Bacteria | 5727 |
| 481 | Ga0451577_0086132 | 3300042876 | Bacteria | 2803 |
| 482 | Ga0451577_0201049 | 3300042876 | Bacteria | 1799 |
| 483 | Ga0451577_0631265 | 3300042876 | Bacteria | 972 |
| 484 | Ga0466969_0003620 | 3300044656 | Bacteria | 8226 |
| 485 | Ga0466972_0110957 | 3300044658 | Bacteria | 1296 |
| 486 | Ga0453683_0944648 | 3300044673 | Bacteria | 571 |
| 487 | Ga0466965_0435424 | 3300044683 | Bacteria | 728 |
| 488 | Ga0466966_0002874 | 3300044684 | Bacteria | 11339 |
| 489 | Ga0466966_0134468 | 3300044684 | Bacteria | 1513 |
| 490 | Ga0466966_0335687 | 3300044684 | Bacteria | 908 |
| 491 | Ga0466961_0003361 | 3300044693 | Bacteria | 9986 |
| 492 | Ga0466963_0194542 | 3300044694 | Bacteria | 1417 |
| 493 | Ga0453684_0297230 | 3300044712 | Bacteria | 1836 |
| 494 | Ga0453684_0412049 | 3300044712 | Bacteria | 1511 |
| 495 | Ga0453684_0640441 | 3300044712 | Bacteria | 1161 |
| 496 | Ga0466971_0000586 | 3300044719 | Bacteria | 14390 |
| 497 | Ga0466970_0013079 | 3300044765 | Bacteria | 4252 |
| 498 | Ga0466970_0080053 | 3300044765 | Bacteria | 1765 |
| 499 | Ga0466957_0004597 | 3300044842 | Bacteria | 7714 |
| 500 | Ga0466960_0137794 | 3300044901 | Bacteria | 1293 |
| 501 | Ga0466959_0000060 | 3300045049 | Bacteria | 76590 |
| 502 | Ga0466959_0651449 | 3300045049 | Bacteria | 707 |
| 503 | Ga0451576_0072763 | 3300045051 | Bacteria | 3576 |
| 504 | Ga0451576_0275135 | 3300045051 | Bacteria | 1760 |
| 505 | Ga0466958_0001428 | 3300045836 | Bacteria | 11321 |
| 506 | Ga0495590_0054938 | 3300046457 | Bacteria | 1391 |
| 507 | Ga0495638_0174869 | 3300046460 | Bacteria | 1229 |
| 508 | Ga0495650_0003992 | 3300046471 | Bacteria | 10361 |
| 509 | Ga0495605_0082631 | 3300046474 | Bacteria | 1500 |
| 510 | Ga0495606_0433630 | 3300046507 | Bacteria | 677 |
| 511 | Ga0495610_0011872 | 3300046512 | Bacteria | 5291 |
| 512 | Ga0495610_0063215 | 3300046512 | Bacteria | 1754 |
| 513 | Ga0495616_0214048 | 3300046513 | Bacteria | 842 |
| 514 | Ga0495620_0314476 | 3300046515 | Bacteria | 595 |
| 515 | Ga0495628_0355406 | 3300046516 | Bacteria | 1076 |
| 516 | Ga0495630_0858381 | 3300046517 | Bacteria | 692 |
| 517 | Ga0495632_0008169 | 3300046519 | Bacteria | 6466 |
| 518 | Ga0495632_0010554 | 3300046519 | Bacteria | 5455 |
| 519 | Ga0495637_0139927 | 3300046520 | Bacteria | 919 |
| 520 | Ga0495643_0008013 | 3300046522 | Bacteria | 6735 |
| 521 | Ga0495643_0125809 | 3300046522 | Bacteria | 1291 |
| 522 | Ga0495642_0078054 | 3300046528 | Bacteria | 1391 |
| 523 | Ga0495642_0217410 | 3300046528 | Bacteria | 834 |
| 524 | Ga0495652_0447252 | 3300046529 | Bacteria | 905 |
| 525 | Ga0495654_0152004 | 3300046530 | Bacteria | 1023 |
| 526 | Ga0495586_0420340 | 3300046535 | Bacteria | 770 |
| 527 | Ga0495598_0011607 | 3300046537 | Bacteria | 2141 |
| 528 | Ga0495621_0005161 | 3300046539 | Bacteria | 3734 |
| 529 | Ga0495597_0004699 | 3300046542 | Bacteria | 7409 |
| 530 | Ga0495597_0057252 | 3300046542 | Bacteria | 1706 |
| 531 | Ga0495597_0297325 | 3300046542 | Bacteria | 627 |
| 532 | Ga0495645_0249612 | 3300046543 | Bacteria | 1180 |
| 533 | Ga0495668_0103975 | 3300046616 | Bacteria | 1554 |
| 534 | Ga0495611_0013778 | 3300046648 | Bacteria | 3447 |
| 535 | Ga0495625_0008189 | 3300046660 | Bacteria | 8949 |
| 536 | Ga0495625_0012918 | 3300046660 | Bacteria | 6742 |
| 537 | Ga0495625_0155573 | 3300046660 | Bacteria | 1534 |
| 538 | Ga0495658_0109631 | 3300046683 | Bacteria | 1658 |
| 539 | Ga0495658_0311035 | 3300046683 | Bacteria | 997 |
| 540 | Ga0495658_0383963 | 3300046683 | Bacteria | 894 |
| 541 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 542 | Ga0495669_0035082 | 3300046684 | Bacteria | 2214 |
| 543 | Ga0495669_0484695 | 3300046684 | Bacteria | 601 |
| 544 | Ga0495671_0085257 | 3300046692 | Bacteria | 1548 |
| 545 | Ga0495671_0311793 | 3300046692 | Bacteria | 756 |
| 546 | Ga0495649_0004058 | 3300046694 | Bacteria | 9640 |
| 547 | Ga0495660_0377967 | 3300046810 | Bacteria | 625 |
| 548 | Ga0495687_001087 | 3300047443 | Bacteria | 26673 |
| 549 | Ga0495687_033644 | 3300047443 | Bacteria | 2322 |
| 550 | Ga0495677_0117681 | 3300047445 | Bacteria | 1012 |
| 551 | Ga0495673_0091223 | 3300047469 | Bacteria | 1245 |
| 552 | Ga0495686_0000902 | 3300047472 | Bacteria | 37377 |
| 553 | Ga0496100_0029766 | 3300048903 | Bacteria | 3381 |
| 554 | Ga0496101_0101156 | 3300048904 | Bacteria | 2158 |
| 555 | Ga0496101_0577309 | 3300048904 | Bacteria | 889 |
| 556 | Ga0496102_0001780 | 3300048905 | Bacteria | 18690 |
| 557 | Ga0496102_0024399 | 3300048905 | Bacteria | 5376 |
| 558 | Ga0496102_0060433 | 3300048905 | Bacteria | 3466 |
| 559 | Ga0496103_0820791 | 3300048906 | Bacteria | 586 |
| 560 | Ga0496104_0236210 | 3300048907 | Bacteria | 1740 |
| 561 | Ga0496106_0079932 | 3300048909 | Bacteria | 2510 |
| 562 | Ga0496108_0009257 | 3300048911 | Bacteria | 7968 |
| 563 | Ga0496109_0048685 | 3300048912 | Bacteria | 3856 |
| 564 | Ga0496109_0603948 | 3300048912 | Bacteria | 1033 |
| 565 | Ga0496109_0887995 | 3300048912 | Bacteria | 829 |
| 566 | Ga0496109_0951750 | 3300048912 | Bacteria | 797 |
| 567 | Ga0496110_0186247 | 3300048913 | Bacteria | 1885 |
| 568 | Ga0496112_0186065 | 3300048915 | Bacteria | 2040 |
| 569 | Ga0496112_0262013 | 3300048915 | Bacteria | 1678 |
| 570 | Ga0496113_0198381 | 3300048916 | Bacteria | 1595 |
| 571 | Ga0496114_0030428 | 3300048917 | Bacteria | 4442 |
| 572 | Ga0496114_0185745 | 3300048917 | Bacteria | 1817 |
| 573 | Ga0496115_0000607 | 3300048918 | Bacteria | 27313 |
| 574 | Ga0496115_0007666 | 3300048918 | Bacteria | 7955 |
| 575 | Ga0496117_0050014 | 3300048920 | Bacteria | 2967 |
| 576 | Ga0496121_0023861 | 3300048924 | Bacteria | 5870 |
| 577 | Ga0496121_0777371 | 3300048924 | Bacteria | 566 |
| 578 | Ga0496122_0083737 | 3300048925 | Bacteria | 2209 |
| 579 | Ga0496123_0059398 | 3300048926 | Bacteria | 2472 |
| 580 | Ga0496124_0000079 | 3300048927 | Bacteria | 212057 |
| 581 | Ga0496124_0196604 | 3300048927 | Bacteria | 1538 |
| 582 | Ga0496125_0003021 | 3300048928 | Bacteria | 21042 |
| 583 | Ga0496125_0547291 | 3300048928 | Bacteria | 642 |
| 584 | Ga0496125_0661057 | 3300048928 | Bacteria | 561 |
| 585 | Ga0496126_0026814 | 3300048929 | Bacteria | 5517 |
| 586 | Ga0496126_0971145 | 3300048929 | Bacteria | 639 |
| 587 | Ga0501323_010732 | 3300049539 | Bacteria | 1096 |
| 588 | Ga0501033_0565430 | 3300049570 | Bacteria | 782 |
| 589 | Ga0501034_0157847 | 3300049571 | Bacteria | 2241 |
| 590 | Ga0501034_0246624 | 3300049571 | Bacteria | 1731 |
| 591 | Ga0501036_0933882 | 3300049572 | Bacteria | 711 |
| 592 | Ga0501036_1120963 | 3300049572 | Bacteria | 642 |
| 593 | Ga0501037_0075842 | 3300049573 | Bacteria | 2442 |
| 594 | Ga0501037_0280206 | 3300049573 | Bacteria | 1162 |
| 595 | Ga0501038_0129680 | 3300049574 | Bacteria | 2072 |
| 596 | Ga0501043_0000108 | 3300049579 | Bacteria | 77329 |
| 597 | Ga0501043_0115490 | 3300049579 | Bacteria | 2107 |
| 598 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 599 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 600 | Ga0501047_0004960 | 3300049581 | Bacteria | 12498 |
| 601 | Ga0501048_0000521 | 3300049582 | Bacteria | 27029 |
| 602 | Ga0501067_0011183 | 3300049583 | Bacteria | 4965 |
| 603 | Ga0501068_0271218 | 3300049584 | Bacteria | 1083 |
| 604 | Ga0501069_0187855 | 3300049585 | Bacteria | 1195 |
| 605 | Ga0501070_0714208 | 3300049586 | Bacteria | 792 |
| 606 | Ga0501071_0810304 | 3300049587 | Bacteria | 722 |
| 607 | Ga0501072_0003168 | 3300049588 | Bacteria | 12380 |
| 608 | Ga0501072_0098114 | 3300049588 | Bacteria | 2329 |
| 609 | Ga0501073_0013100 | 3300049589 | Bacteria | 6046 |
| 610 | Ga0501074_0049878 | 3300049590 | Bacteria | 3022 |
| 611 | Ga0501075_0219277 | 3300049591 | Bacteria | 1451 |
| 612 | Ga0501076_0677045 | 3300049592 | Bacteria | 851 |
| 613 | Ga0501077_0103399 | 3300049593 | Bacteria | 1805 |
| 614 | Ga0501198_000030 | 3300049649 | Bacteria | 59540 |
| 615 | Ga0501222_000047 | 3300049662 | Bacteria | 44574 |
| 616 | Ga0501079_0027856 | 3300049741 | Bacteria | 4334 |
| 617 | Ga0501079_0238683 | 3300049741 | Bacteria | 1420 |
| 618 | Ga0501080_0147968 | 3300049742 | Bacteria | 2171 |
| 619 | Ga0501081_0439574 | 3300049743 | Bacteria | 968 |
| 620 | Ga0501035_0005859 | 3300049822 | Bacteria | 11581 |
| 621 | Ga0501035_0211004 | 3300049822 | Bacteria | 1661 |
| 622 | Ga0501044_0582085 | 3300049823 | Bacteria | 1014 |
| 623 | Ga0501045_0315337 | 3300049824 | Bacteria | 1163 |
| 624 | Ga0501045_0610643 | 3300049824 | Bacteria | 807 |
| 625 | nmdc:mga03683_12840_c1 | 3300050489 | Bacteria | 3069 |
| 626 | nmdc:mga03n38_846963_c1 | 3300050490 | Bacteria | 535 |
| 627 | nmdc:mga00v17_117998_c1 | 3300050491 | Bacteria | 1688 |
| 628 | nmdc:mga0yw44_280599_c1 | 3300050492 | Bacteria | 1113 |
| 629 | nmdc:mga0k408_270946_c1 | 3300050493 | Bacteria | 1014 |
| 630 | nmdc:mga0k408_3090_c1 | 3300050493 | Bacteria | 8816 |
| 631 | nmdc:mga0k408_311471_c1 | 3300050493 | Bacteria | 940 |
| 632 | nmdc:mga0k408_39231_c1 | 3300050493 | Bacteria | 2720 |
| 633 | nmdc:mga0k408_417_c2 | 3300050493 | Bacteria | 21558 |
| 634 | nmdc:mga0k408_725_c1 | 3300050493 | Bacteria | 18088 |
| 635 | nmdc:mga06z11_142899_c1 | 3300050494 | Bacteria | 1354 |
| 636 | nmdc:mga06z11_390529_c1 | 3300050494 | Bacteria | 837 |
| 637 | nmdc:mga06z11_449297_c1 | 3300050494 | Bacteria | 779 |
| 638 | nmdc:mga04h51_130520_c1 | 3300050495 | Bacteria | 944 |
| 639 | nmdc:mga04h51_41706_c1 | 3300050495 | Bacteria | 1501 |
| 640 | nmdc:mga04h51_69857_c1 | 3300050495 | Bacteria | 1224 |
| 641 | nmdc:mga07m45_160_c1 | 3300050496 | Bacteria | 27032 |
| 642 | nmdc:mga07m45_191726_c1 | 3300050496 | Bacteria | 1189 |
| 643 | nmdc:mga07m45_196949_c1 | 3300050496 | Bacteria | 1172 |
| 644 | nmdc:mga07m45_43396_c1 | 3300050496 | Bacteria | 2521 |
| 645 | nmdc:mga07m45_6211_c1 | 3300050496 | Bacteria | 6030 |
| 646 | nmdc:mga07m45_7544_c1 | 3300050496 | Bacteria | 5564 |
| 647 | nmdc:mga07m45_9764_c1 | 3300050496 | Bacteria | 4992 |
| 648 | nmdc:mga05p37_64684_c1 | 3300050507 | Bacteria | 4500 |
| 649 | nmdc:mga0qj67_70852_c1 | 3300050509 | Bacteria | 2781 |
| 650 | nmdc:mga06r32_351191_c1 | 3300050510 | Bacteria | 1459 |
| 651 | nmdc:mga06r32_571990_c1 | 3300050510 | Bacteria | 1103 |
| 652 | nmdc:mga08y16_751343_c1 | 3300050511 | Bacteria | 971 |
| 653 | nmdc:mga0sz30_17553_c1 | 3300050516 | Bacteria | 2855 |
| 654 | Ga0500635_0001608 | 3300053080 | Bacteria | 5440 |
| 655 | Ga0495655_0059358 | 3300053083 | Bacteria | 1039 |
| 656 | Ga0500578_0000537 | 3300053086 | Bacteria | 46023 |
| 657 | Ga0500578_0056046 | 3300053086 | Bacteria | 2521 |
| 658 | Ga0500644_0004699 | 3300053088 | Bacteria | 3427 |
| 659 | Ga0500647_0003051 | 3300053091 | Bacteria | 6424 |
| 660 | Ga0500583_0288271 | 3300053092 | Bacteria | 805 |
| 661 | Ga0500651_0396466 | 3300053093 | Bacteria | 776 |
| 662 | Ga0500572_028022 | 3300053111 | Bacteria | 1547 |
| 663 | Ga0500593_000152 | 3300053117 | Bacteria | 27719 |
| 664 | Ga0500597_064178 | 3300053120 | Bacteria | 1581 |
| 665 | Ga0500607_056281 | 3300053121 | Bacteria | 2077 |
| 666 | Ga0500642_0002803 | 3300053130 | Bacteria | 5170 |
| 667 | Ga0500652_000361 | 3300053131 | Bacteria | 16332 |
| 668 | Ga0500655_003842 | 3300053133 | Bacteria | 2712 |
| 669 | Ga0500658_0010005 | 3300053134 | Bacteria | 3499 |
| 670 | Ga0500658_0156803 | 3300053134 | Bacteria | 1029 |
| 671 | Ga0500559_0053830 | 3300053136 | Bacteria | 1782 |
| 672 | Ga0500559_0103509 | 3300053136 | Bacteria | 1314 |
| 673 | Ga0500561_0019926 | 3300053137 | Bacteria | 1561 |
| 674 | Ga0500561_0038360 | 3300053137 | Bacteria | 1251 |
| 675 | Ga0500561_0041435 | 3300053137 | Bacteria | 1218 |
| 676 | Ga0500568_0011426 | 3300053139 | Bacteria | 4122 |
| 677 | Ga0500568_0014287 | 3300053139 | Bacteria | 3590 |
| 678 | Ga0500577_0051585 | 3300053142 | Bacteria | 1547 |
| 679 | Ga0500579_203344 | 3300053143 | Bacteria | 727 |
| 680 | Ga0500589_194371 | 3300053147 | Bacteria | 785 |
| 681 | Ga0500603_081034 | 3300053150 | Bacteria | 940 |
| 682 | Ga0500616_0080640 | 3300053153 | Bacteria | 1636 |
| 683 | Ga0500616_0173273 | 3300053153 | Bacteria | 978 |
| 684 | Ga0500619_000004 | 3300053154 | Bacteria | 98915 |
| 685 | Ga0500619_246664 | 3300053154 | Bacteria | 589 |
| 686 | Ga0500622_0000423 | 3300053156 | Bacteria | 40034 |
| 687 | Ga0500633_0186565 | 3300053160 | Bacteria | 777 |
| 688 | Ga0500636_0004555 | 3300053177 | Bacteria | 7860 |
| 689 | Ga0500636_0135965 | 3300053177 | Bacteria | 1365 |
| 690 | Ga0500570_045471 | 3300053724 | Bacteria | 2256 |
| 691 | Ga0500570_048548 | 3300053724 | Bacteria | 2157 |
| 692 | Ga0500584_134496 | 3300053726 | Bacteria | 955 |
| 693 | Ga0500645_002532 | 3300053730 | Bacteria | 8063 |
| 694 | Ga0500587_012252 | 3300053739 | Bacteria | 1081 |
| 695 | Ga0501084_0164674 | 3300054114 | Bacteria | 1871 |
| 696 | Ga0590071_001450 | 3300059421 | Bacteria | 6254 |
| 697 | Ga0590074_043912 | 3300059423 | Bacteria | 808 |
| 698 | Ga0501082_0329576 | 3300060353 | Bacteria | 1330 |
| 699 | Ga0501082_1078697 | 3300060353 | Bacteria | 702 |
| 700 | Ga0466962_0001058 | 3300061719 | Bacteria | 12635 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_101486232 | Ga0070660_1014862321 | 124 |
| 2 | 3300005548 | Ga0070665_100997449 | Ga0070665_1009974492 | 133 |
| 3 | 3300039447 | Ga0436361_0511852 | Ga0436361_0511852_3853_4278 | 133 |
| 4 | 3300026089 | Ga0207648_11376382 | Ga0207648_113763821 | 134 |
| 5 | 3300026121 | Ga0207683_10337638 | Ga0207683_103376382 | 134 |
| 6 | iso_pu_bacteria | 2894817345 | 2894819772 | 134 |
| 7 | iso_pu_bacteria | 2643221598 | 2644000050 | 136 |
| 8 | 3300037068 | Ga0373925_1272001 | Ga0373925_1272001_50_532 | 137 |
| 9 | 3300037471 | Ga0395905_0233538 | Ga0395905_0233538_909_1373 | 137 |
| 10 | iso_pu_bacteria | 2837651117 | 2837652698 | 137 |
| 11 | 3300005543 | Ga0070672_100425536 | Ga0070672_1004255362 | 138 |
| 12 | 3300005842 | Ga0068858_100321144 | Ga0068858_1003211443 | 138 |
| 13 | 3300025940 | Ga0207691_10664794 | Ga0207691_106647942 | 138 |
| 14 | 3300026035 | Ga0207703_10549307 | Ga0207703_105493072 | 138 |
| 15 | 3300041494 | Ga0451837_0656693 | Ga0451837_0656693_44_499 | 138 |
| 16 | 3300049581 | Ga0501047_0004960 | Ga0501047_0004960_7444_7884 | 138 |
| 17 | 3300049583 | Ga0501067_0011183 | Ga0501067_0011183_1637_2077 | 138 |
| 18 | 3300049588 | Ga0501072_0003168 | Ga0501072_0003168_7244_7684 | 138 |
| 19 | 3300049589 | Ga0501073_0013100 | Ga0501073_0013100_1579_2019 | 138 |
| 20 | 3300049590 | Ga0501074_0049878 | Ga0501074_0049878_1401_1841 | 138 |
| 21 | 3300049741 | Ga0501079_0027856 | Ga0501079_0027856_3264_3704 | 138 |
| 22 | 3300049742 | Ga0501080_0147968 | Ga0501080_0147968_1247_1687 | 138 |
| 23 | 3300053136 | Ga0500559_0053830 | Ga0500559_0053830_1001_1459 | 138 |
| 24 | 3300054114 | Ga0501084_0164674 | Ga0501084_0164674_339_779 | 138 |
| 25 | 3300060353 | Ga0501082_1078697 | Ga0501082_1078697_83_523 | 138 |
| 26 | 3300005338 | Ga0068868_100586243 | Ga0068868_1005862432 | 139 |
| 27 | 3300021361 | Ga0213872_10024668 | Ga0213872_100246682 | 139 |
| 28 | 3300021361 | Ga0213872_10220729 | Ga0213872_102207291 | 139 |
| 29 | 3300026023 | Ga0207677_10666274 | Ga0207677_106662741 | 139 |
| 30 | 3300035088 | Ga0373940_0138048 | Ga0373940_0138048_153_614 | 139 |
| 31 | 3300037312 | Ga0395899_0000013 | Ga0395899_0000013_360350_360793 | 139 |
| 32 | 3300039447 | Ga0436361_0567912 | Ga0436361_0567912_56_499 | 139 |
| 33 | 3300039447 | Ga0436361_0973074 | Ga0436361_0973074_1288_1731 | 139 |
| 34 | 3300039447 | Ga0436361_1008726 | Ga0436361_1008726_494_937 | 139 |
| 35 | 3300044683 | Ga0466965_0435424 | Ga0466965_0435424_100_543 | 139 |
| 36 | 3300044684 | Ga0466966_0134468 | Ga0466966_0134468_831_1274 | 139 |
| 37 | 3300044684 | Ga0466966_0335687 | Ga0466966_0335687_12_455 | 139 |
| 38 | 3300045051 | Ga0451576_0275135 | Ga0451576_0275135_177_638 | 139 |
| 39 | 3300046684 | Ga0495669_0035082 | Ga0495669_0035082_1093_1554 | 139 |
| 40 | 3300049572 | Ga0501036_1120963 | Ga0501036_1120963_42_500 | 139 |
| 41 | 3300049573 | Ga0501037_0280206 | Ga0501037_0280206_594_1052 | 139 |
| 42 | 3300049584 | Ga0501068_0271218 | Ga0501068_0271218_614_1072 | 139 |
| 43 | 3300049585 | Ga0501069_0187855 | Ga0501069_0187855_705_1163 | 139 |
| 44 | 3300049586 | Ga0501070_0714208 | Ga0501070_0714208_204_662 | 139 |
| 45 | 3300049587 | Ga0501071_0810304 | Ga0501071_0810304_99_557 | 139 |
| 46 | 3300049588 | Ga0501072_0098114 | Ga0501072_0098114_821_1279 | 139 |
| 47 | 3300049591 | Ga0501075_0219277 | Ga0501075_0219277_93_551 | 139 |
| 48 | 3300049592 | Ga0501076_0677045 | Ga0501076_0677045_302_760 | 139 |
| 49 | 3300049593 | Ga0501077_0103399 | Ga0501077_0103399_1063_1521 | 139 |
| 50 | 3300049741 | Ga0501079_0238683 | Ga0501079_0238683_657_1115 | 139 |
| 51 | 3300049743 | Ga0501081_0439574 | Ga0501081_0439574_131_589 | 139 |
| 52 | 3300049824 | Ga0501045_0610643 | Ga0501045_0610643_321_779 | 139 |
| 53 | 3300060353 | Ga0501082_0329576 | Ga0501082_0329576_657_1115 | 139 |
| 54 | 3300005327 | Ga0070658_10117742 | Ga0070658_101177424 | 140 |
| 55 | 3300005327 | Ga0070658_10329543 | Ga0070658_103295432 | 140 |
| 56 | 3300005327 | Ga0070658_10535863 | Ga0070658_105358631 | 140 |
| 57 | 3300005336 | Ga0070680_100016657 | Ga0070680_1000166575 | 140 |
| 58 | 3300005336 | Ga0070680_100117530 | Ga0070680_1001175304 | 140 |
| 59 | 3300005344 | Ga0070661_100299687 | Ga0070661_1002996872 | 140 |
| 60 | 3300005355 | Ga0070671_100099089 | Ga0070671_1000990892 | 140 |
| 61 | 3300005364 | Ga0070673_100029285 | Ga0070673_1000292855 | 140 |
| 62 | 3300005366 | Ga0070659_100015408 | Ga0070659_1000154086 | 140 |
| 63 | 3300005366 | Ga0070659_101279782 | Ga0070659_1012797821 | 140 |
| 64 | 3300005367 | Ga0070667_100331610 | Ga0070667_1003316102 | 140 |
| 65 | 3300005456 | Ga0070678_100102871 | Ga0070678_1001028712 | 140 |
| 66 | 3300005457 | Ga0070662_100081290 | Ga0070662_1000812902 | 140 |
| 67 | 3300005458 | Ga0070681_10054252 | Ga0070681_100542523 | 140 |
| 68 | 3300005458 | Ga0070681_10063126 | Ga0070681_100631263 | 140 |
| 69 | 3300005530 | Ga0070679_100013942 | Ga0070679_1000139424 | 140 |
| 70 | 3300005539 | Ga0068853_100029981 | Ga0068853_1000299814 | 140 |
| 71 | 3300005539 | Ga0068853_100095928 | Ga0068853_1000959282 | 140 |
| 72 | 3300005539 | Ga0068853_100815956 | Ga0068853_1008159561 | 140 |
| 73 | 3300005548 | Ga0070665_100000327 | Ga0070665_10000032751 | 140 |
| 74 | 3300005563 | Ga0068855_100116069 | Ga0068855_1001160694 | 140 |
| 75 | 3300005577 | Ga0068857_101093259 | Ga0068857_1010932592 | 140 |
| 76 | 3300005618 | Ga0068864_100184243 | Ga0068864_1001842432 | 140 |
| 77 | 3300005844 | Ga0068862_100041852 | Ga0068862_1000418521 | 140 |
| 78 | 3300006028 | Ga0070717_10235061 | Ga0070717_102350611 | 140 |
| 79 | 3300009093 | Ga0105240_10012992 | Ga0105240_100129929 | 140 |
| 80 | 3300009093 | Ga0105240_10018555 | Ga0105240_1001855510 | 140 |
| 81 | 3300009093 | Ga0105240_10050283 | Ga0105240_100502836 | 140 |
| 82 | 3300009093 | Ga0105240_10263605 | Ga0105240_102636053 | 140 |
| 83 | 3300009093 | Ga0105240_11641934 | Ga0105240_116419342 | 140 |
| 84 | 3300009098 | Ga0105245_10019471 | Ga0105245_100194716 | 140 |
| 85 | 3300009177 | Ga0105248_10015263 | Ga0105248_100152637 | 140 |
| 86 | 3300009545 | Ga0105237_12115687 | Ga0105237_121156871 | 140 |
| 87 | 3300009551 | Ga0105238_10021552 | Ga0105238_100215524 | 140 |
| 88 | 3300009551 | Ga0105238_10044939 | Ga0105238_100449394 | 140 |
| 89 | 3300010375 | Ga0105239_10216562 | Ga0105239_102165622 | 140 |
| 90 | 3300013104 | Ga0157370_10407612 | Ga0157370_104076122 | 140 |
| 91 | 3300013104 | Ga0157370_10538377 | Ga0157370_105383772 | 140 |
| 92 | 3300013105 | Ga0157369_10740205 | Ga0157369_107402052 | 140 |
| 93 | 3300013296 | Ga0157374_12150638 | Ga0157374_121506381 | 140 |
| 94 | 3300013297 | Ga0157378_10261888 | Ga0157378_102618882 | 140 |
| 95 | 3300013308 | Ga0157375_10095126 | Ga0157375_100951263 | 140 |
| 96 | 3300014325 | Ga0163163_10171221 | Ga0163163_101712213 | 140 |
| 97 | 3300014968 | Ga0157379_10467459 | Ga0157379_104674592 | 140 |
| 98 | 3300025903 | Ga0207680_10221406 | Ga0207680_102214062 | 140 |
| 99 | 3300025909 | Ga0207705_10001301 | Ga0207705_1000130125 | 140 |
| 100 | 3300025909 | Ga0207705_10284910 | Ga0207705_102849102 | 140 |
| 101 | 3300025912 | Ga0207707_10044666 | Ga0207707_100446663 | 140 |
| 102 | 3300025912 | Ga0207707_10061291 | Ga0207707_100612911 | 140 |
| 103 | 3300025913 | Ga0207695_10000728 | Ga0207695_1000072821 | 140 |
| 104 | 3300025913 | Ga0207695_10002551 | Ga0207695_1000255123 | 140 |
| 105 | 3300025913 | Ga0207695_10014064 | Ga0207695_100140649 | 140 |
| 106 | 3300025913 | Ga0207695_10017230 | Ga0207695_100172304 | 140 |
| 107 | 3300025917 | Ga0207660_10032401 | Ga0207660_100324013 | 140 |
| 108 | 3300025917 | Ga0207660_10084746 | Ga0207660_100847464 | 140 |
| 109 | 3300025919 | Ga0207657_10004872 | Ga0207657_100048729 | 140 |
| 110 | 3300025919 | Ga0207657_10058952 | Ga0207657_100589522 | 140 |
| 111 | 3300025919 | Ga0207657_10433400 | Ga0207657_104334001 | 140 |
| 112 | 3300025921 | Ga0207652_10014009 | Ga0207652_100140096 | 140 |
| 113 | 3300025921 | Ga0207652_10723290 | Ga0207652_107232902 | 140 |
| 114 | 3300025923 | Ga0207681_10340000 | Ga0207681_103400002 | 140 |
| 115 | 3300025924 | Ga0207694_10017119 | Ga0207694_100171195 | 140 |
| 116 | 3300025924 | Ga0207694_10046881 | Ga0207694_100468814 | 140 |
| 117 | 3300025925 | Ga0207650_10194608 | Ga0207650_101946083 | 140 |
| 118 | 3300025932 | Ga0207690_10000294 | Ga0207690_1000029428 | 140 |
| 119 | 3300025941 | Ga0207711_10001005 | Ga0207711_1000100510 | 140 |
| 120 | 3300025941 | Ga0207711_11109109 | Ga0207711_111091092 | 140 |
| 121 | 3300025949 | Ga0207667_10006530 | Ga0207667_100065306 | 140 |
| 122 | 3300025949 | Ga0207667_10019379 | Ga0207667_100193795 | 140 |
| 123 | 3300025960 | Ga0207651_10034339 | Ga0207651_100343393 | 140 |
| 124 | 3300025986 | Ga0207658_10320768 | Ga0207658_103207682 | 140 |
| 125 | 3300026041 | Ga0207639_10079911 | Ga0207639_100799113 | 140 |
| 126 | 3300026041 | Ga0207639_10086256 | Ga0207639_100862563 | 140 |
| 127 | 3300026041 | Ga0207639_10651837 | Ga0207639_106518372 | 140 |
| 128 | 3300026041 | Ga0207639_10690553 | Ga0207639_106905532 | 140 |
| 129 | 3300026088 | Ga0207641_10041181 | Ga0207641_100411814 | 140 |
| 130 | 3300026121 | Ga0207683_10259656 | Ga0207683_102596562 | 140 |
| 131 | 3300026142 | Ga0207698_10315229 | Ga0207698_103152292 | 140 |
| 132 | 3300028379 | Ga0268266_10000064 | Ga0268266_1000006457 | 140 |
| 133 | 3300028800 | Ga0265338_10611835 | Ga0265338_106118352 | 140 |
| 134 | 3300031247 | Ga0265340_10023067 | Ga0265340_100230674 | 140 |
| 135 | 3300031616 | Ga0307508_10350083 | Ga0307508_103500832 | 140 |
| 136 | 3300032168 | Ga0316593_10039952 | Ga0316593_100399523 | 140 |
| 137 | 3300035116 | Ga0373945_0026066 | Ga0373945_0026066_1536_2003 | 140 |
| 138 | 3300035695 | Ga0373927_0000732 | Ga0373927_0000732_9869_10336 | 140 |
| 139 | 3300036647 | Ga0316582_0108050 | Ga0316582_0108050_1165_1611 | 140 |
| 140 | 3300036647 | Ga0316582_0207049 | Ga0316582_0207049_243_689 | 140 |
| 141 | 3300036712 | Ga0316584_0294569 | Ga0316584_0294569_470_916 | 140 |
| 142 | 3300036712 | Ga0316584_0347375 | Ga0316584_0347375_506_952 | 140 |
| 143 | 3300037068 | Ga0373925_0000039 | Ga0373925_0000039_50502_50969 | 140 |
| 144 | 3300037418 | Ga0395900_0129947 | Ga0395900_0129947_1806_2258 | 140 |
| 145 | 3300046516 | Ga0495628_0355406 | Ga0495628_0355406_174_641 | 140 |
| 146 | 3300046517 | Ga0495630_0858381 | Ga0495630_0858381_118_585 | 140 |
| 147 | 3300046528 | Ga0495642_0078054 | Ga0495642_0078054_573_1037 | 140 |
| 148 | 3300046529 | Ga0495652_0447252 | Ga0495652_0447252_45_512 | 140 |
| 149 | 3300046535 | Ga0495586_0420340 | Ga0495586_0420340_94_561 | 140 |
| 150 | 3300046543 | Ga0495645_0249612 | Ga0495645_0249612_319_786 | 140 |
| 151 | 3300046616 | Ga0495668_0103975 | Ga0495668_0103975_940_1404 | 140 |
| 152 | 3300046648 | Ga0495611_0013778 | Ga0495611_0013778_389_853 | 140 |
| 153 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_83845_84309 | 140 |
| 154 | 3300047445 | Ga0495677_0117681 | Ga0495677_0117681_419_883 | 140 |
| 155 | 3300048903 | Ga0496100_0029766 | Ga0496100_0029766_800_1264 | 140 |
| 156 | 3300048904 | Ga0496101_0101156 | Ga0496101_0101156_564_1028 | 140 |
| 157 | 3300048905 | Ga0496102_0060433 | Ga0496102_0060433_2315_2779 | 140 |
| 158 | 3300048906 | Ga0496103_0820791 | Ga0496103_0820791_57_521 | 140 |
| 159 | 3300048907 | Ga0496104_0236210 | Ga0496104_0236210_723_1187 | 140 |
| 160 | 3300048911 | Ga0496108_0009257 | Ga0496108_0009257_3567_4031 | 140 |
| 161 | 3300048912 | Ga0496109_0048685 | Ga0496109_0048685_2729_3193 | 140 |
| 162 | 3300048913 | Ga0496110_0186247 | Ga0496110_0186247_770_1234 | 140 |
| 163 | 3300048915 | Ga0496112_0186065 | Ga0496112_0186065_17_484 | 140 |
| 164 | 3300048915 | Ga0496112_0262013 | Ga0496112_0262013_38_502 | 140 |
| 165 | 3300048916 | Ga0496113_0198381 | Ga0496113_0198381_276_740 | 140 |
| 166 | 3300048918 | Ga0496115_0000607 | Ga0496115_0000607_19268_19735 | 140 |
| 167 | 3300048918 | Ga0496115_0007666 | Ga0496115_0007666_2511_2978 | 140 |
| 168 | 3300048924 | Ga0496121_0777371 | Ga0496121_0777371_85_549 | 140 |
| 169 | 3300053091 | Ga0500647_0003051 | Ga0500647_0003051_3294_3758 | 140 |
| 170 | 3300053111 | Ga0500572_028022 | Ga0500572_028022_358_822 | 140 |
| 171 | 3300053120 | Ga0500597_064178 | Ga0500597_064178_61_525 | 140 |
| 172 | 3300053150 | Ga0500603_081034 | Ga0500603_081034_430_897 | 140 |
| 173 | 3300053154 | Ga0500619_246664 | Ga0500619_246664_64_528 | 140 |
| 174 | 3300053177 | Ga0500636_0135965 | Ga0500636_0135965_727_1191 | 140 |
| 175 | 3300003320 | rootH2_10067744 | rootH2_100677445 | 141 |
| 176 | 3300003323 | rootH1_10149653 | rootH1_101496532 | 141 |
| 177 | 3300005334 | Ga0068869_101011222 | Ga0068869_1010112221 | 141 |
| 178 | 3300005455 | Ga0070663_100467579 | Ga0070663_1004675792 | 141 |
| 179 | 3300005457 | Ga0070662_100577276 | Ga0070662_1005772762 | 141 |
| 180 | 3300005614 | Ga0068856_100111665 | Ga0068856_1001116653 | 141 |
| 181 | 3300009098 | Ga0105245_10220088 | Ga0105245_102200883 | 141 |
| 182 | 3300009176 | Ga0105242_11131663 | Ga0105242_111316632 | 141 |
| 183 | 3300009553 | Ga0105249_10599643 | Ga0105249_105996431 | 141 |
| 184 | 3300013306 | Ga0163162_10620307 | Ga0163162_106203072 | 141 |
| 185 | 3300025927 | Ga0207687_10184623 | Ga0207687_101846232 | 141 |
| 186 | 3300025933 | Ga0207706_10599818 | Ga0207706_105998182 | 141 |
| 187 | 3300025961 | Ga0207712_11522526 | Ga0207712_115225261 | 141 |
| 188 | 3300026067 | Ga0207678_10466618 | Ga0207678_104666182 | 141 |
| 189 | 3300026078 | Ga0207702_10582604 | Ga0207702_105826042 | 141 |
| 190 | 3300029957 | Ga0265324_10188597 | Ga0265324_101885972 | 141 |
| 191 | 3300037471 | Ga0395905_0000172 | Ga0395905_0000172_19702_20175 | 141 |
| 192 | 3300037471 | Ga0395905_0517028 | Ga0395905_0517028_427_900 | 141 |
| 193 | 3300048912 | Ga0496109_0887995 | Ga0496109_0887995_293_751 | 141 |
| 194 | 3300048917 | Ga0496114_0185745 | Ga0496114_0185745_889_1347 | 141 |
| 195 | 3300049570 | Ga0501033_0565430 | Ga0501033_0565430_242_715 | 141 |
| 196 | 3300049579 | Ga0501043_0115490 | Ga0501043_0115490_1243_1716 | 141 |
| 197 | 3300049822 | Ga0501035_0005859 | Ga0501035_0005859_1302_1769 | 141 |
| 198 | 3300049822 | Ga0501035_0211004 | Ga0501035_0211004_847_1320 | 141 |
| 199 | 3300053080 | Ga0500635_0001608 | Ga0500635_0001608_1690_2157 | 141 |
| 200 | 3300053136 | Ga0500559_0103509 | Ga0500559_0103509_148_615 | 141 |
| 201 | 3300006846 | Ga0075430_100007141 | Ga0075430_10000714111 | 142 |
| 202 | 3300050509 | nmdc:mga0qj67_70852_c1 | nmdc:mga0qj67_70852_c1_1501_1956 | 142 |
| 203 | 3300050510 | nmdc:mga06r32_571990_c1 | nmdc:mga06r32_571990_c1_131_586 | 142 |
| 204 | 3300013307 | Ga0157372_11158564 | Ga0157372_111585642 | 144 |
| 205 | 3300049571 | Ga0501034_0246624 | Ga0501034_0246624_923_1393 | 144 |
| 206 | 3300005937 | Ga0081455_10313754 | Ga0081455_103137542 | 146 |
| 207 | 3300006847 | Ga0075431_100024811 | Ga0075431_1000248111 | 146 |
| 208 | 3300006847 | Ga0075431_100149677 | Ga0075431_1001496772 | 146 |
| 209 | 3300009094 | Ga0111539_10314626 | Ga0111539_103146262 | 146 |
| 210 | 3300009147 | Ga0114129_10118791 | Ga0114129_101187913 | 146 |
| 211 | 3300048912 | Ga0496109_0603948 | Ga0496109_0603948_10_483 | 146 |
| 212 | 3300050507 | nmdc:mga05p37_64684_c1 | nmdc:mga05p37_64684_c1_1258_1731 | 146 |
| 213 | 3300050510 | nmdc:mga06r32_351191_c1 | nmdc:mga06r32_351191_c1_242_715 | 146 |
| 214 | 3300050511 | nmdc:mga08y16_751343_c1 | nmdc:mga08y16_751343_c1_73_546 | 146 |
| 215 | 3300002987 | JGI25159J45721_1007881 | JGI25159J45721_10078814 | 147 |
| 216 | 3300003187 | JGI25151J46595_10067274 | JGI25151J46595_100672742 | 147 |
| 217 | 3300005262 | Ga0065165_1000046 | Ga0065165_1000046129 | 147 |
| 218 | 3300025284 | Ga0209130_1003746 | Ga0209130_10037466 | 147 |
| 219 | 3300025294 | Ga0209025_1003819 | Ga0209025_10038196 | 147 |
| 220 | 3300025302 | Ga0207426_1014534 | Ga0207426_10145343 | 147 |
| 221 | iso_pu_bacteria | 2643221736 | 2644746671 | 147 |
| 222 | iso_pu_bacteria | 2841760612 | 2841762702 | 147 |
| 223 | iso_pu_bacteria | 2844104063 | 2844110290 | 147 |
| 224 | iso_pu_bacteria | 2851182111 | 2851187138 | 147 |
| 225 | iso_pu_bacteria | 2851246043 | 2851251952 | 147 |
| 226 | iso_pu_bacteria | 8057529695 | 8057535248 | 147 |
| 227 | 3300025945 | Ga0207679_11408055 | Ga0207679_114080551 | 148 |
| 228 | 3300003187 | JGI25151J46595_10000047 | JGI25151J46595_1000004763 | 149 |
| 229 | 3300003771 | Ga0055526_1000274 | Ga0055526_100027440 | 149 |
| 230 | 3300003771 | Ga0055526_1004542 | Ga0055526_10045427 | 149 |
| 231 | 3300003775 | Ga0055524_1000100 | Ga0055524_100010090 | 149 |
| 232 | 3300003775 | Ga0055524_1006673 | Ga0055524_10066735 | 149 |
| 233 | 3300005445 | Ga0070708_101560086 | Ga0070708_1015600861 | 149 |
| 234 | 3300013250 | Ga0171462_1011 | Ga0171462_1011186 | 149 |
| 235 | 3300025291 | Ga0209675_1000536 | Ga0209675_10005366 | 149 |
| 236 | 3300025292 | Ga0209676_1023653 | Ga0209676_10236532 | 149 |
| 237 | 3300025294 | Ga0209025_1000016 | Ga0209025_1000016165 | 149 |
| 238 | 3300025294 | Ga0209025_1043804 | Ga0209025_10438042 | 149 |
| 239 | 3300025295 | Ga0209564_1000023 | Ga0209564_1000023256 | 149 |
| 240 | 3300025295 | Ga0209564_1000035 | Ga0209564_1000035284 | 149 |
| 241 | 3300025299 | Ga0209256_1000025 | Ga0209256_1000025162 | 149 |
| 242 | 3300025299 | Ga0209256_1000262 | Ga0209256_100026240 | 149 |
| 243 | 3300025304 | Ga0209257_1040596 | Ga0209257_10405962 | 149 |
| 244 | 3300028794 | Ga0307515_10141336 | Ga0307515_101413362 | 149 |
| 245 | 3300031456 | Ga0307513_10702708 | Ga0307513_107027082 | 149 |
| 246 | 3300031901 | Ga0307406_10058574 | Ga0307406_100585744 | 149 |
| 247 | 3300038705 | Ga0237819_10957 | Ga0237819_10957_587_1096 | 149 |
| 248 | 3300039145 | Ga0237816_03719 | Ga0237816_03719_205_714 | 149 |
| 249 | 3300046520 | Ga0495637_0139927 | Ga0495637_0139927_335_844 | 149 |
| 250 | 3300046522 | Ga0495643_0125809 | Ga0495643_0125809_459_968 | 149 |
| 251 | 3300046542 | Ga0495597_0297325 | Ga0495597_0297325_86_583 | 149 |
| 252 | 3300048904 | Ga0496101_0577309 | Ga0496101_0577309_71_580 | 149 |
| 253 | 3300048912 | Ga0496109_0951750 | Ga0496109_0951750_96_605 | 149 |
| 254 | 3300048920 | Ga0496117_0050014 | Ga0496117_0050014_1222_1746 | 149 |
| 255 | 3300048925 | Ga0496122_0083737 | Ga0496122_0083737_1069_1593 | 149 |
| 256 | 3300048926 | Ga0496123_0059398 | Ga0496123_0059398_489_1013 | 149 |
| 257 | 3300048927 | Ga0496124_0196604 | Ga0496124_0196604_121_630 | 149 |
| 258 | 3300048929 | Ga0496126_0026814 | Ga0496126_0026814_2560_3069 | 149 |
| 259 | 3300048929 | Ga0496126_0971145 | Ga0496126_0971145_31_540 | 149 |
| 260 | 3300049571 | Ga0501034_0157847 | Ga0501034_0157847_1286_1810 | 149 |
| 261 | 3300049573 | Ga0501037_0075842 | Ga0501037_0075842_1605_2129 | 149 |
| 262 | 3300049574 | Ga0501038_0129680 | Ga0501038_0129680_1300_1824 | 149 |
| 263 | 3300049823 | Ga0501044_0582085 | Ga0501044_0582085_276_800 | 149 |
| 264 | 3300053121 | Ga0500607_056281 | Ga0500607_056281_1451_1960 | 149 |
| 265 | 3300053137 | Ga0500561_0041435 | Ga0500561_0041435_128_637 | 149 |
| 266 | 3300053153 | Ga0500616_0080640 | Ga0500616_0080640_11_520 | 149 |
| 267 | 3300053177 | Ga0500636_0004555 | Ga0500636_0004555_1973_2482 | 149 |
| 268 | iso_pu_bacteria | 2643221733 | 2644728297 | 149 |
| 269 | iso_pu_bacteria | 2643221734 | 2644733263 | 149 |
| 270 | iso_pu_bacteria | 2818991467 | 2819717851 | 149 |
| 271 | iso_pu_bacteria | 2841911363 | 2841916193 | 149 |
| 272 | iso_pu_bacteria | 2841917233 | 2841921138 | 149 |
| 273 | iso_pu_bacteria | 2917699015 | 2917700766 | 149 |
| 274 | 3300044656 | Ga0466969_0003620 | Ga0466969_0003620_6120_6653 | 150 |
| 275 | 3300044684 | Ga0466966_0002874 | Ga0466966_0002874_8372_8905 | 150 |
| 276 | 3300044693 | Ga0466961_0003361 | Ga0466961_0003361_5837_6370 | 150 |
| 277 | 3300044694 | Ga0466963_0194542 | Ga0466963_0194542_485_1018 | 150 |
| 278 | 3300044719 | Ga0466971_0000586 | Ga0466971_0000586_8989_9522 | 150 |
| 279 | 3300044765 | Ga0466970_0013079 | Ga0466970_0013079_1826_2359 | 150 |
| 280 | 3300044842 | Ga0466957_0004597 | Ga0466957_0004597_4083_4616 | 150 |
| 281 | 3300045049 | Ga0466959_0000060 | Ga0466959_0000060_41405_41938 | 150 |
| 282 | 3300045836 | Ga0466958_0001428 | Ga0466958_0001428_10107_10640 | 150 |
| 283 | 3300061719 | Ga0466962_0001058 | Ga0466962_0001058_4102_4635 | 150 |
| 284 | iso_pu_bacteria | 2585428057 | 2587727804 | 150 |
| 285 | iso_pu_bacteria | 2585428058 | 2587733880 | 150 |
| 286 | iso_pu_bacteria | 2585428062 | 2587754481 | 150 |
| 287 | iso_pu_bacteria | 2588253510 | 2588292338 | 150 |
| 288 | iso_pu_bacteria | 2643221592 | 2643972579 | 150 |
| 289 | iso_pu_bacteria | 2643221625 | 2644138413 | 150 |
| 290 | iso_pu_bacteria | 2643221644 | 2644248305 | 150 |
| 291 | iso_pu_bacteria | 2643221648 | 2644273087 | 150 |
| 292 | 3300021361 | Ga0213872_10000086 | Ga0213872_1000008670 | 151 |
| 293 | 3300039447 | Ga0436361_0874346 | Ga0436361_0874346_1803_2276 | 151 |
| 294 | 3300039447 | Ga0436361_0892385 | Ga0436361_0892385_8317_8790 | 151 |
| 295 | 3300021361 | Ga0213872_10000048 | Ga0213872_1000004814 | 152 |
| 296 | 3300039447 | Ga0436361_0943694 | Ga0436361_0943694_72861_73337 | 152 |
| 297 | 3300026118 | Ga0207675_100178236 | Ga0207675_1001782363 | 153 |
| 298 | 3300032004 | Ga0307414_11696264 | Ga0307414_116962641 | 153 |
| 299 | 3300035170 | Ga0373943_0338526 | Ga0373943_0338526_64_525 | 153 |
| 300 | 3300035725 | Ga0373947_0222831 | Ga0373947_0222831_427_888 | 153 |
| 301 | 3300037068 | Ga0373925_0004687 | Ga0373925_0004687_5128_5589 | 153 |
| 302 | 3300042876 | Ga0451577_0201049 | Ga0451577_0201049_1015_1479 | 153 |
| 303 | 3300044673 | Ga0453683_0944648 | Ga0453683_0944648_86_547 | 153 |
| 304 | 3300044712 | Ga0453684_0640441 | Ga0453684_0640441_456_917 | 153 |
| 305 | 3300045051 | Ga0451576_0072763 | Ga0451576_0072763_251_712 | 153 |
| 306 | 3300046683 | Ga0495658_0311035 | Ga0495658_0311035_305_766 | 153 |
| 307 | 3300048927 | Ga0496124_0000079 | Ga0496124_0000079_151657_152118 | 153 |
| 308 | 3300048928 | Ga0496125_0003021 | Ga0496125_0003021_2067_2528 | 153 |
| 309 | 3300053083 | Ga0495655_0059358 | Ga0495655_0059358_49_510 | 153 |
| 310 | 3300002773 | JGI25152J39213_1003184 | JGI25152J39213_10031844 | 154 |
| 311 | 3300002774 | JGI25150J39212_1011358 | JGI25150J39212_10113582 | 154 |
| 312 | 3300003215 | JGI25153J46596_10003416 | JGI25153J46596_100034163 | 154 |
| 313 | 3300003215 | JGI25153J46596_10003814 | JGI25153J46596_100038142 | 154 |
| 314 | 3300003316 | rootH1_10004001 | rootH1_100040012 | 154 |
| 315 | 3300003323 | rootH1_10003085 | rootH1_1000308518 | 154 |
| 316 | 3300003759 | Ga0055525_1000021 | Ga0055525_100002197 | 154 |
| 317 | 3300003771 | Ga0055526_1003449 | Ga0055526_10034494 | 154 |
| 318 | 3300003775 | Ga0055524_1000253 | Ga0055524_10002533 | 154 |
| 319 | 3300003775 | Ga0055524_1006902 | Ga0055524_10069025 | 154 |
| 320 | 3300003791 | Ga0055530_10012910 | Ga0055530_100129102 | 154 |
| 321 | 3300003791 | Ga0055530_10016972 | Ga0055530_100169721 | 154 |
| 322 | 3300003792 | Ga0055540_1000011 | Ga0055540_1000011135 | 154 |
| 323 | 3300003794 | Ga0055531_10000841 | Ga0055531_1000084114 | 154 |
| 324 | 3300003794 | Ga0055531_10007597 | Ga0055531_100075973 | 154 |
| 325 | 3300004625 | Ga0055543_1021852 | Ga0055543_10218522 | 154 |
| 326 | 3300005262 | Ga0065165_1000092 | Ga0065165_1000092102 | 154 |
| 327 | 3300005262 | Ga0065165_1002514 | Ga0065165_10025142 | 154 |
| 328 | 3300005262 | Ga0065165_1040895 | Ga0065165_10408952 | 154 |
| 329 | 3300005331 | Ga0070670_100000316 | Ga0070670_10000031613 | 154 |
| 330 | 3300005333 | Ga0070677_10085159 | Ga0070677_100851592 | 154 |
| 331 | 3300005334 | Ga0068869_100499330 | Ga0068869_1004993301 | 154 |
| 332 | 3300005338 | Ga0068868_100018706 | Ga0068868_1000187064 | 154 |
| 333 | 3300005339 | Ga0070660_100650170 | Ga0070660_1006501701 | 154 |
| 334 | 3300005344 | Ga0070661_100003441 | Ga0070661_1000034418 | 154 |
| 335 | 3300005344 | Ga0070661_100098901 | Ga0070661_1000989012 | 154 |
| 336 | 3300005353 | Ga0070669_100014753 | Ga0070669_1000147535 | 154 |
| 337 | 3300005353 | Ga0070669_100087143 | Ga0070669_1000871433 | 154 |
| 338 | 3300005353 | Ga0070669_100492479 | Ga0070669_1004924792 | 154 |
| 339 | 3300005354 | Ga0070675_100021440 | Ga0070675_1000214402 | 154 |
| 340 | 3300005354 | Ga0070675_100099423 | Ga0070675_1000994232 | 154 |
| 341 | 3300005354 | Ga0070675_100519340 | Ga0070675_1005193402 | 154 |
| 342 | 3300005355 | Ga0070671_100020520 | Ga0070671_1000205202 | 154 |
| 343 | 3300005356 | Ga0070674_100008892 | Ga0070674_1000088922 | 154 |
| 344 | 3300005356 | Ga0070674_100083373 | Ga0070674_1000833732 | 154 |
| 345 | 3300005364 | Ga0070673_100005627 | Ga0070673_1000056272 | 154 |
| 346 | 3300005364 | Ga0070673_100157990 | Ga0070673_1001579902 | 154 |
| 347 | 3300005364 | Ga0070673_100191134 | Ga0070673_1001911342 | 154 |
| 348 | 3300005366 | Ga0070659_100000414 | Ga0070659_10000041425 | 154 |
| 349 | 3300005367 | Ga0070667_100003744 | Ga0070667_1000037441 | 154 |
| 350 | 3300005367 | Ga0070667_100102848 | Ga0070667_1001028482 | 154 |
| 351 | 3300005367 | Ga0070667_100415500 | Ga0070667_1004155002 | 154 |
| 352 | 3300005445 | Ga0070708_100091905 | Ga0070708_1000919054 | 154 |
| 353 | 3300005445 | Ga0070708_100806973 | Ga0070708_1008069731 | 154 |
| 354 | 3300005455 | Ga0070663_100000288 | Ga0070663_10000028820 | 154 |
| 355 | 3300005455 | Ga0070663_100092489 | Ga0070663_1000924892 | 154 |
| 356 | 3300005456 | Ga0070678_100040094 | Ga0070678_1000400943 | 154 |
| 357 | 3300005456 | Ga0070678_100164633 | Ga0070678_1001646333 | 154 |
| 358 | 3300005456 | Ga0070678_100554348 | Ga0070678_1005543481 | 154 |
| 359 | 3300005457 | Ga0070662_100035026 | Ga0070662_1000350264 | 154 |
| 360 | 3300005457 | Ga0070662_100770099 | Ga0070662_1007700992 | 154 |
| 361 | 3300005457 | Ga0070662_100886986 | Ga0070662_1008869862 | 154 |
| 362 | 3300005459 | Ga0068867_100000018 | Ga0068867_10000001817 | 154 |
| 363 | 3300005459 | Ga0068867_100000712 | Ga0068867_1000007123 | 154 |
| 364 | 3300005459 | Ga0068867_100638880 | Ga0068867_1006388801 | 154 |
| 365 | 3300005459 | Ga0068867_100744418 | Ga0068867_1007444182 | 154 |
| 366 | 3300005467 | Ga0070706_100007035 | Ga0070706_1000070353 | 154 |
| 367 | 3300005468 | Ga0070707_100468705 | Ga0070707_1004687052 | 154 |
| 368 | 3300005471 | Ga0070698_100186433 | Ga0070698_1001864333 | 154 |
| 369 | 3300005539 | Ga0068853_100252485 | Ga0068853_1002524853 | 154 |
| 370 | 3300005543 | Ga0070672_100000206 | Ga0070672_10000020619 | 154 |
| 371 | 3300005543 | Ga0070672_100045348 | Ga0070672_1000453483 | 154 |
| 372 | 3300005548 | Ga0070665_100405347 | Ga0070665_1004053472 | 154 |
| 373 | 3300005548 | Ga0070665_101849886 | Ga0070665_1018498862 | 154 |
| 374 | 3300005564 | Ga0070664_100013581 | Ga0070664_1000135818 | 154 |
| 375 | 3300005564 | Ga0070664_100018046 | Ga0070664_1000180462 | 154 |
| 376 | 3300005564 | Ga0070664_100162347 | Ga0070664_1001623473 | 154 |
| 377 | 3300005577 | Ga0068857_100021161 | Ga0068857_1000211615 | 154 |
| 378 | 3300005577 | Ga0068857_101020747 | Ga0068857_1010207472 | 154 |
| 379 | 3300005578 | Ga0068854_100135522 | Ga0068854_1001355222 | 154 |
| 380 | 3300005615 | Ga0070702_100283635 | Ga0070702_1002836352 | 154 |
| 381 | 3300005616 | Ga0068852_100005610 | Ga0068852_1000056104 | 154 |
| 382 | 3300005616 | Ga0068852_100042576 | Ga0068852_1000425764 | 154 |
| 383 | 3300005617 | Ga0068859_100342955 | Ga0068859_1003429553 | 154 |
| 384 | 3300005719 | Ga0068861_101391081 | Ga0068861_1013910811 | 154 |
| 385 | 3300005840 | Ga0068870_10180713 | Ga0068870_101807132 | 154 |
| 386 | 3300005843 | Ga0068860_100044526 | Ga0068860_1000445267 | 154 |
| 387 | 3300005843 | Ga0068860_100902231 | Ga0068860_1009022312 | 154 |
| 388 | 3300006042 | Ga0075368_10034052 | Ga0075368_100340523 | 154 |
| 389 | 3300006042 | Ga0075368_10183265 | Ga0075368_101832652 | 154 |
| 390 | 3300006048 | Ga0075363_100014280 | Ga0075363_1000142802 | 154 |
| 391 | 3300006048 | Ga0075363_100049825 | Ga0075363_1000498253 | 154 |
| 392 | 3300006048 | Ga0075363_100208489 | Ga0075363_1002084892 | 154 |
| 393 | 3300006051 | Ga0075364_10134327 | Ga0075364_101343272 | 154 |
| 394 | 3300006051 | Ga0075364_10368715 | Ga0075364_103687152 | 154 |
| 395 | 3300006177 | Ga0075362_10002253 | Ga0075362_100022535 | 154 |
| 396 | 3300006177 | Ga0075362_10062132 | Ga0075362_100621322 | 154 |
| 397 | 3300006177 | Ga0075362_10251339 | Ga0075362_102513392 | 154 |
| 398 | 3300006178 | Ga0075367_10000848 | Ga0075367_100008489 | 154 |
| 399 | 3300006178 | Ga0075367_10015213 | Ga0075367_100152132 | 154 |
| 400 | 3300006178 | Ga0075367_10047448 | Ga0075367_100474483 | 154 |
| 401 | 3300006178 | Ga0075367_10356749 | Ga0075367_103567492 | 154 |
| 402 | 3300006186 | Ga0075369_10002971 | Ga0075369_100029715 | 154 |
| 403 | 3300006186 | Ga0075369_10022450 | Ga0075369_100224502 | 154 |
| 404 | 3300006186 | Ga0075369_10233888 | Ga0075369_102338882 | 154 |
| 405 | 3300006195 | Ga0075366_10030684 | Ga0075366_100306842 | 154 |
| 406 | 3300006195 | Ga0075366_10039649 | Ga0075366_100396492 | 154 |
| 407 | 3300006195 | Ga0075366_10083557 | Ga0075366_100835571 | 154 |
| 408 | 3300006195 | Ga0075366_10126518 | Ga0075366_101265181 | 154 |
| 409 | 3300006195 | Ga0075366_10174084 | Ga0075366_101740842 | 154 |
| 410 | 3300006195 | Ga0075366_10196770 | Ga0075366_101967702 | 154 |
| 411 | 3300006195 | Ga0075366_10767181 | Ga0075366_107671812 | 154 |
| 412 | 3300006237 | Ga0097621_100198506 | Ga0097621_1001985063 | 154 |
| 413 | 3300006353 | Ga0075370_10002309 | Ga0075370_100023095 | 154 |
| 414 | 3300006353 | Ga0075370_10003363 | Ga0075370_100033638 | 154 |
| 415 | 3300006353 | Ga0075370_10006079 | Ga0075370_100060795 | 154 |
| 416 | 3300006353 | Ga0075370_10047864 | Ga0075370_100478642 | 154 |
| 417 | 3300006353 | Ga0075370_10269571 | Ga0075370_102695712 | 154 |
| 418 | 3300006881 | Ga0068865_100044344 | Ga0068865_1000443443 | 154 |
| 419 | 3300006931 | Ga0097620_100343001 | Ga0097620_1003430013 | 154 |
| 420 | 3300006942 | Ga0099824_1038383 | Ga0099824_10383832 | 154 |
| 421 | 3300006944 | Ga0099823_1002588 | Ga0099823_10025887 | 154 |
| 422 | 3300006946 | Ga0079104_1000040 | Ga0079104_1000040150 | 154 |
| 423 | 3300009093 | Ga0105240_10006664 | Ga0105240_1000666412 | 154 |
| 424 | 3300009093 | Ga0105240_10526827 | Ga0105240_105268272 | 154 |
| 425 | 3300009094 | Ga0111539_12099261 | Ga0111539_120992611 | 154 |
| 426 | 3300009098 | Ga0105245_10363626 | Ga0105245_103636262 | 154 |
| 427 | 3300009148 | Ga0105243_10040230 | Ga0105243_100402303 | 154 |
| 428 | 3300009148 | Ga0105243_10171020 | Ga0105243_101710202 | 154 |
| 429 | 3300009148 | Ga0105243_10317841 | Ga0105243_103178412 | 154 |
| 430 | 3300009148 | Ga0105243_10891390 | Ga0105243_108913902 | 154 |
| 431 | 3300009174 | Ga0105241_10208010 | Ga0105241_102080102 | 154 |
| 432 | 3300009174 | Ga0105241_10438568 | Ga0105241_104385683 | 154 |
| 433 | 3300009545 | Ga0105237_10003122 | Ga0105237_1000312217 | 154 |
| 434 | 3300009545 | Ga0105237_10023165 | Ga0105237_100231659 | 154 |
| 435 | 3300009551 | Ga0105238_10051787 | Ga0105238_100517874 | 154 |
| 436 | 3300009551 | Ga0105238_10451673 | Ga0105238_104516732 | 154 |
| 437 | 3300010375 | Ga0105239_10000563 | Ga0105239_100005636 | 154 |
| 438 | 3300010375 | Ga0105239_10026325 | Ga0105239_100263256 | 154 |
| 439 | 3300010375 | Ga0105239_13222042 | Ga0105239_132220421 | 154 |
| 440 | 3300013296 | Ga0157374_10534134 | Ga0157374_105341342 | 154 |
| 441 | 3300013306 | Ga0163162_10266438 | Ga0163162_102664384 | 154 |
| 442 | 3300013306 | Ga0163162_12423241 | Ga0163162_124232411 | 154 |
| 443 | 3300013308 | Ga0157375_10155596 | Ga0157375_101555962 | 154 |
| 444 | 3300013308 | Ga0157375_10410485 | Ga0157375_104104852 | 154 |
| 445 | 3300014326 | Ga0157380_11437095 | Ga0157380_114370952 | 154 |
| 446 | 3300014326 | Ga0157380_11851205 | Ga0157380_118512052 | 154 |
| 447 | 3300014326 | Ga0157380_12606719 | Ga0157380_126067191 | 154 |
| 448 | 3300014745 | Ga0157377_10000051 | Ga0157377_100000515 | 154 |
| 449 | 3300014745 | Ga0157377_10823948 | Ga0157377_108239481 | 154 |
| 450 | 3300014969 | Ga0157376_11986851 | Ga0157376_119868511 | 154 |
| 451 | 3300017792 | Ga0163161_10003613 | Ga0163161_100036138 | 154 |
| 452 | 3300021361 | Ga0213872_10000046 | Ga0213872_1000004631 | 154 |
| 453 | 3300021361 | Ga0213872_10000090 | Ga0213872_1000009013 | 154 |
| 454 | 3300021361 | Ga0213872_10216111 | Ga0213872_102161111 | 154 |
| 455 | 3300025230 | Ga0209563_100005 | Ga0209563_100005230 | 154 |
| 456 | 3300025245 | Ga0207425_1001899 | Ga0207425_10018994 | 154 |
| 457 | 3300025245 | Ga0207425_1070726 | Ga0207425_10707262 | 154 |
| 458 | 3300025258 | Ga0209129_1000124 | Ga0209129_10001244 | 154 |
| 459 | 3300025263 | Ga0209565_1021127 | Ga0209565_10211273 | 154 |
| 460 | 3300025273 | Ga0209673_1040424 | Ga0209673_10404242 | 154 |
| 461 | 3300025295 | Ga0209564_1000057 | Ga0209564_1000057117 | 154 |
| 462 | 3300025297 | Ga0209758_1000214 | Ga0209758_100021487 | 154 |
| 463 | 3300025297 | Ga0209758_1000232 | Ga0209758_100023286 | 154 |
| 464 | 3300025298 | Ga0209050_1000376 | Ga0209050_100037612 | 154 |
| 465 | 3300025298 | Ga0209050_1001215 | Ga0209050_100121510 | 154 |
| 466 | 3300025298 | Ga0209050_1008356 | Ga0209050_10083566 | 154 |
| 467 | 3300025299 | Ga0209256_1000113 | Ga0209256_1000113153 | 154 |
| 468 | 3300025303 | Ga0209051_1000020 | Ga0209051_1000020135 | 154 |
| 469 | 3300025304 | Ga0209257_1000085 | Ga0209257_1000085135 | 154 |
| 470 | 3300025304 | Ga0209257_1013523 | Ga0209257_10135232 | 154 |
| 471 | 3300025304 | Ga0209257_1032608 | Ga0209257_10326083 | 154 |
| 472 | 3300025893 | Ga0207682_10000269 | Ga0207682_1000026921 | 154 |
| 473 | 3300025893 | Ga0207682_10010445 | Ga0207682_100104454 | 154 |
| 474 | 3300025899 | Ga0207642_10187481 | Ga0207642_101874812 | 154 |
| 475 | 3300025907 | Ga0207645_10048409 | Ga0207645_100484093 | 154 |
| 476 | 3300025907 | Ga0207645_10336406 | Ga0207645_103364062 | 154 |
| 477 | 3300025908 | Ga0207643_10149855 | Ga0207643_101498553 | 154 |
| 478 | 3300025908 | Ga0207643_10258548 | Ga0207643_102585482 | 154 |
| 479 | 3300025910 | Ga0207684_10000871 | Ga0207684_1000087124 | 154 |
| 480 | 3300025913 | Ga0207695_10021053 | Ga0207695_1002105310 | 154 |
| 481 | 3300025913 | Ga0207695_10105580 | Ga0207695_101055804 | 154 |
| 482 | 3300025914 | Ga0207671_10005735 | Ga0207671_100057355 | 154 |
| 483 | 3300025914 | Ga0207671_10102303 | Ga0207671_101023032 | 154 |
| 484 | 3300025919 | Ga0207657_10079911 | Ga0207657_100799113 | 154 |
| 485 | 3300025919 | Ga0207657_10373856 | Ga0207657_103738562 | 154 |
| 486 | 3300025920 | Ga0207649_10004702 | Ga0207649_100047028 | 154 |
| 487 | 3300025920 | Ga0207649_10154689 | Ga0207649_101546892 | 154 |
| 488 | 3300025923 | Ga0207681_10012357 | Ga0207681_100123574 | 154 |
| 489 | 3300025923 | Ga0207681_10077266 | Ga0207681_100772662 | 154 |
| 490 | 3300025923 | Ga0207681_10546601 | Ga0207681_105466012 | 154 |
| 491 | 3300025924 | Ga0207694_10162481 | Ga0207694_101624813 | 154 |
| 492 | 3300025925 | Ga0207650_10000172 | Ga0207650_1000017261 | 154 |
| 493 | 3300025925 | Ga0207650_10433211 | Ga0207650_104332112 | 154 |
| 494 | 3300025926 | Ga0207659_10000066 | Ga0207659_1000006622 | 154 |
| 495 | 3300025926 | Ga0207659_10352282 | Ga0207659_103522822 | 154 |
| 496 | 3300025927 | Ga0207687_10264631 | Ga0207687_102646312 | 154 |
| 497 | 3300025927 | Ga0207687_10368975 | Ga0207687_103689752 | 154 |
| 498 | 3300025931 | Ga0207644_10017947 | Ga0207644_100179472 | 154 |
| 499 | 3300025931 | Ga0207644_10343913 | Ga0207644_103439132 | 154 |
| 500 | 3300025932 | Ga0207690_10000990 | Ga0207690_1000099014 | 154 |
| 501 | 3300025933 | Ga0207706_10046461 | Ga0207706_100464614 | 154 |
| 502 | 3300025933 | Ga0207706_10428628 | Ga0207706_104286282 | 154 |
| 503 | 3300025935 | Ga0207709_10000889 | Ga0207709_1000088925 | 154 |
| 504 | 3300025937 | Ga0207669_10026021 | Ga0207669_100260215 | 154 |
| 505 | 3300025937 | Ga0207669_10111764 | Ga0207669_101117641 | 154 |
| 506 | 3300025937 | Ga0207669_10217891 | Ga0207669_102178912 | 154 |
| 507 | 3300025938 | Ga0207704_10403934 | Ga0207704_104039342 | 154 |
| 508 | 3300025940 | Ga0207691_10000265 | Ga0207691_1000026522 | 154 |
| 509 | 3300025940 | Ga0207691_10009413 | Ga0207691_100094134 | 154 |
| 510 | 3300025940 | Ga0207691_10064013 | Ga0207691_100640133 | 154 |
| 511 | 3300025942 | Ga0207689_10175883 | Ga0207689_101758832 | 154 |
| 512 | 3300025945 | Ga0207679_10006650 | Ga0207679_100066503 | 154 |
| 513 | 3300025945 | Ga0207679_10011841 | Ga0207679_100118413 | 154 |
| 514 | 3300025945 | Ga0207679_10271021 | Ga0207679_102710212 | 154 |
| 515 | 3300025960 | Ga0207651_10129420 | Ga0207651_101294202 | 154 |
| 516 | 3300025960 | Ga0207651_10140082 | Ga0207651_101400822 | 154 |
| 517 | 3300025960 | Ga0207651_10273466 | Ga0207651_102734662 | 154 |
| 518 | 3300025972 | Ga0207668_10488555 | Ga0207668_104885552 | 154 |
| 519 | 3300025986 | Ga0207658_10031651 | Ga0207658_100316513 | 154 |
| 520 | 3300025986 | Ga0207658_10079771 | Ga0207658_100797714 | 154 |
| 521 | 3300025986 | Ga0207658_10207290 | Ga0207658_102072901 | 154 |
| 522 | 3300025986 | Ga0207658_10269678 | Ga0207658_102696782 | 154 |
| 523 | 3300025986 | Ga0207658_10912347 | Ga0207658_109123472 | 154 |
| 524 | 3300026023 | Ga0207677_10064156 | Ga0207677_100641563 | 154 |
| 525 | 3300026023 | Ga0207677_10357805 | Ga0207677_103578052 | 154 |
| 526 | 3300026035 | Ga0207703_10754915 | Ga0207703_107549152 | 154 |
| 527 | 3300026067 | Ga0207678_10001406 | Ga0207678_1000140621 | 154 |
| 528 | 3300026067 | Ga0207678_10151853 | Ga0207678_101518533 | 154 |
| 529 | 3300026067 | Ga0207678_10300228 | Ga0207678_103002282 | 154 |
| 530 | 3300026089 | Ga0207648_10000060 | Ga0207648_1000006084 | 154 |
| 531 | 3300026089 | Ga0207648_10044482 | Ga0207648_100444824 | 154 |
| 532 | 3300026089 | Ga0207648_10126026 | Ga0207648_101260262 | 154 |
| 533 | 3300026089 | Ga0207648_10200534 | Ga0207648_102005343 | 154 |
| 534 | 3300026089 | Ga0207648_10280613 | Ga0207648_102806133 | 154 |
| 535 | 3300026095 | Ga0207676_10117777 | Ga0207676_101177772 | 154 |
| 536 | 3300026116 | Ga0207674_10018423 | Ga0207674_100184235 | 154 |
| 537 | 3300026116 | Ga0207674_10424112 | Ga0207674_104241122 | 154 |
| 538 | 3300026118 | Ga0207675_100699016 | Ga0207675_1006990161 | 154 |
| 539 | 3300026118 | Ga0207675_101231684 | Ga0207675_1012316842 | 154 |
| 540 | 3300026121 | Ga0207683_10065460 | Ga0207683_100654603 | 154 |
| 541 | 3300026121 | Ga0207683_10114077 | Ga0207683_101140774 | 154 |
| 542 | 3300026121 | Ga0207683_10478185 | Ga0207683_104781852 | 154 |
| 543 | 3300026142 | Ga0207698_10003996 | Ga0207698_100039968 | 154 |
| 544 | 3300026142 | Ga0207698_10039287 | Ga0207698_100392874 | 154 |
| 545 | 3300027111 | Ga0209281_1000074 | Ga0209281_1000074228 | 154 |
| 546 | 3300027866 | Ga0209813_10036427 | Ga0209813_100364272 | 154 |
| 547 | 3300028379 | Ga0268266_10108959 | Ga0268266_101089592 | 154 |
| 548 | 3300028379 | Ga0268266_10675334 | Ga0268266_106753342 | 154 |
| 549 | 3300028379 | Ga0268266_11399608 | Ga0268266_113996082 | 154 |
| 550 | 3300028786 | Ga0307517_10000499 | Ga0307517_1000049928 | 154 |
| 551 | 3300028786 | Ga0307517_10234865 | Ga0307517_102348652 | 154 |
| 552 | 3300028786 | Ga0307517_10274665 | Ga0307517_102746652 | 154 |
| 553 | 3300028794 | Ga0307515_10000366 | Ga0307515_1000036614 | 154 |
| 554 | 3300028794 | Ga0307515_10001653 | Ga0307515_1000165341 | 154 |
| 555 | 3300028794 | Ga0307515_10124341 | Ga0307515_101243413 | 154 |
| 556 | 3300028794 | Ga0307515_10251358 | Ga0307515_102513582 | 154 |
| 557 | 3300028794 | Ga0307515_10283422 | Ga0307515_102834222 | 154 |
| 558 | 3300030522 | Ga0307512_10065820 | Ga0307512_100658202 | 154 |
| 559 | 3300031250 | Ga0265331_10009064 | Ga0265331_100090649 | 154 |
| 560 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028299 | 154 |
| 561 | 3300031456 | Ga0307513_10067533 | Ga0307513_100675334 | 154 |
| 562 | 3300031456 | Ga0307513_10085924 | Ga0307513_100859243 | 154 |
| 563 | 3300031456 | Ga0307513_10130895 | Ga0307513_101308953 | 154 |
| 564 | 3300031456 | Ga0307513_10392945 | Ga0307513_103929452 | 154 |
| 565 | 3300031548 | Ga0307408_100120045 | Ga0307408_1001200453 | 154 |
| 566 | 3300031548 | Ga0307408_100148194 | Ga0307408_1001481942 | 154 |
| 567 | 3300031548 | Ga0307408_101519866 | Ga0307408_1015198662 | 154 |
| 568 | 3300031616 | Ga0307508_10000194 | Ga0307508_1000019449 | 154 |
| 569 | 3300031616 | Ga0307508_10025639 | Ga0307508_100256394 | 154 |
| 570 | 3300031649 | Ga0307514_10023006 | Ga0307514_100230064 | 154 |
| 571 | 3300031649 | Ga0307514_10080658 | Ga0307514_100806583 | 154 |
| 572 | 3300031730 | Ga0307516_10001561 | Ga0307516_1000156114 | 154 |
| 573 | 3300031730 | Ga0307516_10002583 | Ga0307516_1000258311 | 154 |
| 574 | 3300031730 | Ga0307516_10044992 | Ga0307516_100449925 | 154 |
| 575 | 3300031730 | Ga0307516_10075203 | Ga0307516_100752032 | 154 |
| 576 | 3300031730 | Ga0307516_10445659 | Ga0307516_104456592 | 154 |
| 577 | 3300031730 | Ga0307516_10597004 | Ga0307516_105970042 | 154 |
| 578 | 3300031911 | Ga0307412_11288395 | Ga0307412_112883952 | 154 |
| 579 | 3300032004 | Ga0307414_10154051 | Ga0307414_101540513 | 154 |
| 580 | 3300032005 | Ga0307411_11079297 | Ga0307411_110792972 | 154 |
| 581 | 3300033179 | Ga0307507_10172037 | Ga0307507_101720372 | 154 |
| 582 | 3300033180 | Ga0307510_10394286 | Ga0307510_103942862 | 154 |
| 583 | 3300034957 | Ga0373938_0018338 | Ga0373938_0018338_896_1360 | 154 |
| 584 | 3300035117 | Ga0373953_0261981 | Ga0373953_0261981_108_590 | 154 |
| 585 | 3300036401 | Ga0373937_0103288 | Ga0373937_0103288_1112_1594 | 154 |
| 586 | 3300039447 | Ga0436361_0042216 | Ga0436361_0042216_5268_5732 | 154 |
| 587 | 3300039447 | Ga0436361_0633280 | Ga0436361_0633280_75547_76011 | 154 |
| 588 | 3300039447 | Ga0436361_0661766 | Ga0436361_0661766_37053_37517 | 154 |
| 589 | 3300039447 | Ga0436361_0692684 | Ga0436361_0692684_122183_122647 | 154 |
| 590 | 3300041443 | Ga0451789_0772919 | Ga0451789_0772919_1191_1655 | 154 |
| 591 | 3300041451 | Ga0451791_1786793 | Ga0451791_1786793_267_731 | 154 |
| 592 | 3300041452 | Ga0451793_1319808 | Ga0451793_1319808_246_710 | 154 |
| 593 | 3300041453 | Ga0451797_0349248 | Ga0451797_0349248_18_482 | 154 |
| 594 | 3300041453 | Ga0451797_0494721 | Ga0451797_0494721_37_501 | 154 |
| 595 | 3300041453 | Ga0451797_0636430 | Ga0451797_0636430_261_860 | 154 |
| 596 | 3300041456 | Ga0451795_0259599 | Ga0451795_0259599_125_607 | 154 |
| 597 | 3300041456 | Ga0451795_0766554 | Ga0451795_0766554_692_1156 | 154 |
| 598 | 3300041459 | Ga0451800_0252204 | Ga0451800_0252204_831_1295 | 154 |
| 599 | 3300041459 | Ga0451800_1634667 | Ga0451800_1634667_441_905 | 154 |
| 600 | 3300041486 | Ga0451807_2396062 | Ga0451807_2396062_11_475 | 154 |
| 601 | 3300041498 | Ga0451841_1304204 | Ga0451841_1304204_515_979 | 154 |
| 602 | 3300041507 | Ga0451851_0101857 | Ga0451851_0101857_30_494 | 154 |
| 603 | 3300041509 | Ga0451843_0764763 | Ga0451843_0764763_34_498 | 154 |
| 604 | 3300041511 | Ga0451855_0947765 | Ga0451855_0947765_150_614 | 154 |
| 605 | 3300041512 | Ga0451853_0482874 | Ga0451853_0482874_128_592 | 154 |
| 606 | 3300041512 | Ga0451853_1144964 | Ga0451853_1144964_681_1145 | 154 |
| 607 | 3300041997 | Ga0439431_0005195 | Ga0439431_0005195_1675_2139 | 154 |
| 608 | 3300042121 | Ga0450919_000139 | Ga0450919_000139_4420_4884 | 154 |
| 609 | 3300042126 | Ga0450888_002426 | Ga0450888_002426_748_1212 | 154 |
| 610 | 3300042157 | Ga0439458_0006248 | Ga0439458_0006248_955_1419 | 154 |
| 611 | 3300042531 | Ga0450918_005133 | Ga0450918_005133_1392_1856 | 154 |
| 612 | 3300042876 | Ga0451577_0018787 | Ga0451577_0018787_5166_5630 | 154 |
| 613 | 3300042876 | Ga0451577_0022716 | Ga0451577_0022716_5075_5539 | 154 |
| 614 | 3300042876 | Ga0451577_0086132 | Ga0451577_0086132_128_592 | 154 |
| 615 | 3300042876 | Ga0451577_0631265 | Ga0451577_0631265_16_480 | 154 |
| 616 | 3300044658 | Ga0466972_0110957 | Ga0466972_0110957_361_825 | 154 |
| 617 | 3300044712 | Ga0453684_0297230 | Ga0453684_0297230_739_1203 | 154 |
| 618 | 3300044712 | Ga0453684_0412049 | Ga0453684_0412049_486_950 | 154 |
| 619 | 3300044765 | Ga0466970_0080053 | Ga0466970_0080053_358_822 | 154 |
| 620 | 3300044901 | Ga0466960_0137794 | Ga0466960_0137794_381_845 | 154 |
| 621 | 3300045049 | Ga0466959_0651449 | Ga0466959_0651449_17_481 | 154 |
| 622 | 3300046457 | Ga0495590_0054938 | Ga0495590_0054938_268_732 | 154 |
| 623 | 3300046460 | Ga0495638_0174869 | Ga0495638_0174869_623_1087 | 154 |
| 624 | 3300046471 | Ga0495650_0003992 | Ga0495650_0003992_1279_1743 | 154 |
| 625 | 3300046474 | Ga0495605_0082631 | Ga0495605_0082631_437_901 | 154 |
| 626 | 3300046507 | Ga0495606_0433630 | Ga0495606_0433630_118_582 | 154 |
| 627 | 3300046512 | Ga0495610_0011872 | Ga0495610_0011872_3166_3630 | 154 |
| 628 | 3300046512 | Ga0495610_0063215 | Ga0495610_0063215_981_1445 | 154 |
| 629 | 3300046513 | Ga0495616_0214048 | Ga0495616_0214048_42_506 | 154 |
| 630 | 3300046515 | Ga0495620_0314476 | Ga0495620_0314476_19_483 | 154 |
| 631 | 3300046519 | Ga0495632_0008169 | Ga0495632_0008169_3805_4269 | 154 |
| 632 | 3300046519 | Ga0495632_0010554 | Ga0495632_0010554_3641_4105 | 154 |
| 633 | 3300046522 | Ga0495643_0008013 | Ga0495643_0008013_4799_5263 | 154 |
| 634 | 3300046528 | Ga0495642_0217410 | Ga0495642_0217410_313_777 | 154 |
| 635 | 3300046530 | Ga0495654_0152004 | Ga0495654_0152004_247_711 | 154 |
| 636 | 3300046537 | Ga0495598_0011607 | Ga0495598_0011607_809_1273 | 154 |
| 637 | 3300046539 | Ga0495621_0005161 | Ga0495621_0005161_1252_1716 | 154 |
| 638 | 3300046542 | Ga0495597_0004699 | Ga0495597_0004699_4548_5012 | 154 |
| 639 | 3300046542 | Ga0495597_0057252 | Ga0495597_0057252_354_818 | 154 |
| 640 | 3300046660 | Ga0495625_0008189 | Ga0495625_0008189_3342_3806 | 154 |
| 641 | 3300046660 | Ga0495625_0012918 | Ga0495625_0012918_2960_3424 | 154 |
| 642 | 3300046660 | Ga0495625_0155573 | Ga0495625_0155573_155_637 | 154 |
| 643 | 3300046683 | Ga0495658_0109631 | Ga0495658_0109631_253_717 | 154 |
| 644 | 3300046683 | Ga0495658_0383963 | Ga0495658_0383963_194_676 | 154 |
| 645 | 3300046684 | Ga0495669_0484695 | Ga0495669_0484695_40_504 | 154 |
| 646 | 3300046692 | Ga0495671_0085257 | Ga0495671_0085257_1003_1485 | 154 |
| 647 | 3300046692 | Ga0495671_0311793 | Ga0495671_0311793_207_671 | 154 |
| 648 | 3300046694 | Ga0495649_0004058 | Ga0495649_0004058_2927_3391 | 154 |
| 649 | 3300046810 | Ga0495660_0377967 | Ga0495660_0377967_45_509 | 154 |
| 650 | 3300047443 | Ga0495687_001087 | Ga0495687_001087_19452_19916 | 154 |
| 651 | 3300047443 | Ga0495687_033644 | Ga0495687_033644_1141_1605 | 154 |
| 652 | 3300047469 | Ga0495673_0091223 | Ga0495673_0091223_198_680 | 154 |
| 653 | 3300047472 | Ga0495686_0000902 | Ga0495686_0000902_2580_3044 | 154 |
| 654 | 3300048905 | Ga0496102_0001780 | Ga0496102_0001780_11298_11762 | 154 |
| 655 | 3300048905 | Ga0496102_0024399 | Ga0496102_0024399_4071_4535 | 154 |
| 656 | 3300048909 | Ga0496106_0079932 | Ga0496106_0079932_1188_1670 | 154 |
| 657 | 3300048917 | Ga0496114_0030428 | Ga0496114_0030428_748_1212 | 154 |
| 658 | 3300048924 | Ga0496121_0023861 | Ga0496121_0023861_1221_1685 | 154 |
| 659 | 3300048928 | Ga0496125_0547291 | Ga0496125_0547291_101_565 | 154 |
| 660 | 3300048928 | Ga0496125_0661057 | Ga0496125_0661057_29_493 | 154 |
| 661 | 3300049539 | Ga0501323_010732 | Ga0501323_010732_219_683 | 154 |
| 662 | 3300049572 | Ga0501036_0933882 | Ga0501036_0933882_97_561 | 154 |
| 663 | 3300049579 | Ga0501043_0000108 | Ga0501043_0000108_43456_43920 | 154 |
| 664 | 3300049580 | Ga0501046_0000050 | Ga0501046_0000050_33448_33912 | 154 |
| 665 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_334920_335384 | 154 |
| 666 | 3300049582 | Ga0501048_0000521 | Ga0501048_0000521_17210_17674 | 154 |
| 667 | 3300049649 | Ga0501198_000030 | Ga0501198_000030_1828_2292 | 154 |
| 668 | 3300049662 | Ga0501222_000047 | Ga0501222_000047_1794_2258 | 154 |
| 669 | 3300049824 | Ga0501045_0315337 | Ga0501045_0315337_77_541 | 154 |
| 670 | 3300050489 | nmdc:mga03683_12840_c1 | nmdc:mga03683_12840_c1_2546_3010 | 154 |
| 671 | 3300050490 | nmdc:mga03n38_846963_c1 | nmdc:mga03n38_846963_c1_25_489 | 154 |
| 672 | 3300050491 | nmdc:mga00v17_117998_c1 | nmdc:mga00v17_117998_c1_120_584 | 154 |
| 673 | 3300050492 | nmdc:mga0yw44_280599_c1 | nmdc:mga0yw44_280599_c1_168_632 | 154 |
| 674 | 3300050493 | nmdc:mga0k408_270946_c1 | nmdc:mga0k408_270946_c1_424_888 | 154 |
| 675 | 3300050493 | nmdc:mga0k408_3090_c1 | nmdc:mga0k408_3090_c1_1104_1568 | 154 |
| 676 | 3300050493 | nmdc:mga0k408_311471_c1 | nmdc:mga0k408_311471_c1_437_901 | 154 |
| 677 | 3300050493 | nmdc:mga0k408_39231_c1 | nmdc:mga0k408_39231_c1_2207_2671 | 154 |
| 678 | 3300050493 | nmdc:mga0k408_417_c2 | nmdc:mga0k408_417_c2_2061_2525 | 154 |
| 679 | 3300050493 | nmdc:mga0k408_725_c1 | nmdc:mga0k408_725_c1_2154_2618 | 154 |
| 680 | 3300050494 | nmdc:mga06z11_142899_c1 | nmdc:mga06z11_142899_c1_729_1193 | 154 |
| 681 | 3300050494 | nmdc:mga06z11_390529_c1 | nmdc:mga06z11_390529_c1_188_652 | 154 |
| 682 | 3300050494 | nmdc:mga06z11_449297_c1 | nmdc:mga06z11_449297_c1_163_627 | 154 |
| 683 | 3300050495 | nmdc:mga04h51_130520_c1 | nmdc:mga04h51_130520_c1_261_725 | 154 |
| 684 | 3300050495 | nmdc:mga04h51_41706_c1 | nmdc:mga04h51_41706_c1_384_848 | 154 |
| 685 | 3300050495 | nmdc:mga04h51_69857_c1 | nmdc:mga04h51_69857_c1_746_1210 | 154 |
| 686 | 3300050496 | nmdc:mga07m45_160_c1 | nmdc:mga07m45_160_c1_18416_18880 | 154 |
| 687 | 3300050496 | nmdc:mga07m45_191726_c1 | nmdc:mga07m45_191726_c1_430_894 | 154 |
| 688 | 3300050496 | nmdc:mga07m45_196949_c1 | nmdc:mga07m45_196949_c1_261_725 | 154 |
| 689 | 3300050496 | nmdc:mga07m45_43396_c1 | nmdc:mga07m45_43396_c1_1841_2305 | 154 |
| 690 | 3300050496 | nmdc:mga07m45_6211_c1 | nmdc:mga07m45_6211_c1_4421_4885 | 154 |
| 691 | 3300050496 | nmdc:mga07m45_7544_c1 | nmdc:mga07m45_7544_c1_3867_4331 | 154 |
| 692 | 3300050496 | nmdc:mga07m45_9764_c1 | nmdc:mga07m45_9764_c1_2420_2884 | 154 |
| 693 | 3300050516 | nmdc:mga0sz30_17553_c1 | nmdc:mga0sz30_17553_c1_1248_1712 | 154 |
| 694 | 3300053086 | Ga0500578_0000537 | Ga0500578_0000537_42405_42869 | 154 |
| 695 | 3300053086 | Ga0500578_0056046 | Ga0500578_0056046_1283_1765 | 154 |
| 696 | 3300053088 | Ga0500644_0004699 | Ga0500644_0004699_2141_2605 | 154 |
| 697 | 3300053092 | Ga0500583_0288271 | Ga0500583_0288271_138_602 | 154 |
| 698 | 3300053093 | Ga0500651_0396466 | Ga0500651_0396466_156_620 | 154 |
| 699 | 3300053117 | Ga0500593_000152 | Ga0500593_000152_3029_3493 | 154 |
| 700 | 3300053130 | Ga0500642_0002803 | Ga0500642_0002803_940_1404 | 154 |
| 701 | 3300053131 | Ga0500652_000361 | Ga0500652_000361_3324_3788 | 154 |
| 702 | 3300053133 | Ga0500655_003842 | Ga0500655_003842_1688_2152 | 154 |
| 703 | 3300053134 | Ga0500658_0010005 | Ga0500658_0010005_2828_3292 | 154 |
| 704 | 3300053134 | Ga0500658_0156803 | Ga0500658_0156803_267_731 | 154 |
| 705 | 3300053137 | Ga0500561_0019926 | Ga0500561_0019926_585_1049 | 154 |
| 706 | 3300053137 | Ga0500561_0038360 | Ga0500561_0038360_761_1240 | 154 |
| 707 | 3300053139 | Ga0500568_0011426 | Ga0500568_0011426_388_852 | 154 |
| 708 | 3300053139 | Ga0500568_0014287 | Ga0500568_0014287_1091_1555 | 154 |
| 709 | 3300053142 | Ga0500577_0051585 | Ga0500577_0051585_859_1323 | 154 |
| 710 | 3300053143 | Ga0500579_203344 | Ga0500579_203344_116_580 | 154 |
| 711 | 3300053147 | Ga0500589_194371 | Ga0500589_194371_299_763 | 154 |
| 712 | 3300053153 | Ga0500616_0173273 | Ga0500616_0173273_477_941 | 154 |
| 713 | 3300053154 | Ga0500619_000004 | Ga0500619_000004_69648_70112 | 154 |
| 714 | 3300053156 | Ga0500622_0000423 | Ga0500622_0000423_37873_38337 | 154 |
| 715 | 3300053160 | Ga0500633_0186565 | Ga0500633_0186565_196_678 | 154 |
| 716 | 3300053724 | Ga0500570_045471 | Ga0500570_045471_134_598 | 154 |
| 717 | 3300053724 | Ga0500570_048548 | Ga0500570_048548_310_774 | 154 |
| 718 | 3300053726 | Ga0500584_134496 | Ga0500584_134496_407_871 | 154 |
| 719 | 3300053730 | Ga0500645_002532 | Ga0500645_002532_6851_7333 | 154 |
| 720 | 3300053739 | Ga0500587_012252 | Ga0500587_012252_431_895 | 154 |
| 721 | 3300059421 | Ga0590071_001450 | Ga0590071_001450_3403_3882 | 154 |
| 722 | 3300059423 | Ga0590074_043912 | Ga0590074_043912_79_558 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a4f-assembly1.cif.gz_AI | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) | 0.9928 | 14 | 87 |
| 7a4f-assembly1.cif.gz_AC | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) | 0.9825 | 14 | 87 |
| 7a4h-assembly1.cif.gz_BB | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9817 | 13 | 81 |
| 7a4h-assembly1.cif.gz_BK | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9786 | 13 | 81 |
| 7a4h-assembly1.cif.gz_BL | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9785 | 13 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mk3100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9668 | 13 | 152 | 3.40.50.960 |
| 1nqwC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9667 | 12 | 154 | 3.40.50.960 |
| af_B4FBV7_62_217_3.40.50.960 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9532 | 9 | 151 | 3.40.50.960 |
| 4kq6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9517 | 11 | 147 | 3.40.50.960 |
| 2vi5I00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9354 | 12 | 154 | 3.40.50.960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G4QCK0-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9894 | 13 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A077DE93-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9892 | 13 | 154 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A2G8SWT9-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9889 | 13 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A6N0ZF49-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9887 | 13 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A7X7CUF1-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9885 | 13 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar