F477155
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 319 | 718 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10375128|Ga0105245_103751283 |
| Length | 121 |
| Sequence | MDAYHALHPLDCHRADHEKELHMLYAIIGTDRPESLPARLAARPPHLARLQALRDAGRMVLAGPFPAIDSVDPGPAGFSGSLIVAEFASLQDAQAWADADPYIAAGVYEKVDVRPFRQTLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 147 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 151 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 159 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 160 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 161 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 163 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 175 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 183 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 184 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 185 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 186 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 187 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 188 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 189 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 190 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 198 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 199 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 202 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 206 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 267 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 273 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 298 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 313 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 315 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.66 |
| Metatranscriptomes | 3.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.99 |
| Nodule | 0 |
| Rhizoplane | 2.09 |
| Rhizosphere | 85.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10075712 | 3300003215 | Bacteria | 855 |
| 2 | Ga0055539_1000969 | 3300003752 | Bacteria | 6314 |
| 3 | Ga0055533_1000728 | 3300003756 | Bacteria | 10638 |
| 4 | Ga0055527_1000689 | 3300003760 | Bacteria | 9874 |
| 5 | Ga0055535_1001681 | 3300003761 | Bacteria | 10147 |
| 6 | Ga0055542_1001628 | 3300003762 | Bacteria | 10147 |
| 7 | Ga0055529_1001211 | 3300003763 | Bacteria | 10147 |
| 8 | Ga0070658_11265300 | 3300005327 | Bacteria | 641 |
| 9 | Ga0070670_100049790 | 3300005331 | Bacteria | 3601 |
| 10 | Ga0070670_100477308 | 3300005331 | Bacteria | 1107 |
| 11 | Ga0068869_100036368 | 3300005334 | Bacteria | 3496 |
| 12 | Ga0070666_10175091 | 3300005335 | Bacteria | 1504 |
| 13 | Ga0070666_10435552 | 3300005335 | Bacteria | 946 |
| 14 | Ga0068868_100103557 | 3300005338 | Bacteria | 2306 |
| 15 | Ga0068868_100292769 | 3300005338 | Bacteria | 1381 |
| 16 | Ga0070660_101499926 | 3300005339 | Bacteria | 573 |
| 17 | Ga0070689_100063654 | 3300005340 | Bacteria | 2870 |
| 18 | Ga0070687_100078080 | 3300005343 | Bacteria | 1798 |
| 19 | Ga0070661_100323668 | 3300005344 | Bacteria | 1204 |
| 20 | Ga0070661_100371567 | 3300005344 | Bacteria | 1126 |
| 21 | Ga0070668_100799529 | 3300005347 | Bacteria | 838 |
| 22 | Ga0070669_100080888 | 3300005353 | Bacteria | 2419 |
| 23 | Ga0070675_100635982 | 3300005354 | Bacteria | 969 |
| 24 | Ga0070671_100176346 | 3300005355 | Bacteria | 1809 |
| 25 | Ga0070673_101259562 | 3300005364 | Bacteria | 694 |
| 26 | Ga0070659_100579156 | 3300005366 | Bacteria | 963 |
| 27 | Ga0070667_100218838 | 3300005367 | Bacteria | 1695 |
| 28 | Ga0070667_100613544 | 3300005367 | Bacteria | 1003 |
| 29 | Ga0070714_100003135 | 3300005435 | Bacteria | 12279 |
| 30 | Ga0070714_101128759 | 3300005435 | Bacteria | 764 |
| 31 | Ga0070711_100383056 | 3300005439 | Bacteria | 1138 |
| 32 | Ga0070711_100466163 | 3300005439 | Bacteria | 1036 |
| 33 | Ga0070708_100033183 | 3300005445 | Bacteria | 4485 |
| 34 | Ga0070708_100332715 | 3300005445 | Bacteria | 1431 |
| 35 | Ga0070663_100490265 | 3300005455 | Bacteria | 1019 |
| 36 | Ga0070681_11284927 | 3300005458 | Unclassified | 654 |
| 37 | Ga0068867_100816346 | 3300005459 | Bacteria | 833 |
| 38 | Ga0070706_100343571 | 3300005467 | Bacteria | 1391 |
| 39 | Ga0070699_100784912 | 3300005518 | Bacteria | 872 |
| 40 | Ga0070697_100058903 | 3300005536 | Bacteria | 3126 |
| 41 | Ga0070697_100922230 | 3300005536 | Bacteria | 775 |
| 42 | Ga0068853_100005942 | 3300005539 | Bacteria | 9640 |
| 43 | Ga0068853_100096609 | 3300005539 | Bacteria | 2607 |
| 44 | Ga0068853_100330528 | 3300005539 | Bacteria | 1414 |
| 45 | Ga0068853_101183174 | 3300005539 | Bacteria | 738 |
| 46 | Ga0070672_100003097 | 3300005543 | Bacteria | 10729 |
| 47 | Ga0070672_100006127 | 3300005543 | Bacteria | 8048 |
| 48 | Ga0070696_100224466 | 3300005546 | Bacteria | 1411 |
| 49 | Ga0070665_100023062 | 3300005548 | Bacteria | 6269 |
| 50 | Ga0070665_100043640 | 3300005548 | Bacteria | 4505 |
| 51 | Ga0068855_100005893 | 3300005563 | Bacteria | 14940 |
| 52 | Ga0068855_100085911 | 3300005563 | Bacteria | 3639 |
| 53 | Ga0068855_101751500 | 3300005563 | Bacteria | 632 |
| 54 | Ga0070664_100375476 | 3300005564 | Bacteria | 1297 |
| 55 | Ga0068857_100034950 | 3300005577 | Bacteria | 4448 |
| 56 | Ga0068854_100849100 | 3300005578 | Bacteria | 799 |
| 57 | Ga0068856_100001563 | 3300005614 | Bacteria | 23973 |
| 58 | Ga0068856_100083087 | 3300005614 | Bacteria | 3180 |
| 59 | Ga0068856_100787046 | 3300005614 | Bacteria | 971 |
| 60 | Ga0068866_10703429 | 3300005718 | Unclassified | 693 |
| 61 | Ga0068861_101682402 | 3300005719 | Bacteria | 627 |
| 62 | Ga0068863_100524601 | 3300005841 | Bacteria | 1168 |
| 63 | Ga0075365_11189769 | 3300006038 | Bacteria | 536 |
| 64 | Ga0075364_10022744 | 3300006051 | Bacteria | 3963 |
| 65 | Ga0070712_101491878 | 3300006175 | Bacteria | 591 |
| 66 | Ga0070712_101711802 | 3300006175 | Unclassified | 550 |
| 67 | Ga0075369_10027825 | 3300006186 | Bacteria | 2365 |
| 68 | Ga0075366_10019991 | 3300006195 | Bacteria | 3881 |
| 69 | Ga0075366_10062156 | 3300006195 | Unclassified | 2220 |
| 70 | Ga0075366_10099444 | 3300006195 | Bacteria | 1745 |
| 71 | Ga0075366_10221389 | 3300006195 | Bacteria | 1153 |
| 72 | Ga0097621_100018815 | 3300006237 | Bacteria | 5287 |
| 73 | Ga0097621_100051918 | 3300006237 | Bacteria | 3338 |
| 74 | Ga0068871_100008112 | 3300006358 | Bacteria | 7539 |
| 75 | Ga0068871_100070200 | 3300006358 | Bacteria | 2879 |
| 76 | Ga0068871_100187299 | 3300006358 | Bacteria | 1781 |
| 77 | Ga0075430_101250026 | 3300006846 | Unclassified | 611 |
| 78 | Ga0068865_100047406 | 3300006881 | Bacteria | 2952 |
| 79 | Ga0105250_10000398 | 3300009092 | Bacteria | 32150 |
| 80 | Ga0105250_10047216 | 3300009092 | Bacteria | 1727 |
| 81 | Ga0105240_10012696 | 3300009093 | Bacteria | 11610 |
| 82 | Ga0105240_10020043 | 3300009093 | Bacteria | 8928 |
| 83 | Ga0105240_11262537 | 3300009093 | Bacteria | 780 |
| 84 | Ga0105245_10375128 | 3300009098 | Bacteria | 1415 |
| 85 | Ga0105245_11594672 | 3300009098 | Unclassified | 704 |
| 86 | Ga0105245_11921735 | 3300009098 | Bacteria | 645 |
| 87 | Ga0105245_13287675 | 3300009098 | Bacteria | 500 |
| 88 | Ga0105243_11122627 | 3300009148 | Bacteria | 796 |
| 89 | Ga0105241_10007901 | 3300009174 | Bacteria | 7820 |
| 90 | Ga0105241_10568076 | 3300009174 | Bacteria | 1020 |
| 91 | Ga0105242_10035574 | 3300009176 | Bacteria | 3993 |
| 92 | Ga0105242_10415718 | 3300009176 | Bacteria | 1259 |
| 93 | Ga0105237_10230058 | 3300009545 | Bacteria | 1855 |
| 94 | Ga0105237_10659516 | 3300009545 | Bacteria | 1053 |
| 95 | Ga0105238_10078836 | 3300009551 | Bacteria | 3284 |
| 96 | Ga0105238_11999375 | 3300009551 | Unclassified | 613 |
| 97 | Ga0105249_10641648 | 3300009553 | Bacteria | 1119 |
| 98 | Ga0105249_10949011 | 3300009553 | Bacteria | 928 |
| 99 | Ga0105239_11025634 | 3300010375 | Bacteria | 949 |
| 100 | Ga0105239_13650391 | 3300010375 | Bacteria | 500 |
| 101 | Ga0105246_11503899 | 3300011119 | Bacteria | 632 |
| 102 | Ga0157373_10672199 | 3300013100 | Bacteria | 757 |
| 103 | Ga0157370_10082368 | 3300013104 | Bacteria | 3026 |
| 104 | Ga0157370_10225213 | 3300013104 | Bacteria | 1736 |
| 105 | Ga0157370_10454415 | 3300013104 | Bacteria | 1177 |
| 106 | Ga0157370_10725149 | 3300013104 | Bacteria | 906 |
| 107 | Ga0157370_10925468 | 3300013104 | Bacteria | 791 |
| 108 | Ga0157369_10000107 | 3300013105 | Bacteria | 117307 |
| 109 | Ga0157374_10001069 | 3300013296 | Bacteria | 23735 |
| 110 | Ga0157374_10189321 | 3300013296 | Bacteria | 2012 |
| 111 | Ga0157374_11212395 | 3300013296 | Bacteria | 776 |
| 112 | Ga0157378_10133862 | 3300013297 | Bacteria | 2297 |
| 113 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 114 | Ga0163162_10018484 | 3300013306 | Bacteria | 6830 |
| 115 | Ga0163162_10129315 | 3300013306 | Bacteria | 2634 |
| 116 | Ga0163162_10146958 | 3300013306 | Bacteria | 2474 |
| 117 | Ga0163162_12364566 | 3300013306 | Bacteria | 611 |
| 118 | Ga0157372_10130695 | 3300013307 | Bacteria | 2889 |
| 119 | Ga0157372_10153701 | 3300013307 | Bacteria | 2657 |
| 120 | Ga0157372_10197696 | 3300013307 | Bacteria | 2329 |
| 121 | Ga0157372_10529701 | 3300013307 | Bacteria | 1373 |
| 122 | Ga0157375_10008003 | 3300013308 | Bacteria | 9256 |
| 123 | Ga0157375_10017610 | 3300013308 | Bacteria | 6451 |
| 124 | Ga0157375_10346480 | 3300013308 | Bacteria | 1651 |
| 125 | Ga0157375_10394930 | 3300013308 | Bacteria | 1550 |
| 126 | Ga0157375_11529536 | 3300013308 | Bacteria | 788 |
| 127 | Ga0163163_10000877 | 3300014325 | Bacteria | 25623 |
| 128 | Ga0157380_10271205 | 3300014326 | Bacteria | 1547 |
| 129 | Ga0182008_10498293 | 3300014497 | Bacteria | 669 |
| 130 | Ga0157376_10036763 | 3300014969 | Bacteria | 3969 |
| 131 | Ga0157376_10069159 | 3300014969 | Bacteria | 2992 |
| 132 | Ga0157376_10084090 | 3300014969 | Bacteria | 2739 |
| 133 | Ga0157376_10329284 | 3300014969 | Bacteria | 1455 |
| 134 | Ga0157376_10341116 | 3300014969 | Bacteria | 1431 |
| 135 | Ga0182006_1000027 | 3300015261 | Bacteria | 252946 |
| 136 | Ga0182007_10026262 | 3300015262 | Bacteria | 2021 |
| 137 | Ga0182005_1116436 | 3300015265 | Bacteria | 758 |
| 138 | Ga0182005_1133497 | 3300015265 | Bacteria | 713 |
| 139 | Ga0163161_10028934 | 3300017792 | Bacteria | 3937 |
| 140 | Ga0163161_10171676 | 3300017792 | Bacteria | 1658 |
| 141 | Ga0163161_10277407 | 3300017792 | Bacteria | 1314 |
| 142 | Ga0213872_10000114 | 3300021361 | Bacteria | 74773 |
| 143 | Ga0213872_10001215 | 3300021361 | Bacteria | 17431 |
| 144 | Ga0213872_10003003 | 3300021361 | Bacteria | 9533 |
| 145 | Ga0213872_10043645 | 3300021361 | Bacteria | 2042 |
| 146 | Ga0209674_100108 | 3300025226 | Bacteria | 150893 |
| 147 | Ga0209674_100193 | 3300025226 | Bacteria | 65447 |
| 148 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 149 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 150 | Ga0209677_100725 | 3300025253 | Bacteria | 16786 |
| 151 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 152 | Ga0209129_1001003 | 3300025258 | Bacteria | 16831 |
| 153 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 154 | Ga0209758_1017824 | 3300025297 | Bacteria | 3511 |
| 155 | Ga0209051_1017881 | 3300025303 | Bacteria | 3156 |
| 156 | Ga0209051_1020949 | 3300025303 | Bacteria | 2799 |
| 157 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 158 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 159 | Ga0207680_10036335 | 3300025903 | Bacteria | 2837 |
| 160 | Ga0207680_10097066 | 3300025903 | Bacteria | 1886 |
| 161 | Ga0207647_10000228 | 3300025904 | Bacteria | 46540 |
| 162 | Ga0207699_10767495 | 3300025906 | Bacteria | 708 |
| 163 | Ga0207645_10004105 | 3300025907 | Bacteria | 10836 |
| 164 | Ga0207645_10597737 | 3300025907 | Bacteria | 749 |
| 165 | Ga0207705_11355132 | 3300025909 | Bacteria | 542 |
| 166 | Ga0207684_10155282 | 3300025910 | Bacteria | 1970 |
| 167 | Ga0207654_10003007 | 3300025911 | Bacteria | 8558 |
| 168 | Ga0207695_10010495 | 3300025913 | Bacteria | 11330 |
| 169 | Ga0207695_10016538 | 3300025913 | Bacteria | 8625 |
| 170 | Ga0207671_10645067 | 3300025914 | Bacteria | 843 |
| 171 | Ga0207693_11057425 | 3300025915 | Bacteria | 618 |
| 172 | Ga0207663_10428932 | 3300025916 | Bacteria | 1016 |
| 173 | Ga0207663_11170712 | 3300025916 | Unclassified | 619 |
| 174 | Ga0207663_11496001 | 3300025916 | Bacteria | 544 |
| 175 | Ga0207662_10097766 | 3300025918 | Bacteria | 1815 |
| 176 | Ga0207662_10670909 | 3300025918 | Bacteria | 725 |
| 177 | Ga0207657_10737573 | 3300025919 | Bacteria | 764 |
| 178 | Ga0207649_10299750 | 3300025920 | Bacteria | 1175 |
| 179 | Ga0207649_11182276 | 3300025920 | Bacteria | 604 |
| 180 | Ga0207650_10272912 | 3300025925 | Bacteria | 1375 |
| 181 | Ga0207650_11888316 | 3300025925 | Bacteria | 505 |
| 182 | Ga0207659_10122833 | 3300025926 | Bacteria | 1992 |
| 183 | Ga0207659_10993861 | 3300025926 | Bacteria | 722 |
| 184 | Ga0207687_10717413 | 3300025927 | Unclassified | 849 |
| 185 | Ga0207687_11391297 | 3300025927 | Bacteria | 603 |
| 186 | Ga0207700_10127745 | 3300025928 | Bacteria | 2071 |
| 187 | Ga0207700_10869651 | 3300025928 | Unclassified | 807 |
| 188 | Ga0207664_10003195 | 3300025929 | Bacteria | 10890 |
| 189 | Ga0207664_10741864 | 3300025929 | Bacteria | 883 |
| 190 | Ga0207664_11356738 | 3300025929 | Bacteria | 631 |
| 191 | Ga0207644_10241602 | 3300025931 | Bacteria | 1438 |
| 192 | Ga0207690_10045337 | 3300025932 | Bacteria | 2904 |
| 193 | Ga0207686_10041543 | 3300025934 | Bacteria | 2805 |
| 194 | Ga0207686_10733287 | 3300025934 | Bacteria | 788 |
| 195 | Ga0207670_10099376 | 3300025936 | Bacteria | 2076 |
| 196 | Ga0207669_10837794 | 3300025937 | Bacteria | 765 |
| 197 | Ga0207704_10050600 | 3300025938 | Bacteria | 2507 |
| 198 | Ga0207704_10193768 | 3300025938 | Bacteria | 1480 |
| 199 | Ga0207691_10007159 | 3300025940 | Bacteria | 10762 |
| 200 | Ga0207691_10015655 | 3300025940 | Bacteria | 7208 |
| 201 | Ga0207711_10611663 | 3300025941 | Bacteria | 1017 |
| 202 | Ga0207689_10021038 | 3300025942 | Bacteria | 5484 |
| 203 | Ga0207689_10041169 | 3300025942 | Bacteria | 3823 |
| 204 | Ga0207679_10398126 | 3300025945 | Bacteria | 1211 |
| 205 | Ga0207667_10002442 | 3300025949 | Bacteria | 23238 |
| 206 | Ga0207667_10266294 | 3300025949 | Bacteria | 1752 |
| 207 | Ga0207651_10067790 | 3300025960 | Bacteria | 2513 |
| 208 | Ga0207712_10625661 | 3300025961 | Bacteria | 933 |
| 209 | Ga0207668_11932808 | 3300025972 | Bacteria | 532 |
| 210 | Ga0207658_10458919 | 3300025986 | Bacteria | 1129 |
| 211 | Ga0207658_10471470 | 3300025986 | Bacteria | 1114 |
| 212 | Ga0207677_10841785 | 3300026023 | Bacteria | 824 |
| 213 | Ga0207639_10001611 | 3300026041 | Bacteria | 15191 |
| 214 | Ga0207639_10141071 | 3300026041 | Bacteria | 2008 |
| 215 | Ga0207639_11116685 | 3300026041 | Bacteria | 739 |
| 216 | Ga0207639_12293897 | 3300026041 | Unclassified | 501 |
| 217 | Ga0207678_10351673 | 3300026067 | Bacteria | 1271 |
| 218 | Ga0207702_10000265 | 3300026078 | Bacteria | 60212 |
| 219 | Ga0207648_10122465 | 3300026089 | Bacteria | 2287 |
| 220 | Ga0207648_11224352 | 3300026089 | Bacteria | 705 |
| 221 | Ga0207674_10132242 | 3300026116 | Bacteria | 2458 |
| 222 | Ga0207674_10612777 | 3300026116 | Bacteria | 1051 |
| 223 | Ga0207683_10027916 | 3300026121 | Bacteria | 4878 |
| 224 | Ga0207698_10673496 | 3300026142 | Bacteria | 1027 |
| 225 | Ga0268266_10050113 | 3300028379 | Bacteria | 3582 |
| 226 | Ga0265336_10000635 | 3300028666 | Bacteria | 19337 |
| 227 | Ga0265336_10006849 | 3300028666 | Bacteria | 4080 |
| 228 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 229 | Ga0265324_10001952 | 3300029957 | Bacteria | 11051 |
| 230 | Ga0265324_10102855 | 3300029957 | Bacteria | 970 |
| 231 | Ga0265324_10119162 | 3300029957 | Bacteria | 896 |
| 232 | Ga0265330_10036623 | 3300031235 | Bacteria | 2186 |
| 233 | Ga0265328_10049087 | 3300031239 | Bacteria | 1550 |
| 234 | Ga0265328_10365586 | 3300031239 | Bacteria | 563 |
| 235 | Ga0265325_10001045 | 3300031241 | Bacteria | 19966 |
| 236 | Ga0265325_10012166 | 3300031241 | Bacteria | 4925 |
| 237 | Ga0265331_10005415 | 3300031250 | Bacteria | 7707 |
| 238 | Ga0265331_10011631 | 3300031250 | Bacteria | 4812 |
| 239 | Ga0265331_10036638 | 3300031250 | Bacteria | 2407 |
| 240 | Ga0265331_10079529 | 3300031250 | Bacteria | 1525 |
| 241 | Ga0265331_10159281 | 3300031250 | Bacteria | 1023 |
| 242 | Ga0265331_10161473 | 3300031250 | Bacteria | 1015 |
| 243 | Ga0265331_10175274 | 3300031250 | Bacteria | 969 |
| 244 | Ga0265327_10000217 | 3300031251 | Bacteria | 117085 |
| 245 | Ga0265327_10000263 | 3300031251 | Bacteria | 104045 |
| 246 | Ga0265327_10000384 | 3300031251 | Bacteria | 83284 |
| 247 | Ga0265327_10000451 | 3300031251 | Bacteria | 73966 |
| 248 | Ga0265327_10001651 | 3300031251 | Bacteria | 26917 |
| 249 | Ga0265327_10003428 | 3300031251 | Bacteria | 15161 |
| 250 | Ga0265327_10014981 | 3300031251 | Bacteria | 5041 |
| 251 | Ga0265327_10075927 | 3300031251 | Bacteria | 1671 |
| 252 | Ga0265327_10088011 | 3300031251 | Bacteria | 1520 |
| 253 | Ga0265327_10183608 | 3300031251 | Bacteria | 955 |
| 254 | Ga0265327_10366397 | 3300031251 | Bacteria | 628 |
| 255 | Ga0265316_10000415 | 3300031344 | Bacteria | 48828 |
| 256 | Ga0265316_10132038 | 3300031344 | Bacteria | 1880 |
| 257 | Ga0265316_10674948 | 3300031344 | Bacteria | 729 |
| 258 | Ga0265316_10793138 | 3300031344 | Bacteria | 665 |
| 259 | Ga0307509_10000033 | 3300031507 | Bacteria | 194363 |
| 260 | Ga0307509_10061303 | 3300031507 | Bacteria | 3972 |
| 261 | Ga0307509_10953348 | 3300031507 | Bacteria | 524 |
| 262 | Ga0307408_100138751 | 3300031548 | Bacteria | 1906 |
| 263 | Ga0307408_100771864 | 3300031548 | Bacteria | 870 |
| 264 | Ga0316575_10006222 | 3300031665 | Bacteria | 4283 |
| 265 | Ga0316575_10042932 | 3300031665 | Bacteria | 1791 |
| 266 | Ga0316575_10133854 | 3300031665 | Bacteria | 1018 |
| 267 | Ga0316575_10196060 | 3300031665 | Bacteria | 840 |
| 268 | Ga0316575_10224117 | 3300031665 | Bacteria | 785 |
| 269 | Ga0316575_10286563 | 3300031665 | Bacteria | 695 |
| 270 | Ga0316575_10410854 | 3300031665 | Bacteria | 581 |
| 271 | Ga0316575_10537856 | 3300031665 | Bacteria | 509 |
| 272 | Ga0316579_10002808 | 3300031691 | Bacteria | 6658 |
| 273 | Ga0316579_10005314 | 3300031691 | Bacteria | 5189 |
| 274 | Ga0316579_10106037 | 3300031691 | Bacteria | 1347 |
| 275 | Ga0316579_10139971 | 3300031691 | Bacteria | 1166 |
| 276 | Ga0316579_10265492 | 3300031691 | Bacteria | 830 |
| 277 | Ga0316579_10308419 | 3300031691 | Bacteria | 765 |
| 278 | Ga0316579_10359585 | 3300031691 | Unclassified | 704 |
| 279 | Ga0265314_10000695 | 3300031711 | Bacteria | 40901 |
| 280 | Ga0265314_10044803 | 3300031711 | Bacteria | 3132 |
| 281 | Ga0265314_10244154 | 3300031711 | Bacteria | 1034 |
| 282 | Ga0265314_10582371 | 3300031711 | Bacteria | 578 |
| 283 | Ga0316576_10012034 | 3300031727 | Bacteria | 5700 |
| 284 | Ga0316576_10023904 | 3300031727 | Bacteria | 4263 |
| 285 | Ga0316576_10092384 | 3300031727 | Bacteria | 2255 |
| 286 | Ga0316576_10111617 | 3300031727 | Bacteria | 2049 |
| 287 | Ga0316576_10228420 | 3300031727 | Bacteria | 1399 |
| 288 | Ga0316576_10234281 | 3300031727 | Bacteria | 1380 |
| 289 | Ga0316576_10604169 | 3300031727 | Bacteria | 801 |
| 290 | Ga0316576_10912995 | 3300031727 | Bacteria | 628 |
| 291 | Ga0316576_11324248 | 3300031727 | Bacteria | 506 |
| 292 | Ga0316578_10007293 | 3300031728 | Bacteria | 5533 |
| 293 | Ga0316578_10010611 | 3300031728 | Bacteria | 4789 |
| 294 | Ga0316578_10056810 | 3300031728 | Bacteria | 2299 |
| 295 | Ga0316578_10061543 | 3300031728 | Bacteria | 2212 |
| 296 | Ga0316578_10062242 | 3300031728 | Bacteria | 2200 |
| 297 | Ga0316578_10149733 | 3300031728 | Bacteria | 1406 |
| 298 | Ga0316578_10239849 | 3300031728 | Bacteria | 1088 |
| 299 | Ga0316578_10316154 | 3300031728 | Bacteria | 932 |
| 300 | Ga0316578_10452038 | 3300031728 | Bacteria | 759 |
| 301 | Ga0316578_10604164 | 3300031728 | Bacteria | 642 |
| 302 | Ga0316577_10004833 | 3300031733 | Bacteria | 7006 |
| 303 | Ga0316577_10013861 | 3300031733 | Bacteria | 4419 |
| 304 | Ga0316577_10023862 | 3300031733 | Bacteria | 3396 |
| 305 | Ga0316577_10134076 | 3300031733 | Bacteria | 1394 |
| 306 | Ga0316577_10197181 | 3300031733 | Bacteria | 1138 |
| 307 | Ga0307413_10068741 | 3300031824 | Bacteria | 2220 |
| 308 | Ga0307413_10082143 | 3300031824 | Bacteria | 2069 |
| 309 | Ga0307407_10894506 | 3300031903 | Bacteria | 681 |
| 310 | Ga0307409_102669715 | 3300031995 | Bacteria | 528 |
| 311 | Ga0307416_100234135 | 3300032002 | Bacteria | 1773 |
| 312 | Ga0307414_10005069 | 3300032004 | Bacteria | 7219 |
| 313 | Ga0307414_10160577 | 3300032004 | Bacteria | 1785 |
| 314 | Ga0307411_10230912 | 3300032005 | Bacteria | 1442 |
| 315 | Ga0316583_10187225 | 3300032133 | Unclassified | 719 |
| 316 | Ga0316585_10062376 | 3300032137 | Bacteria | 1205 |
| 317 | Ga0316585_10200746 | 3300032137 | Bacteria | 659 |
| 318 | Ga0316585_10245587 | 3300032137 | Bacteria | 593 |
| 319 | Ga0316580_10008941 | 3300032139 | Bacteria | 3009 |
| 320 | Ga0316580_10159362 | 3300032139 | Unclassified | 693 |
| 321 | Ga0316593_10001438 | 3300032168 | Bacteria | 5250 |
| 322 | Ga0316593_10005218 | 3300032168 | Bacteria | 3408 |
| 323 | Ga0316593_10007592 | 3300032168 | Bacteria | 2984 |
| 324 | Ga0316593_10009320 | 3300032168 | Bacteria | 2767 |
| 325 | Ga0316593_10021089 | 3300032168 | Bacteria | 2034 |
| 326 | Ga0316593_10030402 | 3300032168 | Bacteria | 1753 |
| 327 | Ga0316593_10038088 | 3300032168 | Bacteria | 1591 |
| 328 | Ga0316593_10051481 | 3300032168 | Bacteria | 1392 |
| 329 | Ga0316593_10239656 | 3300032168 | Bacteria | 677 |
| 330 | Ga0307507_10115035 | 3300033179 | Bacteria | 2179 |
| 331 | Ga0316592_1001647 | 3300033524 | Bacteria | 3672 |
| 332 | Ga0316592_1004031 | 3300033524 | Bacteria | 2703 |
| 333 | Ga0316586_1006539 | 3300033527 | Bacteria | 1674 |
| 334 | Ga0316586_1011285 | 3300033527 | Bacteria | 1366 |
| 335 | Ga0316586_1082190 | 3300033527 | Unclassified | 602 |
| 336 | Ga0316588_1002175 | 3300033528 | Bacteria | 3381 |
| 337 | Ga0316587_1000605 | 3300033529 | Bacteria | 3789 |
| 338 | Ga0316587_1001369 | 3300033529 | Bacteria | 2981 |
| 339 | Ga0316587_1026280 | 3300033529 | Bacteria | 1014 |
| 340 | Ga0316587_1066493 | 3300033529 | Bacteria | 672 |
| 341 | Ga0316596_1002607 | 3300033541 | Bacteria | 3868 |
| 342 | Ga0316596_1003987 | 3300033541 | Bacteria | 3274 |
| 343 | Ga0316596_1005395 | 3300033541 | Bacteria | 2919 |
| 344 | Ga0316596_1017537 | 3300033541 | Bacteria | 1801 |
| 345 | Ga0316596_1156885 | 3300033541 | Bacteria | 626 |
| 346 | Ga0373934_0031476 | 3300035086 | Bacteria | 2077 |
| 347 | Ga0373949_0156436 | 3300035090 | Bacteria | 662 |
| 348 | Ga0373960_0347069 | 3300035121 | Unclassified | 562 |
| 349 | Ga0373955_0280213 | 3300035172 | Bacteria | 1003 |
| 350 | Ga0316574_0000917 | 3300035398 | Bacteria | 13080 |
| 351 | Ga0316574_0006438 | 3300035398 | Bacteria | 6349 |
| 352 | Ga0316574_0016304 | 3300035398 | Bacteria | 4328 |
| 353 | Ga0316574_0017949 | 3300035398 | Bacteria | 4149 |
| 354 | Ga0316574_0024050 | 3300035398 | Bacteria | 3642 |
| 355 | Ga0316574_0031363 | 3300035398 | Bacteria | 3224 |
| 356 | Ga0316574_0043388 | 3300035398 | Bacteria | 2779 |
| 357 | Ga0316574_0063386 | 3300035398 | Bacteria | 2324 |
| 358 | Ga0316574_0065877 | 3300035398 | Bacteria | 2281 |
| 359 | Ga0316574_0070611 | 3300035398 | Bacteria | 2205 |
| 360 | Ga0316574_0158006 | 3300035398 | Bacteria | 1461 |
| 361 | Ga0316574_0197633 | 3300035398 | Bacteria | 1292 |
| 362 | Ga0316574_0322234 | 3300035398 | Unclassified | 981 |
| 363 | Ga0316574_0329566 | 3300035398 | Unclassified | 968 |
| 364 | Ga0316574_0359894 | 3300035398 | Bacteria | 920 |
| 365 | Ga0316574_0470007 | 3300035398 | Bacteria | 786 |
| 366 | Ga0316574_0538927 | 3300035398 | Bacteria | 725 |
| 367 | Ga0316574_0640603 | 3300035398 | Bacteria | 655 |
| 368 | Ga0316574_0785017 | 3300035398 | Bacteria | 580 |
| 369 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 370 | Ga0316582_0002409 | 3300036647 | Bacteria | 8769 |
| 371 | Ga0316582_0002944 | 3300036647 | Bacteria | 8193 |
| 372 | Ga0316582_0003473 | 3300036647 | Bacteria | 7737 |
| 373 | Ga0316582_0010224 | 3300036647 | Bacteria | 5129 |
| 374 | Ga0316582_0020160 | 3300036647 | Bacteria | 3917 |
| 375 | Ga0316582_0121405 | 3300036647 | Bacteria | 1748 |
| 376 | Ga0316582_0196440 | 3300036647 | Bacteria | 1375 |
| 377 | Ga0316582_0221996 | 3300036647 | Bacteria | 1292 |
| 378 | Ga0316582_0302263 | 3300036647 | Bacteria | 1099 |
| 379 | Ga0316582_0316738 | 3300036647 | Bacteria | 1072 |
| 380 | Ga0316582_0669850 | 3300036647 | Bacteria | 713 |
| 381 | Ga0316584_0000296 | 3300036712 | Bacteria | 25440 |
| 382 | Ga0316584_0004769 | 3300036712 | Bacteria | 8993 |
| 383 | Ga0316584_0009712 | 3300036712 | Bacteria | 6691 |
| 384 | Ga0316584_0022679 | 3300036712 | Bacteria | 4582 |
| 385 | Ga0316584_0038020 | 3300036712 | Bacteria | 3579 |
| 386 | Ga0316584_0054814 | 3300036712 | Bacteria | 2985 |
| 387 | Ga0316584_0085991 | 3300036712 | Bacteria | 2354 |
| 388 | Ga0316584_0181699 | 3300036712 | Bacteria | 1557 |
| 389 | Ga0316584_0245427 | 3300036712 | Bacteria | 1309 |
| 390 | Ga0316584_0530190 | 3300036712 | Bacteria | 824 |
| 391 | Ga0316584_0719068 | 3300036712 | Bacteria | 683 |
| 392 | Ga0395899_0057003 | 3300037312 | Bacteria | 2885 |
| 393 | Ga0395899_0200134 | 3300037312 | Bacteria | 1393 |
| 394 | Ga0395899_0919260 | 3300037312 | Bacteria | 532 |
| 395 | Ga0395900_0007174 | 3300037418 | Bacteria | 11550 |
| 396 | Ga0395900_0064142 | 3300037418 | Bacteria | 3776 |
| 397 | Ga0395900_0664007 | 3300037418 | Unclassified | 978 |
| 398 | Ga0395898_0044148 | 3300037466 | Bacteria | 4390 |
| 399 | Ga0395898_0127063 | 3300037466 | Bacteria | 2442 |
| 400 | Ga0395905_0093701 | 3300037471 | Bacteria | 2817 |
| 401 | Ga0395905_0143599 | 3300037471 | Bacteria | 2246 |
| 402 | Ga0316581_0020940 | 3300037588 | Bacteria | 1918 |
| 403 | Ga0316581_0045368 | 3300037588 | Bacteria | 1342 |
| 404 | Ga0316581_0067708 | 3300037588 | Bacteria | 1096 |
| 405 | Ga0395901_0009614 | 3300038443 | Bacteria | 9807 |
| 406 | Ga0395901_0077019 | 3300038443 | Bacteria | 3480 |
| 407 | Ga0395901_0085496 | 3300038443 | Bacteria | 3298 |
| 408 | Ga0400484_13421 | 3300038725 | Bacteria | 33582 |
| 409 | Ga0400484_36729 | 3300038725 | Unclassified | 2030 |
| 410 | Ga0400490_57276 | 3300038726 | Bacteria | 13433 |
| 411 | Ga0400490_60783 | 3300038726 | Bacteria | 8098 |
| 412 | Ga0400491_13912 | 3300038727 | Unclassified | 2097 |
| 413 | Ga0400491_26096 | 3300038727 | Bacteria | 2362 |
| 414 | Ga0400485_07884 | 3300038735 | Bacteria | 123132 |
| 415 | Ga0400488_12060 | 3300038741 | Bacteria | 10322 |
| 416 | Ga0400488_14459 | 3300038741 | Bacteria | 3518 |
| 417 | Ga0400488_38117 | 3300038741 | Unclassified | 1666 |
| 418 | Ga0400488_47132 | 3300038741 | Bacteria | 1208 |
| 419 | Ga0400488_62074 | 3300038741 | Bacteria | 18243 |
| 420 | Ga0400486_28685 | 3300038742 | Bacteria | 138069 |
| 421 | Ga0400483_074278 | 3300039062 | Bacteria | 2760 |
| 422 | Ga0400483_078872 | 3300039062 | Bacteria | 19759 |
| 423 | Ga0400483_243724 | 3300039062 | Bacteria | 2051 |
| 424 | Ga0400483_261783 | 3300039062 | Bacteria | 2368 |
| 425 | Ga0400483_262546 | 3300039062 | Unclassified | 1925 |
| 426 | Ga0400489_37628 | 3300039093 | Bacteria | 1292 |
| 427 | Ga0400487_17750 | 3300039110 | Bacteria | 2698 |
| 428 | Ga0400487_19743 | 3300039110 | Bacteria | 12773 |
| 429 | Ga0400487_27243 | 3300039110 | Bacteria | 18394 |
| 430 | Ga0400487_63494 | 3300039110 | Bacteria | 48331 |
| 431 | Ga0436361_0215157 | 3300039447 | Bacteria | 166868 |
| 432 | Ga0436361_0406661 | 3300039447 | Bacteria | 15607 |
| 433 | Ga0436361_0857217 | 3300039447 | Bacteria | 1039 |
| 434 | Ga0436361_0880017 | 3300039447 | Bacteria | 8784 |
| 435 | Ga0436361_0883037 | 3300039447 | Bacteria | 610 |
| 436 | Ga0436361_1012185 | 3300039447 | Bacteria | 1084 |
| 437 | Ga0436361_1132645 | 3300039447 | Bacteria | 4350 |
| 438 | Ga0439436_0010326 | 3300041404 | Bacteria | 2850 |
| 439 | Ga0439439_0001670 | 3300041406 | Bacteria | 4499 |
| 440 | Ga0451795_0341801 | 3300041456 | Bacteria | 2087 |
| 441 | Ga0451802_0570730 | 3300041460 | Bacteria | 1095 |
| 442 | Ga0451807_0581176 | 3300041486 | Bacteria | 820 |
| 443 | Ga0451807_2618503 | 3300041486 | Bacteria | 1680 |
| 444 | Ga0451837_1382718 | 3300041494 | Bacteria | 2521 |
| 445 | Ga0439445_0004296 | 3300042004 | Bacteria | 3224 |
| 446 | Ga0439445_0123772 | 3300042004 | Bacteria | 743 |
| 447 | Ga0439432_008540 | 3300042006 | Bacteria | 3594 |
| 448 | Ga0439449_0019101 | 3300042007 | Bacteria | 2570 |
| 449 | Ga0439455_0176088 | 3300042012 | Bacteria | 615 |
| 450 | Ga0439462_0012694 | 3300042015 | Bacteria | 2153 |
| 451 | Ga0451577_0050976 | 3300042876 | Bacteria | 3694 |
| 452 | Ga0451577_0087260 | 3300042876 | Bacteria | 2784 |
| 453 | Ga0451577_0119469 | 3300042876 | Bacteria | 2361 |
| 454 | Ga0451577_0264760 | 3300042876 | Bacteria | 1556 |
| 455 | Ga0451577_0269066 | 3300042876 | Unclassified | 1543 |
| 456 | Ga0451577_0874135 | 3300042876 | Bacteria | 810 |
| 457 | Ga0451577_0908700 | 3300042876 | Bacteria | 793 |
| 458 | Ga0466969_0008592 | 3300044656 | Bacteria | 5417 |
| 459 | Ga0466969_0022510 | 3300044656 | Bacteria | 3252 |
| 460 | Ga0466975_0340179 | 3300044661 | Bacteria | 945 |
| 461 | Ga0453683_0204910 | 3300044673 | Bacteria | 1252 |
| 462 | Ga0466965_0011487 | 3300044683 | Bacteria | 4152 |
| 463 | Ga0466966_0011013 | 3300044684 | Bacteria | 6002 |
| 464 | Ga0466966_0024354 | 3300044684 | Bacteria | 3960 |
| 465 | Ga0466961_0000131 | 3300044693 | Bacteria | 50219 |
| 466 | Ga0466961_0003687 | 3300044693 | Bacteria | 9559 |
| 467 | Ga0466961_0004743 | 3300044693 | Bacteria | 8557 |
| 468 | Ga0453684_0004710 | 3300044712 | Bacteria | 28217 |
| 469 | Ga0453684_0007598 | 3300044712 | Bacteria | 19866 |
| 470 | Ga0453684_0013476 | 3300044712 | Bacteria | 13271 |
| 471 | Ga0453684_0212635 | 3300044712 | Bacteria | 2247 |
| 472 | Ga0453684_0237233 | 3300044712 | Bacteria | 2102 |
| 473 | Ga0453684_0778832 | 3300044712 | Bacteria | 1033 |
| 474 | Ga0453684_1795844 | 3300044712 | Bacteria | 623 |
| 475 | Ga0466970_0052824 | 3300044765 | Bacteria | 2169 |
| 476 | Ga0466970_0109262 | 3300044765 | Bacteria | 1510 |
| 477 | Ga0466957_0109237 | 3300044842 | Bacteria | 1752 |
| 478 | Ga0466959_0000232 | 3300045049 | Bacteria | 35011 |
| 479 | Ga0466959_0000838 | 3300045049 | Bacteria | 18168 |
| 480 | Ga0466959_1073702 | 3300045049 | Bacteria | 535 |
| 481 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 482 | Ga0451576_0000250 | 3300045051 | Bacteria | 132101 |
| 483 | Ga0451576_0001427 | 3300045051 | Bacteria | 40849 |
| 484 | Ga0451576_0026520 | 3300045051 | Bacteria | 6233 |
| 485 | Ga0451576_0029526 | 3300045051 | Bacteria | 5866 |
| 486 | Ga0451576_0044995 | 3300045051 | Bacteria | 4651 |
| 487 | Ga0451576_0070946 | 3300045051 | Bacteria | 3626 |
| 488 | Ga0451576_0259649 | 3300045051 | Bacteria | 1815 |
| 489 | Ga0451576_1042154 | 3300045051 | Bacteria | 857 |
| 490 | Ga0451576_1051696 | 3300045051 | Bacteria | 853 |
| 491 | Ga0451576_1077088 | 3300045051 | Bacteria | 841 |
| 492 | Ga0451576_1115684 | 3300045051 | Bacteria | 825 |
| 493 | Ga0451576_1232305 | 3300045051 | Bacteria | 781 |
| 494 | Ga0466958_0031465 | 3300045836 | Bacteria | 3154 |
| 495 | Ga0495617_000288 | 3300046452 | Bacteria | 28911 |
| 496 | Ga0495617_000874 | 3300046452 | Bacteria | 14200 |
| 497 | Ga0495627_000778 | 3300046453 | Bacteria | 23542 |
| 498 | Ga0495590_0011311 | 3300046457 | Bacteria | 3339 |
| 499 | Ga0495638_0000584 | 3300046460 | Bacteria | 41161 |
| 500 | Ga0495650_0008270 | 3300046471 | Bacteria | 6099 |
| 501 | Ga0495650_0146583 | 3300046471 | Bacteria | 850 |
| 502 | Ga0495605_0062734 | 3300046474 | Bacteria | 1775 |
| 503 | Ga0495584_0010943 | 3300046491 | Bacteria | 4655 |
| 504 | Ga0495585_0000019 | 3300046492 | Bacteria | 156966 |
| 505 | Ga0495585_0231149 | 3300046492 | Bacteria | 929 |
| 506 | Ga0495607_0000430 | 3300046501 | Bacteria | 42487 |
| 507 | Ga0495607_0252086 | 3300046501 | Bacteria | 849 |
| 508 | Ga0495583_0036562 | 3300046506 | Bacteria | 2334 |
| 509 | Ga0495606_0000665 | 3300046507 | Bacteria | 53891 |
| 510 | Ga0495606_0000888 | 3300046507 | Bacteria | 44688 |
| 511 | Ga0495606_0002803 | 3300046507 | Bacteria | 19410 |
| 512 | Ga0495606_0314611 | 3300046507 | Bacteria | 843 |
| 513 | Ga0495610_0024167 | 3300046512 | Bacteria | 3284 |
| 514 | Ga0495610_0099501 | 3300046512 | Bacteria | 1305 |
| 515 | Ga0495616_0000047 | 3300046513 | Bacteria | 110592 |
| 516 | Ga0495616_0129543 | 3300046513 | Bacteria | 1157 |
| 517 | Ga0495616_0238355 | 3300046513 | Bacteria | 785 |
| 518 | Ga0495620_0007968 | 3300046515 | Bacteria | 5710 |
| 519 | Ga0495620_0012378 | 3300046515 | Bacteria | 4411 |
| 520 | Ga0495630_0466972 | 3300046517 | Bacteria | 967 |
| 521 | Ga0495631_0000361 | 3300046518 | Bacteria | 31358 |
| 522 | Ga0495631_0000705 | 3300046518 | Bacteria | 21584 |
| 523 | Ga0495631_0000767 | 3300046518 | Bacteria | 20651 |
| 524 | Ga0495632_0045045 | 3300046519 | Bacteria | 2199 |
| 525 | Ga0495632_0046221 | 3300046519 | Bacteria | 2164 |
| 526 | Ga0495632_0210392 | 3300046519 | Bacteria | 882 |
| 527 | Ga0495648_0000947 | 3300046524 | Bacteria | 30046 |
| 528 | Ga0495648_0003270 | 3300046524 | Bacteria | 14341 |
| 529 | Ga0495663_0073966 | 3300046525 | Bacteria | 1089 |
| 530 | Ga0495654_0000922 | 3300046530 | Bacteria | 21861 |
| 531 | Ga0495665_0086171 | 3300046531 | Bacteria | 1651 |
| 532 | Ga0495609_0001428 | 3300046538 | Bacteria | 15911 |
| 533 | Ga0495621_0108453 | 3300046539 | Bacteria | 1063 |
| 534 | Ga0495656_0038020 | 3300046615 | Bacteria | 1991 |
| 535 | Ga0495668_0006146 | 3300046616 | Bacteria | 7948 |
| 536 | Ga0495668_0216334 | 3300046616 | Bacteria | 1049 |
| 537 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 538 | Ga0495611_0000239 | 3300046648 | Bacteria | 38010 |
| 539 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 540 | Ga0495625_0434806 | 3300046660 | Bacteria | 813 |
| 541 | Ga0495661_0001751 | 3300046665 | Bacteria | 17457 |
| 542 | Ga0495670_0010116 | 3300046691 | Bacteria | 4640 |
| 543 | Ga0495670_0050033 | 3300046691 | Bacteria | 2091 |
| 544 | Ga0495670_0275207 | 3300046691 | Bacteria | 900 |
| 545 | Ga0495671_0000272 | 3300046692 | Bacteria | 43513 |
| 546 | Ga0495589_0000329 | 3300046794 | Bacteria | 37186 |
| 547 | Ga0495660_0047556 | 3300046810 | Bacteria | 2348 |
| 548 | Ga0495660_0047561 | 3300046810 | Bacteria | 2348 |
| 549 | Ga0495636_0110047 | 3300047318 | Bacteria | 1211 |
| 550 | Ga0495672_0006584 | 3300047320 | Bacteria | 8947 |
| 551 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 552 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 553 | Ga0495673_0000099 | 3300047469 | Bacteria | 179978 |
| 554 | Ga0495673_0035008 | 3300047469 | Bacteria | 2317 |
| 555 | Ga0495673_0285818 | 3300047469 | Bacteria | 594 |
| 556 | Ga0495686_0000255 | 3300047472 | Bacteria | 95600 |
| 557 | Ga0495686_0052579 | 3300047472 | Bacteria | 2553 |
| 558 | Ga0495686_0065153 | 3300047472 | Bacteria | 2253 |
| 559 | Ga0495686_0372021 | 3300047472 | Bacteria | 772 |
| 560 | Ga0495686_0547305 | 3300047472 | Bacteria | 604 |
| 561 | Ga0496100_0160269 | 3300048903 | Bacteria | 1612 |
| 562 | Ga0496100_1118917 | 3300048903 | Bacteria | 621 |
| 563 | Ga0496101_0063136 | 3300048904 | Bacteria | 2695 |
| 564 | Ga0496102_0332424 | 3300048905 | Bacteria | 1431 |
| 565 | Ga0496102_0642306 | 3300048905 | Bacteria | 984 |
| 566 | Ga0496103_0369715 | 3300048906 | Bacteria | 921 |
| 567 | Ga0496106_0002577 | 3300048909 | Bacteria | 13499 |
| 568 | Ga0496107_1112225 | 3300048910 | Bacteria | 570 |
| 569 | Ga0496108_0298956 | 3300048911 | Bacteria | 1402 |
| 570 | Ga0496109_0542389 | 3300048912 | Bacteria | 1097 |
| 571 | Ga0496115_0302808 | 3300048918 | Bacteria | 1310 |
| 572 | Ga0496116_0168745 | 3300048919 | Bacteria | 1189 |
| 573 | Ga0496117_0068320 | 3300048920 | Bacteria | 2399 |
| 574 | Ga0496117_0221893 | 3300048920 | Bacteria | 1051 |
| 575 | Ga0496118_0002292 | 3300048921 | Bacteria | 26037 |
| 576 | Ga0496118_0015532 | 3300048921 | Bacteria | 7043 |
| 577 | Ga0496118_0029973 | 3300048921 | Bacteria | 4553 |
| 578 | Ga0496121_0000210 | 3300048924 | Bacteria | 128287 |
| 579 | Ga0496121_0002725 | 3300048924 | Bacteria | 26358 |
| 580 | Ga0496121_0074823 | 3300048924 | Bacteria | 2707 |
| 581 | Ga0496121_0311210 | 3300048924 | Bacteria | 1064 |
| 582 | Ga0496121_0415780 | 3300048924 | Bacteria | 876 |
| 583 | Ga0496122_0032475 | 3300048925 | Bacteria | 4315 |
| 584 | Ga0496122_0100938 | 3300048925 | Bacteria | 1929 |
| 585 | Ga0496122_0227339 | 3300048925 | Bacteria | 1064 |
| 586 | Ga0496122_0256459 | 3300048925 | Bacteria | 974 |
| 587 | Ga0496123_0058141 | 3300048926 | Bacteria | 2511 |
| 588 | Ga0496123_0071913 | 3300048926 | Bacteria | 2154 |
| 589 | Ga0496125_0012647 | 3300048928 | Bacteria | 8357 |
| 590 | Ga0496126_1263775 | 3300048929 | Bacteria | 539 |
| 591 | Ga0495678_000664 | 3300049459 | Bacteria | 31545 |
| 592 | Ga0495682_0020684 | 3300049460 | Bacteria | 2469 |
| 593 | Ga0495682_0041271 | 3300049460 | Bacteria | 1691 |
| 594 | Ga0501300_072364 | 3300049523 | Bacteria | 559 |
| 595 | Ga0501031_0036335 | 3300049568 | Bacteria | 3213 |
| 596 | Ga0501031_0819665 | 3300049568 | Bacteria | 596 |
| 597 | Ga0501032_0000744 | 3300049569 | Bacteria | 26473 |
| 598 | Ga0501032_0021539 | 3300049569 | Bacteria | 4479 |
| 599 | Ga0501032_0869784 | 3300049569 | Bacteria | 568 |
| 600 | Ga0501033_0003954 | 3300049570 | Bacteria | 12016 |
| 601 | Ga0501033_0010512 | 3300049570 | Bacteria | 7098 |
| 602 | Ga0501033_0083570 | 3300049570 | Bacteria | 2340 |
| 603 | Ga0501034_0000996 | 3300049571 | Bacteria | 40586 |
| 604 | Ga0501034_0002335 | 3300049571 | Bacteria | 23169 |
| 605 | Ga0501034_0104860 | 3300049571 | Bacteria | 2820 |
| 606 | Ga0501034_0484912 | 3300049571 | Bacteria | 1151 |
| 607 | Ga0501034_0659861 | 3300049571 | Bacteria | 947 |
| 608 | Ga0501034_0798819 | 3300049571 | Unclassified | 836 |
| 609 | Ga0501036_0043683 | 3300049572 | Bacteria | 3796 |
| 610 | Ga0501036_0207362 | 3300049572 | Bacteria | 1647 |
| 611 | Ga0501037_0000566 | 3300049573 | Bacteria | 29217 |
| 612 | Ga0501037_0004006 | 3300049573 | Bacteria | 10681 |
| 613 | Ga0501037_0007619 | 3300049573 | Bacteria | 7927 |
| 614 | Ga0501037_0095314 | 3300049573 | Bacteria | 2151 |
| 615 | Ga0501037_0327745 | 3300049573 | Bacteria | 1059 |
| 616 | Ga0501037_0458867 | 3300049573 | Bacteria | 868 |
| 617 | Ga0501037_0820218 | 3300049573 | Bacteria | 613 |
| 618 | Ga0501037_0950502 | 3300049573 | Bacteria | 561 |
| 619 | Ga0501038_0000746 | 3300049574 | Bacteria | 29017 |
| 620 | Ga0501038_0005436 | 3300049574 | Bacteria | 11835 |
| 621 | Ga0501038_0007938 | 3300049574 | Bacteria | 9779 |
| 622 | Ga0501038_0014627 | 3300049574 | Bacteria | 7151 |
| 623 | Ga0501038_0371693 | 3300049574 | Bacteria | 1110 |
| 624 | Ga0501039_0012430 | 3300049575 | Bacteria | 6501 |
| 625 | Ga0501039_0067110 | 3300049575 | Bacteria | 2786 |
| 626 | Ga0501039_0257096 | 3300049575 | Bacteria | 1373 |
| 627 | Ga0501042_0322089 | 3300049578 | Bacteria | 1117 |
| 628 | Ga0501042_0363175 | 3300049578 | Bacteria | 1048 |
| 629 | Ga0501043_0005586 | 3300049579 | Bacteria | 10129 |
| 630 | Ga0501043_0024289 | 3300049579 | Bacteria | 4757 |
| 631 | Ga0501043_0054377 | 3300049579 | Bacteria | 3144 |
| 632 | Ga0501043_0339815 | 3300049579 | Bacteria | 1142 |
| 633 | Ga0501043_1334928 | 3300049579 | Bacteria | 500 |
| 634 | Ga0501046_0000760 | 3300049580 | Bacteria | 31143 |
| 635 | Ga0501046_0314335 | 3300049580 | Bacteria | 1142 |
| 636 | Ga0501046_0340015 | 3300049580 | Bacteria | 1091 |
| 637 | Ga0501047_0001682 | 3300049581 | Bacteria | 21529 |
| 638 | Ga0501047_0006314 | 3300049581 | Bacteria | 11147 |
| 639 | Ga0501047_0224359 | 3300049581 | Bacteria | 1734 |
| 640 | Ga0501047_0224384 | 3300049581 | Bacteria | 1734 |
| 641 | Ga0501047_0291289 | 3300049581 | Bacteria | 1476 |
| 642 | Ga0501047_0540519 | 3300049581 | Bacteria | 990 |
| 643 | Ga0501047_0597252 | 3300049581 | Bacteria | 926 |
| 644 | Ga0501047_0822098 | 3300049581 | Bacteria | 743 |
| 645 | Ga0501048_0283698 | 3300049582 | Bacteria | 1177 |
| 646 | Ga0501067_0037230 | 3300049583 | Bacteria | 2702 |
| 647 | Ga0501067_0048538 | 3300049583 | Bacteria | 2354 |
| 648 | Ga0501067_0085285 | 3300049583 | Bacteria | 1753 |
| 649 | Ga0501069_0028355 | 3300049585 | Bacteria | 3069 |
| 650 | Ga0501069_0047385 | 3300049585 | Bacteria | 2386 |
| 651 | Ga0501069_0246042 | 3300049585 | Bacteria | 1043 |
| 652 | Ga0501070_0003644 | 3300049586 | Bacteria | 13321 |
| 653 | Ga0501070_0003853 | 3300049586 | Bacteria | 12940 |
| 654 | Ga0501070_0021411 | 3300049586 | Bacteria | 5424 |
| 655 | Ga0501070_0033976 | 3300049586 | Bacteria | 4266 |
| 656 | Ga0501070_0047614 | 3300049586 | Bacteria | 3562 |
| 657 | Ga0501070_0080426 | 3300049586 | Bacteria | 2696 |
| 658 | Ga0501070_0102947 | 3300049586 | Bacteria | 2361 |
| 659 | Ga0501072_0000714 | 3300049588 | Bacteria | 24116 |
| 660 | Ga0501073_0001389 | 3300049589 | Bacteria | 17851 |
| 661 | Ga0501073_0060100 | 3300049589 | Bacteria | 2652 |
| 662 | Ga0501073_0091460 | 3300049589 | Bacteria | 2115 |
| 663 | Ga0501073_0998950 | 3300049589 | Bacteria | 576 |
| 664 | Ga0501074_0000672 | 3300049590 | Bacteria | 21334 |
| 665 | Ga0501074_0031093 | 3300049590 | Bacteria | 3868 |
| 666 | Ga0501074_1320589 | 3300049590 | Bacteria | 505 |
| 667 | Ga0501075_0075495 | 3300049591 | Bacteria | 2549 |
| 668 | Ga0501077_0200093 | 3300049593 | Bacteria | 1269 |
| 669 | Ga0501079_0088598 | 3300049741 | Bacteria | 2396 |
| 670 | Ga0501079_0507019 | 3300049741 | Bacteria | 949 |
| 671 | Ga0501080_0010993 | 3300049742 | Bacteria | 8286 |
| 672 | Ga0501080_0023507 | 3300049742 | Bacteria | 5712 |
| 673 | Ga0501080_0025335 | 3300049742 | Bacteria | 5503 |
| 674 | Ga0501080_0194744 | 3300049742 | Bacteria | 1862 |
| 675 | Ga0501080_0194865 | 3300049742 | Bacteria | 1861 |
| 676 | Ga0501080_1529515 | 3300049742 | Bacteria | 566 |
| 677 | Ga0501083_0020036 | 3300049744 | Bacteria | 4655 |
| 678 | Ga0501280_000116 | 3300049776 | Bacteria | 21015 |
| 679 | Ga0501035_0003276 | 3300049822 | Bacteria | 15521 |
| 680 | Ga0501035_0040291 | 3300049822 | Bacteria | 4222 |
| 681 | Ga0501035_0060626 | 3300049822 | Bacteria | 3368 |
| 682 | Ga0501035_0063180 | 3300049822 | Bacteria | 3294 |
| 683 | Ga0501035_0333878 | 3300049822 | Bacteria | 1271 |
| 684 | Ga0501035_1006512 | 3300049822 | Bacteria | 655 |
| 685 | Ga0501035_1558208 | 3300049822 | Bacteria | 502 |
| 686 | Ga0501044_0000190 | 3300049823 | Bacteria | 77415 |
| 687 | Ga0501044_0002882 | 3300049823 | Bacteria | 19574 |
| 688 | Ga0501044_0025830 | 3300049823 | Bacteria | 6225 |
| 689 | Ga0501044_0062309 | 3300049823 | Bacteria | 3812 |
| 690 | Ga0501044_0133563 | 3300049823 | Bacteria | 2474 |
| 691 | Ga0501044_0204715 | 3300049823 | Bacteria | 1930 |
| 692 | Ga0501044_0907414 | 3300049823 | Bacteria | 756 |
| 693 | Ga0501044_1047509 | 3300049823 | Bacteria | 686 |
| 694 | Ga0501044_1416828 | 3300049823 | Bacteria | 560 |
| 695 | nmdc:mga00v17_37036_c1 | 3300050491 | Bacteria | 2910 |
| 696 | nmdc:mga0yw44_1241947_c1 | 3300050492 | Bacteria | 502 |
| 697 | nmdc:mga0k408_160022_c1 | 3300050493 | Bacteria | 1341 |
| 698 | nmdc:mga0k408_32718_c1 | 3300050493 | Bacteria | 2971 |
| 699 | nmdc:mga0k408_7088_c1 | 3300050493 | Bacteria | 5987 |
| 700 | nmdc:mga06z11_540788_c1 | 3300050494 | Bacteria | 707 |
| 701 | nmdc:mga07m45_84427_c1 | 3300050496 | Bacteria | 1494 |
| 702 | nmdc:mga06r32_680441_c1 | 3300050510 | Bacteria | 995 |
| 703 | nmdc:mga0sz30_51816_c1 | 3300050516 | Bacteria | 1742 |
| 704 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 705 | Ga0500566_0466051 | 3300053094 | Bacteria | 550 |
| 706 | Ga0500641_0002680 | 3300053096 | Bacteria | 6289 |
| 707 | Ga0500555_000245 | 3300053103 | Bacteria | 24063 |
| 708 | Ga0500559_0039706 | 3300053136 | Bacteria | 2048 |
| 709 | Ga0500622_0000023 | 3300053156 | Bacteria | 251170 |
| 710 | Ga0500636_0000837 | 3300053177 | Bacteria | 16563 |
| 711 | Ga0500637_0028995 | 3300053178 | Bacteria | 3067 |
| 712 | Ga0500645_000235 | 3300053730 | Bacteria | 41905 |
| 713 | Ga0501084_0115255 | 3300054114 | Bacteria | 2259 |
| 714 | Ga0500661_025343 | 3300055283 | Bacteria | 1049 |
| 715 | Ga0501082_0077132 | 3300060353 | Bacteria | 2873 |
| 716 | Ga0501082_1315532 | 3300060353 | Bacteria | 631 |
| 717 | Ga0501082_1484152 | 3300060353 | Bacteria | 592 |
| 718 | Ga0466962_0368067 | 3300061719 | Bacteria | 717 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031665 | Ga0316575_10196060 | Ga0316575_101960602 | 98 |
| 2 | 3300031691 | Ga0316579_10308419 | Ga0316579_103084192 | 98 |
| 3 | 3300031727 | Ga0316576_10912995 | Ga0316576_109129952 | 98 |
| 4 | 3300031728 | Ga0316578_10604164 | Ga0316578_106041642 | 98 |
| 5 | 3300035398 | Ga0316574_0006438 | Ga0316574_0006438_5552_5848 | 98 |
| 6 | 3300036647 | Ga0316582_0002409 | Ga0316582_0002409_7109_7405 | 98 |
| 7 | 3300036712 | Ga0316584_0038020 | Ga0316584_0038020_152_451 | 98 |
| 8 | 3300037588 | Ga0316581_0067708 | Ga0316581_0067708_441_737 | 98 |
| 9 | 3300003215 | JGI25153J46596_10075712 | JGI25153J46596_100757122 | 99 |
| 10 | 3300003752 | Ga0055539_1000969 | Ga0055539_10009699 | 99 |
| 11 | 3300003756 | Ga0055533_1000728 | Ga0055533_10007289 | 99 |
| 12 | 3300003760 | Ga0055527_1000689 | Ga0055527_10006899 | 99 |
| 13 | 3300003761 | Ga0055535_1001681 | Ga0055535_100168110 | 99 |
| 14 | 3300003762 | Ga0055542_1001628 | Ga0055542_100162810 | 99 |
| 15 | 3300003763 | Ga0055529_1001211 | Ga0055529_100121110 | 99 |
| 16 | 3300005327 | Ga0070658_11265300 | Ga0070658_112653002 | 99 |
| 17 | 3300005331 | Ga0070670_100049790 | Ga0070670_1000497901 | 99 |
| 18 | 3300005331 | Ga0070670_100477308 | Ga0070670_1004773083 | 99 |
| 19 | 3300005334 | Ga0068869_100036368 | Ga0068869_1000363683 | 99 |
| 20 | 3300005335 | Ga0070666_10175091 | Ga0070666_101750913 | 99 |
| 21 | 3300005335 | Ga0070666_10435552 | Ga0070666_104355521 | 99 |
| 22 | 3300005338 | Ga0068868_100103557 | Ga0068868_1001035571 | 99 |
| 23 | 3300005338 | Ga0068868_100292769 | Ga0068868_1002927692 | 99 |
| 24 | 3300005339 | Ga0070660_101499926 | Ga0070660_1014999261 | 99 |
| 25 | 3300005340 | Ga0070689_100063654 | Ga0070689_1000636543 | 99 |
| 26 | 3300005343 | Ga0070687_100078080 | Ga0070687_1000780801 | 99 |
| 27 | 3300005344 | Ga0070661_100323668 | Ga0070661_1003236682 | 99 |
| 28 | 3300005344 | Ga0070661_100371567 | Ga0070661_1003715672 | 99 |
| 29 | 3300005347 | Ga0070668_100799529 | Ga0070668_1007995292 | 99 |
| 30 | 3300005353 | Ga0070669_100080888 | Ga0070669_1000808883 | 99 |
| 31 | 3300005354 | Ga0070675_100635982 | Ga0070675_1006359821 | 99 |
| 32 | 3300005355 | Ga0070671_100176346 | Ga0070671_1001763463 | 99 |
| 33 | 3300005364 | Ga0070673_101259562 | Ga0070673_1012595622 | 99 |
| 34 | 3300005366 | Ga0070659_100579156 | Ga0070659_1005791562 | 99 |
| 35 | 3300005367 | Ga0070667_100218838 | Ga0070667_1002188383 | 99 |
| 36 | 3300005367 | Ga0070667_100613544 | Ga0070667_1006135441 | 99 |
| 37 | 3300005435 | Ga0070714_100003135 | Ga0070714_1000031354 | 99 |
| 38 | 3300005435 | Ga0070714_101128759 | Ga0070714_1011287592 | 99 |
| 39 | 3300005439 | Ga0070711_100383056 | Ga0070711_1003830563 | 99 |
| 40 | 3300005439 | Ga0070711_100466163 | Ga0070711_1004661632 | 99 |
| 41 | 3300005445 | Ga0070708_100033183 | Ga0070708_1000331832 | 99 |
| 42 | 3300005445 | Ga0070708_100332715 | Ga0070708_1003327152 | 99 |
| 43 | 3300005455 | Ga0070663_100490265 | Ga0070663_1004902653 | 99 |
| 44 | 3300005458 | Ga0070681_11284927 | Ga0070681_112849272 | 99 |
| 45 | 3300005459 | Ga0068867_100816346 | Ga0068867_1008163462 | 99 |
| 46 | 3300005467 | Ga0070706_100343571 | Ga0070706_1003435712 | 99 |
| 47 | 3300005518 | Ga0070699_100784912 | Ga0070699_1007849122 | 99 |
| 48 | 3300005536 | Ga0070697_100058903 | Ga0070697_1000589033 | 99 |
| 49 | 3300005536 | Ga0070697_100922230 | Ga0070697_1009222301 | 99 |
| 50 | 3300005539 | Ga0068853_100005942 | Ga0068853_1000059425 | 99 |
| 51 | 3300005539 | Ga0068853_100096609 | Ga0068853_1000966094 | 99 |
| 52 | 3300005539 | Ga0068853_100330528 | Ga0068853_1003305282 | 99 |
| 53 | 3300005539 | Ga0068853_101183174 | Ga0068853_1011831741 | 99 |
| 54 | 3300005543 | Ga0070672_100003097 | Ga0070672_1000030976 | 99 |
| 55 | 3300005543 | Ga0070672_100006127 | Ga0070672_1000061277 | 99 |
| 56 | 3300005546 | Ga0070696_100224466 | Ga0070696_1002244662 | 99 |
| 57 | 3300005548 | Ga0070665_100023062 | Ga0070665_1000230625 | 99 |
| 58 | 3300005548 | Ga0070665_100043640 | Ga0070665_1000436403 | 99 |
| 59 | 3300005563 | Ga0068855_100005893 | Ga0068855_1000058939 | 99 |
| 60 | 3300005563 | Ga0068855_100085911 | Ga0068855_1000859112 | 99 |
| 61 | 3300005563 | Ga0068855_101751500 | Ga0068855_1017515001 | 99 |
| 62 | 3300005564 | Ga0070664_100375476 | Ga0070664_1003754762 | 99 |
| 63 | 3300005577 | Ga0068857_100034950 | Ga0068857_1000349503 | 99 |
| 64 | 3300005578 | Ga0068854_100849100 | Ga0068854_1008491002 | 99 |
| 65 | 3300005614 | Ga0068856_100001563 | Ga0068856_1000015635 | 99 |
| 66 | 3300005614 | Ga0068856_100083087 | Ga0068856_1000830874 | 99 |
| 67 | 3300005614 | Ga0068856_100787046 | Ga0068856_1007870462 | 99 |
| 68 | 3300005718 | Ga0068866_10703429 | Ga0068866_107034291 | 99 |
| 69 | 3300005719 | Ga0068861_101682402 | Ga0068861_1016824022 | 99 |
| 70 | 3300005841 | Ga0068863_100524601 | Ga0068863_1005246012 | 99 |
| 71 | 3300006038 | Ga0075365_11189769 | Ga0075365_111897692 | 99 |
| 72 | 3300006051 | Ga0075364_10022744 | Ga0075364_100227446 | 99 |
| 73 | 3300006175 | Ga0070712_101491878 | Ga0070712_1014918781 | 99 |
| 74 | 3300006175 | Ga0070712_101711802 | Ga0070712_1017118022 | 99 |
| 75 | 3300006186 | Ga0075369_10027825 | Ga0075369_100278253 | 99 |
| 76 | 3300006195 | Ga0075366_10019991 | Ga0075366_100199914 | 99 |
| 77 | 3300006195 | Ga0075366_10062156 | Ga0075366_100621562 | 99 |
| 78 | 3300006195 | Ga0075366_10099444 | Ga0075366_100994442 | 99 |
| 79 | 3300006195 | Ga0075366_10221389 | Ga0075366_102213893 | 99 |
| 80 | 3300006237 | Ga0097621_100018815 | Ga0097621_1000188153 | 99 |
| 81 | 3300006237 | Ga0097621_100051918 | Ga0097621_1000519185 | 99 |
| 82 | 3300006358 | Ga0068871_100008112 | Ga0068871_1000081128 | 99 |
| 83 | 3300006358 | Ga0068871_100070200 | Ga0068871_1000702003 | 99 |
| 84 | 3300006358 | Ga0068871_100187299 | Ga0068871_1001872994 | 99 |
| 85 | 3300006846 | Ga0075430_101250026 | Ga0075430_1012500262 | 99 |
| 86 | 3300006881 | Ga0068865_100047406 | Ga0068865_1000474064 | 99 |
| 87 | 3300009092 | Ga0105250_10000398 | Ga0105250_100003982 | 99 |
| 88 | 3300009092 | Ga0105250_10047216 | Ga0105250_100472163 | 99 |
| 89 | 3300009093 | Ga0105240_10012696 | Ga0105240_100126966 | 99 |
| 90 | 3300009093 | Ga0105240_10020043 | Ga0105240_100200435 | 99 |
| 91 | 3300009093 | Ga0105240_11262537 | Ga0105240_112625372 | 99 |
| 92 | 3300009098 | Ga0105245_10375128 | Ga0105245_103751283 | 99 |
| 93 | 3300009098 | Ga0105245_11594672 | Ga0105245_115946722 | 99 |
| 94 | 3300009098 | Ga0105245_11921735 | Ga0105245_119217351 | 99 |
| 95 | 3300009098 | Ga0105245_13287675 | Ga0105245_132876751 | 99 |
| 96 | 3300009148 | Ga0105243_11122627 | Ga0105243_111226271 | 99 |
| 97 | 3300009174 | Ga0105241_10007901 | Ga0105241_100079017 | 99 |
| 98 | 3300009174 | Ga0105241_10568076 | Ga0105241_105680761 | 99 |
| 99 | 3300009176 | Ga0105242_10035574 | Ga0105242_100355744 | 99 |
| 100 | 3300009176 | Ga0105242_10415718 | Ga0105242_104157182 | 99 |
| 101 | 3300009545 | Ga0105237_10230058 | Ga0105237_102300583 | 99 |
| 102 | 3300009545 | Ga0105237_10659516 | Ga0105237_106595162 | 99 |
| 103 | 3300009551 | Ga0105238_10078836 | Ga0105238_100788363 | 99 |
| 104 | 3300009551 | Ga0105238_11999375 | Ga0105238_119993752 | 99 |
| 105 | 3300009553 | Ga0105249_10641648 | Ga0105249_106416482 | 99 |
| 106 | 3300009553 | Ga0105249_10949011 | Ga0105249_109490111 | 99 |
| 107 | 3300010375 | Ga0105239_11025634 | Ga0105239_110256341 | 99 |
| 108 | 3300010375 | Ga0105239_13650391 | Ga0105239_136503912 | 99 |
| 109 | 3300011119 | Ga0105246_11503899 | Ga0105246_115038992 | 99 |
| 110 | 3300013100 | Ga0157373_10672199 | Ga0157373_106721992 | 99 |
| 111 | 3300013104 | Ga0157370_10082368 | Ga0157370_100823685 | 99 |
| 112 | 3300013104 | Ga0157370_10225213 | Ga0157370_102252132 | 99 |
| 113 | 3300013104 | Ga0157370_10454415 | Ga0157370_104544153 | 99 |
| 114 | 3300013104 | Ga0157370_10725149 | Ga0157370_107251492 | 99 |
| 115 | 3300013104 | Ga0157370_10925468 | Ga0157370_109254681 | 99 |
| 116 | 3300013105 | Ga0157369_10000107 | Ga0157369_1000010720 | 99 |
| 117 | 3300013296 | Ga0157374_10001069 | Ga0157374_100010696 | 99 |
| 118 | 3300013296 | Ga0157374_10189321 | Ga0157374_101893213 | 99 |
| 119 | 3300013296 | Ga0157374_11212395 | Ga0157374_112123952 | 99 |
| 120 | 3300013297 | Ga0157378_10133862 | Ga0157378_101338622 | 99 |
| 121 | 3300013306 | Ga0163162_10000003 | Ga0163162_1000000337 | 99 |
| 122 | 3300013306 | Ga0163162_10018484 | Ga0163162_100184845 | 99 |
| 123 | 3300013306 | Ga0163162_10129315 | Ga0163162_101293152 | 99 |
| 124 | 3300013306 | Ga0163162_10146958 | Ga0163162_101469584 | 99 |
| 125 | 3300013306 | Ga0163162_12364566 | Ga0163162_123645662 | 99 |
| 126 | 3300013307 | Ga0157372_10130695 | Ga0157372_101306954 | 99 |
| 127 | 3300013307 | Ga0157372_10153701 | Ga0157372_101537013 | 99 |
| 128 | 3300013307 | Ga0157372_10197696 | Ga0157372_101976963 | 99 |
| 129 | 3300013307 | Ga0157372_10529701 | Ga0157372_105297013 | 99 |
| 130 | 3300013308 | Ga0157375_10008003 | Ga0157375_100080033 | 99 |
| 131 | 3300013308 | Ga0157375_10017610 | Ga0157375_100176103 | 99 |
| 132 | 3300013308 | Ga0157375_10346480 | Ga0157375_103464802 | 99 |
| 133 | 3300013308 | Ga0157375_10394930 | Ga0157375_103949303 | 99 |
| 134 | 3300013308 | Ga0157375_11529536 | Ga0157375_115295361 | 99 |
| 135 | 3300014325 | Ga0163163_10000877 | Ga0163163_100008777 | 99 |
| 136 | 3300014326 | Ga0157380_10271205 | Ga0157380_102712053 | 99 |
| 137 | 3300014497 | Ga0182008_10498293 | Ga0182008_104982931 | 99 |
| 138 | 3300014969 | Ga0157376_10036763 | Ga0157376_100367633 | 99 |
| 139 | 3300014969 | Ga0157376_10069159 | Ga0157376_100691592 | 99 |
| 140 | 3300014969 | Ga0157376_10084090 | Ga0157376_100840903 | 99 |
| 141 | 3300014969 | Ga0157376_10329284 | Ga0157376_103292843 | 99 |
| 142 | 3300014969 | Ga0157376_10341116 | Ga0157376_103411163 | 99 |
| 143 | 3300015261 | Ga0182006_1000027 | Ga0182006_100002715 | 99 |
| 144 | 3300015262 | Ga0182007_10026262 | Ga0182007_100262623 | 99 |
| 145 | 3300015265 | Ga0182005_1116436 | Ga0182005_11164362 | 99 |
| 146 | 3300015265 | Ga0182005_1133497 | Ga0182005_11334972 | 99 |
| 147 | 3300017792 | Ga0163161_10028934 | Ga0163161_100289343 | 99 |
| 148 | 3300017792 | Ga0163161_10171676 | Ga0163161_101716763 | 99 |
| 149 | 3300017792 | Ga0163161_10277407 | Ga0163161_102774072 | 99 |
| 150 | 3300021361 | Ga0213872_10000114 | Ga0213872_1000011466 | 99 |
| 151 | 3300021361 | Ga0213872_10001215 | Ga0213872_100012157 | 99 |
| 152 | 3300021361 | Ga0213872_10003003 | Ga0213872_100030035 | 99 |
| 153 | 3300021361 | Ga0213872_10043645 | Ga0213872_100436452 | 99 |
| 154 | 3300025226 | Ga0209674_100108 | Ga0209674_100108114 | 99 |
| 155 | 3300025226 | Ga0209674_100193 | Ga0209674_10019339 | 99 |
| 156 | 3300025228 | Ga0209672_100078 | Ga0209672_10007810 | 99 |
| 157 | 3300025242 | Ga0209258_100012 | Ga0209258_100012692 | 99 |
| 158 | 3300025253 | Ga0209677_100725 | Ga0209677_1007255 | 99 |
| 159 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013679 | 99 |
| 160 | 3300025258 | Ga0209129_1001003 | Ga0209129_10010035 | 99 |
| 161 | 3300025272 | Ga0209455_1000126 | Ga0209455_1000126150 | 99 |
| 162 | 3300025297 | Ga0209758_1017824 | Ga0209758_10178243 | 99 |
| 163 | 3300025303 | Ga0209051_1017881 | Ga0209051_10178813 | 99 |
| 164 | 3300025303 | Ga0209051_1020949 | Ga0209051_10209493 | 99 |
| 165 | 3300025711 | Ga0207696_1000034 | Ga0207696_100003469 | 99 |
| 166 | 3300025735 | Ga0207713_1000014 | Ga0207713_1000014362 | 99 |
| 167 | 3300025903 | Ga0207680_10036335 | Ga0207680_100363355 | 99 |
| 168 | 3300025903 | Ga0207680_10097066 | Ga0207680_100970663 | 99 |
| 169 | 3300025904 | Ga0207647_10000228 | Ga0207647_1000022826 | 99 |
| 170 | 3300025906 | Ga0207699_10767495 | Ga0207699_107674952 | 99 |
| 171 | 3300025907 | Ga0207645_10004105 | Ga0207645_100041055 | 99 |
| 172 | 3300025907 | Ga0207645_10597737 | Ga0207645_105977372 | 99 |
| 173 | 3300025909 | Ga0207705_11355132 | Ga0207705_113551322 | 99 |
| 174 | 3300025910 | Ga0207684_10155282 | Ga0207684_101552823 | 99 |
| 175 | 3300025911 | Ga0207654_10003007 | Ga0207654_100030072 | 99 |
| 176 | 3300025913 | Ga0207695_10010495 | Ga0207695_100104958 | 99 |
| 177 | 3300025913 | Ga0207695_10016538 | Ga0207695_100165385 | 99 |
| 178 | 3300025914 | Ga0207671_10645067 | Ga0207671_106450671 | 99 |
| 179 | 3300025915 | Ga0207693_11057425 | Ga0207693_110574252 | 99 |
| 180 | 3300025916 | Ga0207663_10428932 | Ga0207663_104289322 | 99 |
| 181 | 3300025916 | Ga0207663_11170712 | Ga0207663_111707122 | 99 |
| 182 | 3300025916 | Ga0207663_11496001 | Ga0207663_114960012 | 99 |
| 183 | 3300025918 | Ga0207662_10097766 | Ga0207662_100977661 | 99 |
| 184 | 3300025918 | Ga0207662_10670909 | Ga0207662_106709092 | 99 |
| 185 | 3300025919 | Ga0207657_10737573 | Ga0207657_107375732 | 99 |
| 186 | 3300025920 | Ga0207649_10299750 | Ga0207649_102997502 | 99 |
| 187 | 3300025920 | Ga0207649_11182276 | Ga0207649_111822762 | 99 |
| 188 | 3300025925 | Ga0207650_10272912 | Ga0207650_102729123 | 99 |
| 189 | 3300025925 | Ga0207650_11888316 | Ga0207650_118883161 | 99 |
| 190 | 3300025926 | Ga0207659_10122833 | Ga0207659_101228334 | 99 |
| 191 | 3300025926 | Ga0207659_10993861 | Ga0207659_109938612 | 99 |
| 192 | 3300025927 | Ga0207687_10717413 | Ga0207687_107174132 | 99 |
| 193 | 3300025927 | Ga0207687_11391297 | Ga0207687_113912971 | 99 |
| 194 | 3300025928 | Ga0207700_10127745 | Ga0207700_101277452 | 99 |
| 195 | 3300025928 | Ga0207700_10869651 | Ga0207700_108696512 | 99 |
| 196 | 3300025929 | Ga0207664_10003195 | Ga0207664_100031957 | 99 |
| 197 | 3300025929 | Ga0207664_10741864 | Ga0207664_107418642 | 99 |
| 198 | 3300025929 | Ga0207664_11356738 | Ga0207664_113567382 | 99 |
| 199 | 3300025931 | Ga0207644_10241602 | Ga0207644_102416022 | 99 |
| 200 | 3300025932 | Ga0207690_10045337 | Ga0207690_100453373 | 99 |
| 201 | 3300025934 | Ga0207686_10041543 | Ga0207686_100415434 | 99 |
| 202 | 3300025934 | Ga0207686_10733287 | Ga0207686_107332872 | 99 |
| 203 | 3300025936 | Ga0207670_10099376 | Ga0207670_100993762 | 99 |
| 204 | 3300025937 | Ga0207669_10837794 | Ga0207669_108377942 | 99 |
| 205 | 3300025938 | Ga0207704_10050600 | Ga0207704_100506004 | 99 |
| 206 | 3300025938 | Ga0207704_10193768 | Ga0207704_101937681 | 99 |
| 207 | 3300025940 | Ga0207691_10007159 | Ga0207691_100071596 | 99 |
| 208 | 3300025940 | Ga0207691_10015655 | Ga0207691_100156552 | 99 |
| 209 | 3300025941 | Ga0207711_10611663 | Ga0207711_106116631 | 99 |
| 210 | 3300025942 | Ga0207689_10021038 | Ga0207689_100210384 | 99 |
| 211 | 3300025942 | Ga0207689_10041169 | Ga0207689_100411693 | 99 |
| 212 | 3300025945 | Ga0207679_10398126 | Ga0207679_103981263 | 99 |
| 213 | 3300025949 | Ga0207667_10002442 | Ga0207667_100024424 | 99 |
| 214 | 3300025949 | Ga0207667_10266294 | Ga0207667_102662943 | 99 |
| 215 | 3300025960 | Ga0207651_10067790 | Ga0207651_100677902 | 99 |
| 216 | 3300025961 | Ga0207712_10625661 | Ga0207712_106256612 | 99 |
| 217 | 3300025972 | Ga0207668_11932808 | Ga0207668_119328082 | 99 |
| 218 | 3300025986 | Ga0207658_10458919 | Ga0207658_104589192 | 99 |
| 219 | 3300025986 | Ga0207658_10471470 | Ga0207658_104714701 | 99 |
| 220 | 3300026023 | Ga0207677_10841785 | Ga0207677_108417853 | 99 |
| 221 | 3300026041 | Ga0207639_10001611 | Ga0207639_1000161112 | 99 |
| 222 | 3300026041 | Ga0207639_10141071 | Ga0207639_101410714 | 99 |
| 223 | 3300026041 | Ga0207639_11116685 | Ga0207639_111166852 | 99 |
| 224 | 3300026041 | Ga0207639_12293897 | Ga0207639_122938972 | 99 |
| 225 | 3300026067 | Ga0207678_10351673 | Ga0207678_103516733 | 99 |
| 226 | 3300026078 | Ga0207702_10000265 | Ga0207702_1000026539 | 99 |
| 227 | 3300026089 | Ga0207648_10122465 | Ga0207648_101224653 | 99 |
| 228 | 3300026089 | Ga0207648_11224352 | Ga0207648_112243522 | 99 |
| 229 | 3300026116 | Ga0207674_10132242 | Ga0207674_101322421 | 99 |
| 230 | 3300026116 | Ga0207674_10612777 | Ga0207674_106127773 | 99 |
| 231 | 3300026121 | Ga0207683_10027916 | Ga0207683_100279164 | 99 |
| 232 | 3300026142 | Ga0207698_10673496 | Ga0207698_106734961 | 99 |
| 233 | 3300028379 | Ga0268266_10050113 | Ga0268266_100501133 | 99 |
| 234 | 3300028666 | Ga0265336_10000635 | Ga0265336_100006352 | 99 |
| 235 | 3300028666 | Ga0265336_10006849 | Ga0265336_100068492 | 99 |
| 236 | 3300029957 | Ga0265324_10000006 | Ga0265324_1000000637 | 99 |
| 237 | 3300029957 | Ga0265324_10001952 | Ga0265324_100019528 | 99 |
| 238 | 3300029957 | Ga0265324_10102855 | Ga0265324_101028552 | 99 |
| 239 | 3300029957 | Ga0265324_10119162 | Ga0265324_101191622 | 99 |
| 240 | 3300031235 | Ga0265330_10036623 | Ga0265330_100366232 | 99 |
| 241 | 3300031239 | Ga0265328_10049087 | Ga0265328_100490873 | 99 |
| 242 | 3300031239 | Ga0265328_10365586 | Ga0265328_103655862 | 99 |
| 243 | 3300031241 | Ga0265325_10001045 | Ga0265325_100010457 | 99 |
| 244 | 3300031241 | Ga0265325_10012166 | Ga0265325_100121667 | 99 |
| 245 | 3300031250 | Ga0265331_10005415 | Ga0265331_100054151 | 99 |
| 246 | 3300031250 | Ga0265331_10011631 | Ga0265331_100116314 | 99 |
| 247 | 3300031250 | Ga0265331_10036638 | Ga0265331_100366383 | 99 |
| 248 | 3300031250 | Ga0265331_10079529 | Ga0265331_100795293 | 99 |
| 249 | 3300031250 | Ga0265331_10159281 | Ga0265331_101592811 | 99 |
| 250 | 3300031250 | Ga0265331_10161473 | Ga0265331_101614732 | 99 |
| 251 | 3300031250 | Ga0265331_10175274 | Ga0265331_101752742 | 99 |
| 252 | 3300031251 | Ga0265327_10000217 | Ga0265327_10000217104 | 99 |
| 253 | 3300031251 | Ga0265327_10000263 | Ga0265327_1000026328 | 99 |
| 254 | 3300031251 | Ga0265327_10000384 | Ga0265327_1000038475 | 99 |
| 255 | 3300031251 | Ga0265327_10000451 | Ga0265327_1000045136 | 99 |
| 256 | 3300031251 | Ga0265327_10001651 | Ga0265327_100016519 | 99 |
| 257 | 3300031251 | Ga0265327_10003428 | Ga0265327_100034288 | 99 |
| 258 | 3300031251 | Ga0265327_10014981 | Ga0265327_100149814 | 99 |
| 259 | 3300031251 | Ga0265327_10075927 | Ga0265327_100759272 | 99 |
| 260 | 3300031251 | Ga0265327_10088011 | Ga0265327_100880113 | 99 |
| 261 | 3300031251 | Ga0265327_10183608 | Ga0265327_101836082 | 99 |
| 262 | 3300031251 | Ga0265327_10366397 | Ga0265327_103663972 | 99 |
| 263 | 3300031344 | Ga0265316_10000415 | Ga0265316_100004158 | 99 |
| 264 | 3300031344 | Ga0265316_10132038 | Ga0265316_101320383 | 99 |
| 265 | 3300031344 | Ga0265316_10674948 | Ga0265316_106749482 | 99 |
| 266 | 3300031344 | Ga0265316_10793138 | Ga0265316_107931382 | 99 |
| 267 | 3300031507 | Ga0307509_10000033 | Ga0307509_1000003321 | 99 |
| 268 | 3300031507 | Ga0307509_10061303 | Ga0307509_100613034 | 99 |
| 269 | 3300031507 | Ga0307509_10953348 | Ga0307509_109533482 | 99 |
| 270 | 3300031548 | Ga0307408_100138751 | Ga0307408_1001387513 | 99 |
| 271 | 3300031548 | Ga0307408_100771864 | Ga0307408_1007718642 | 99 |
| 272 | 3300031665 | Ga0316575_10006222 | Ga0316575_100062222 | 99 |
| 273 | 3300031665 | Ga0316575_10042932 | Ga0316575_100429323 | 99 |
| 274 | 3300031665 | Ga0316575_10133854 | Ga0316575_101338542 | 99 |
| 275 | 3300031665 | Ga0316575_10224117 | Ga0316575_102241171 | 99 |
| 276 | 3300031665 | Ga0316575_10286563 | Ga0316575_102865632 | 99 |
| 277 | 3300031665 | Ga0316575_10410854 | Ga0316575_104108542 | 99 |
| 278 | 3300031665 | Ga0316575_10537856 | Ga0316575_105378561 | 99 |
| 279 | 3300031691 | Ga0316579_10002808 | Ga0316579_100028085 | 99 |
| 280 | 3300031691 | Ga0316579_10005314 | Ga0316579_100053143 | 99 |
| 281 | 3300031691 | Ga0316579_10106037 | Ga0316579_101060372 | 99 |
| 282 | 3300031691 | Ga0316579_10139971 | Ga0316579_101399713 | 99 |
| 283 | 3300031691 | Ga0316579_10265492 | Ga0316579_102654922 | 99 |
| 284 | 3300031691 | Ga0316579_10359585 | Ga0316579_103595852 | 99 |
| 285 | 3300031711 | Ga0265314_10000695 | Ga0265314_1000069517 | 99 |
| 286 | 3300031711 | Ga0265314_10044803 | Ga0265314_100448033 | 99 |
| 287 | 3300031711 | Ga0265314_10244154 | Ga0265314_102441542 | 99 |
| 288 | 3300031711 | Ga0265314_10582371 | Ga0265314_105823712 | 99 |
| 289 | 3300031727 | Ga0316576_10012034 | Ga0316576_100120347 | 99 |
| 290 | 3300031727 | Ga0316576_10023904 | Ga0316576_100239043 | 99 |
| 291 | 3300031727 | Ga0316576_10092384 | Ga0316576_100923843 | 99 |
| 292 | 3300031727 | Ga0316576_10111617 | Ga0316576_101116172 | 99 |
| 293 | 3300031727 | Ga0316576_10228420 | Ga0316576_102284202 | 99 |
| 294 | 3300031727 | Ga0316576_10234281 | Ga0316576_102342813 | 99 |
| 295 | 3300031727 | Ga0316576_10604169 | Ga0316576_106041692 | 99 |
| 296 | 3300031727 | Ga0316576_11324248 | Ga0316576_113242482 | 99 |
| 297 | 3300031728 | Ga0316578_10007293 | Ga0316578_100072935 | 99 |
| 298 | 3300031728 | Ga0316578_10010611 | Ga0316578_100106112 | 99 |
| 299 | 3300031728 | Ga0316578_10056810 | Ga0316578_100568102 | 99 |
| 300 | 3300031728 | Ga0316578_10061543 | Ga0316578_100615433 | 99 |
| 301 | 3300031728 | Ga0316578_10062242 | Ga0316578_100622423 | 99 |
| 302 | 3300031728 | Ga0316578_10149733 | Ga0316578_101497332 | 99 |
| 303 | 3300031728 | Ga0316578_10239849 | Ga0316578_102398492 | 99 |
| 304 | 3300031728 | Ga0316578_10316154 | Ga0316578_103161542 | 99 |
| 305 | 3300031728 | Ga0316578_10452038 | Ga0316578_104520382 | 99 |
| 306 | 3300031733 | Ga0316577_10004833 | Ga0316577_100048338 | 99 |
| 307 | 3300031733 | Ga0316577_10013861 | Ga0316577_100138612 | 99 |
| 308 | 3300031733 | Ga0316577_10023862 | Ga0316577_100238623 | 99 |
| 309 | 3300031733 | Ga0316577_10134076 | Ga0316577_101340763 | 99 |
| 310 | 3300031733 | Ga0316577_10197181 | Ga0316577_101971813 | 99 |
| 311 | 3300031824 | Ga0307413_10068741 | Ga0307413_100687413 | 99 |
| 312 | 3300031824 | Ga0307413_10082143 | Ga0307413_100821433 | 99 |
| 313 | 3300031903 | Ga0307407_10894506 | Ga0307407_108945062 | 99 |
| 314 | 3300031995 | Ga0307409_102669715 | Ga0307409_1026697151 | 99 |
| 315 | 3300032002 | Ga0307416_100234135 | Ga0307416_1002341353 | 99 |
| 316 | 3300032004 | Ga0307414_10005069 | Ga0307414_1000506910 | 99 |
| 317 | 3300032004 | Ga0307414_10160577 | Ga0307414_101605774 | 99 |
| 318 | 3300032005 | Ga0307411_10230912 | Ga0307411_102309123 | 99 |
| 319 | 3300032133 | Ga0316583_10187225 | Ga0316583_101872252 | 99 |
| 320 | 3300032137 | Ga0316585_10062376 | Ga0316585_100623762 | 99 |
| 321 | 3300032137 | Ga0316585_10200746 | Ga0316585_102007462 | 99 |
| 322 | 3300032137 | Ga0316585_10245587 | Ga0316585_102455871 | 99 |
| 323 | 3300032139 | Ga0316580_10008941 | Ga0316580_100089412 | 99 |
| 324 | 3300032139 | Ga0316580_10159362 | Ga0316580_101593621 | 99 |
| 325 | 3300032168 | Ga0316593_10001438 | Ga0316593_100014382 | 99 |
| 326 | 3300032168 | Ga0316593_10005218 | Ga0316593_100052183 | 99 |
| 327 | 3300032168 | Ga0316593_10007592 | Ga0316593_100075923 | 99 |
| 328 | 3300032168 | Ga0316593_10009320 | Ga0316593_100093202 | 99 |
| 329 | 3300032168 | Ga0316593_10021089 | Ga0316593_100210892 | 99 |
| 330 | 3300032168 | Ga0316593_10030402 | Ga0316593_100304022 | 99 |
| 331 | 3300032168 | Ga0316593_10038088 | Ga0316593_100380882 | 99 |
| 332 | 3300032168 | Ga0316593_10051481 | Ga0316593_100514813 | 99 |
| 333 | 3300032168 | Ga0316593_10239656 | Ga0316593_102396562 | 99 |
| 334 | 3300033179 | Ga0307507_10115035 | Ga0307507_101150353 | 99 |
| 335 | 3300033524 | Ga0316592_1001647 | Ga0316592_10016475 | 99 |
| 336 | 3300033524 | Ga0316592_1004031 | Ga0316592_10040313 | 99 |
| 337 | 3300033527 | Ga0316586_1006539 | Ga0316586_10065392 | 99 |
| 338 | 3300033527 | Ga0316586_1011285 | Ga0316586_10112852 | 99 |
| 339 | 3300033527 | Ga0316586_1082190 | Ga0316586_10821902 | 99 |
| 340 | 3300033528 | Ga0316588_1002175 | Ga0316588_10021755 | 99 |
| 341 | 3300033529 | Ga0316587_1000605 | Ga0316587_10006052 | 99 |
| 342 | 3300033529 | Ga0316587_1001369 | Ga0316587_10013693 | 99 |
| 343 | 3300033529 | Ga0316587_1026280 | Ga0316587_10262802 | 99 |
| 344 | 3300033529 | Ga0316587_1066493 | Ga0316587_10664931 | 99 |
| 345 | 3300033541 | Ga0316596_1002607 | Ga0316596_10026073 | 99 |
| 346 | 3300033541 | Ga0316596_1003987 | Ga0316596_10039874 | 99 |
| 347 | 3300033541 | Ga0316596_1005395 | Ga0316596_10053953 | 99 |
| 348 | 3300033541 | Ga0316596_1017537 | Ga0316596_10175373 | 99 |
| 349 | 3300033541 | Ga0316596_1156885 | Ga0316596_11568852 | 99 |
| 350 | 3300035086 | Ga0373934_0031476 | Ga0373934_0031476_563_871 | 99 |
| 351 | 3300035090 | Ga0373949_0156436 | Ga0373949_0156436_262_561 | 99 |
| 352 | 3300035121 | Ga0373960_0347069 | Ga0373960_0347069_65_367 | 99 |
| 353 | 3300035172 | Ga0373955_0280213 | Ga0373955_0280213_48_347 | 99 |
| 354 | 3300035398 | Ga0316574_0000917 | Ga0316574_0000917_6218_6517 | 99 |
| 355 | 3300035398 | Ga0316574_0016304 | Ga0316574_0016304_2969_3268 | 99 |
| 356 | 3300035398 | Ga0316574_0017949 | Ga0316574_0017949_1605_1904 | 99 |
| 357 | 3300035398 | Ga0316574_0024050 | Ga0316574_0024050_2600_2899 | 99 |
| 358 | 3300035398 | Ga0316574_0031363 | Ga0316574_0031363_1567_1866 | 99 |
| 359 | 3300035398 | Ga0316574_0043388 | Ga0316574_0043388_155_457 | 99 |
| 360 | 3300035398 | Ga0316574_0063386 | Ga0316574_0063386_865_1164 | 99 |
| 361 | 3300035398 | Ga0316574_0065877 | Ga0316574_0065877_748_1047 | 99 |
| 362 | 3300035398 | Ga0316574_0070611 | Ga0316574_0070611_673_975 | 99 |
| 363 | 3300035398 | Ga0316574_0158006 | Ga0316574_0158006_800_1099 | 99 |
| 364 | 3300035398 | Ga0316574_0197633 | Ga0316574_0197633_413_712 | 99 |
| 365 | 3300035398 | Ga0316574_0322234 | Ga0316574_0322234_558_857 | 99 |
| 366 | 3300035398 | Ga0316574_0329566 | Ga0316574_0329566_28_327 | 99 |
| 367 | 3300035398 | Ga0316574_0359894 | Ga0316574_0359894_309_611 | 99 |
| 368 | 3300035398 | Ga0316574_0470007 | Ga0316574_0470007_176_475 | 99 |
| 369 | 3300035398 | Ga0316574_0538927 | Ga0316574_0538927_117_416 | 99 |
| 370 | 3300035398 | Ga0316574_0640603 | Ga0316574_0640603_26_325 | 99 |
| 371 | 3300035398 | Ga0316574_0785017 | Ga0316574_0785017_78_377 | 99 |
| 372 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_316390_316689 | 99 |
| 373 | 3300036647 | Ga0316582_0002944 | Ga0316582_0002944_7553_7852 | 99 |
| 374 | 3300036647 | Ga0316582_0003473 | Ga0316582_0003473_1524_1829 | 99 |
| 375 | 3300036647 | Ga0316582_0010224 | Ga0316582_0010224_1386_1685 | 99 |
| 376 | 3300036647 | Ga0316582_0020160 | Ga0316582_0020160_2087_2386 | 99 |
| 377 | 3300036647 | Ga0316582_0121405 | Ga0316582_0121405_236_538 | 99 |
| 378 | 3300036647 | Ga0316582_0196440 | Ga0316582_0196440_184_483 | 99 |
| 379 | 3300036647 | Ga0316582_0221996 | Ga0316582_0221996_403_705 | 99 |
| 380 | 3300036647 | Ga0316582_0302263 | Ga0316582_0302263_214_516 | 99 |
| 381 | 3300036647 | Ga0316582_0316738 | Ga0316582_0316738_118_420 | 99 |
| 382 | 3300036647 | Ga0316582_0669850 | Ga0316582_0669850_391_693 | 99 |
| 383 | 3300036712 | Ga0316584_0000296 | Ga0316584_0000296_14926_15225 | 99 |
| 384 | 3300036712 | Ga0316584_0004769 | Ga0316584_0004769_5867_6169 | 99 |
| 385 | 3300036712 | Ga0316584_0009712 | Ga0316584_0009712_574_879 | 99 |
| 386 | 3300036712 | Ga0316584_0022679 | Ga0316584_0022679_112_411 | 99 |
| 387 | 3300036712 | Ga0316584_0054814 | Ga0316584_0054814_1922_2224 | 99 |
| 388 | 3300036712 | Ga0316584_0085991 | Ga0316584_0085991_183_482 | 99 |
| 389 | 3300036712 | Ga0316584_0181699 | Ga0316584_0181699_351_650 | 99 |
| 390 | 3300036712 | Ga0316584_0245427 | Ga0316584_0245427_143_442 | 99 |
| 391 | 3300036712 | Ga0316584_0530190 | Ga0316584_0530190_160_459 | 99 |
| 392 | 3300036712 | Ga0316584_0719068 | Ga0316584_0719068_129_431 | 99 |
| 393 | 3300037312 | Ga0395899_0057003 | Ga0395899_0057003_306_605 | 99 |
| 394 | 3300037312 | Ga0395899_0200134 | Ga0395899_0200134_602_901 | 99 |
| 395 | 3300037312 | Ga0395899_0919260 | Ga0395899_0919260_200_502 | 99 |
| 396 | 3300037418 | Ga0395900_0007174 | Ga0395900_0007174_4205_4504 | 99 |
| 397 | 3300037418 | Ga0395900_0064142 | Ga0395900_0064142_1154_1456 | 99 |
| 398 | 3300037418 | Ga0395900_0664007 | Ga0395900_0664007_637_939 | 99 |
| 399 | 3300037466 | Ga0395898_0044148 | Ga0395898_0044148_777_1076 | 99 |
| 400 | 3300037466 | Ga0395898_0127063 | Ga0395898_0127063_1138_1437 | 99 |
| 401 | 3300037471 | Ga0395905_0093701 | Ga0395905_0093701_433_732 | 99 |
| 402 | 3300037471 | Ga0395905_0143599 | Ga0395905_0143599_769_1068 | 99 |
| 403 | 3300037588 | Ga0316581_0020940 | Ga0316581_0020940_518_823 | 99 |
| 404 | 3300037588 | Ga0316581_0045368 | Ga0316581_0045368_801_1100 | 99 |
| 405 | 3300038443 | Ga0395901_0009614 | Ga0395901_0009614_669_968 | 99 |
| 406 | 3300038443 | Ga0395901_0077019 | Ga0395901_0077019_945_1244 | 99 |
| 407 | 3300038443 | Ga0395901_0085496 | Ga0395901_0085496_900_1202 | 99 |
| 408 | 3300038725 | Ga0400484_13421 | Ga0400484_13421_10232_10534 | 99 |
| 409 | 3300038725 | Ga0400484_36729 | Ga0400484_36729_667_969 | 99 |
| 410 | 3300038726 | Ga0400490_57276 | Ga0400490_57276_9185_9487 | 99 |
| 411 | 3300038726 | Ga0400490_60783 | Ga0400490_60783_3115_3417 | 99 |
| 412 | 3300038727 | Ga0400491_13912 | Ga0400491_13912_1686_1988 | 99 |
| 413 | 3300038727 | Ga0400491_26096 | Ga0400491_26096_1451_1753 | 99 |
| 414 | 3300038735 | Ga0400485_07884 | Ga0400485_07884_52038_52340 | 99 |
| 415 | 3300038741 | Ga0400488_12060 | Ga0400488_12060_5902_6204 | 99 |
| 416 | 3300038741 | Ga0400488_14459 | Ga0400488_14459_999_1301 | 99 |
| 417 | 3300038741 | Ga0400488_38117 | Ga0400488_38117_789_1091 | 99 |
| 418 | 3300038741 | Ga0400488_47132 | Ga0400488_47132_491_793 | 99 |
| 419 | 3300038741 | Ga0400488_62074 | Ga0400488_62074_17007_17309 | 99 |
| 420 | 3300038742 | Ga0400486_28685 | Ga0400486_28685_70753_71055 | 99 |
| 421 | 3300039062 | Ga0400483_074278 | Ga0400483_074278_826_1146 | 99 |
| 422 | 3300039062 | Ga0400483_078872 | Ga0400483_078872_6982_7284 | 99 |
| 423 | 3300039062 | Ga0400483_243724 | Ga0400483_243724_1394_1696 | 99 |
| 424 | 3300039062 | Ga0400483_261783 | Ga0400483_261783_1786_2085 | 99 |
| 425 | 3300039062 | Ga0400483_262546 | Ga0400483_262546_1165_1485 | 99 |
| 426 | 3300039093 | Ga0400489_37628 | Ga0400489_37628_232_531 | 99 |
| 427 | 3300039110 | Ga0400487_17750 | Ga0400487_17750_897_1199 | 99 |
| 428 | 3300039110 | Ga0400487_19743 | Ga0400487_19743_727_1029 | 99 |
| 429 | 3300039110 | Ga0400487_27243 | Ga0400487_27243_1086_1388 | 99 |
| 430 | 3300039110 | Ga0400487_63494 | Ga0400487_63494_11765_12067 | 99 |
| 431 | 3300039447 | Ga0436361_0215157 | Ga0436361_0215157_109656_109958 | 99 |
| 432 | 3300039447 | Ga0436361_0406661 | Ga0436361_0406661_13971_14273 | 99 |
| 433 | 3300039447 | Ga0436361_0857217 | Ga0436361_0857217_259_561 | 99 |
| 434 | 3300039447 | Ga0436361_0880017 | Ga0436361_0880017_4418_4720 | 99 |
| 435 | 3300039447 | Ga0436361_0883037 | Ga0436361_0883037_204_506 | 99 |
| 436 | 3300039447 | Ga0436361_1012185 | Ga0436361_1012185_505_807 | 99 |
| 437 | 3300039447 | Ga0436361_1132645 | Ga0436361_1132645_2192_2494 | 99 |
| 438 | 3300041404 | Ga0439436_0010326 | Ga0439436_0010326_216_515 | 99 |
| 439 | 3300041406 | Ga0439439_0001670 | Ga0439439_0001670_783_1082 | 99 |
| 440 | 3300041456 | Ga0451795_0341801 | Ga0451795_0341801_727_1026 | 99 |
| 441 | 3300041460 | Ga0451802_0570730 | Ga0451802_0570730_534_833 | 99 |
| 442 | 3300041486 | Ga0451807_0581176 | Ga0451807_0581176_204_506 | 99 |
| 443 | 3300041486 | Ga0451807_2618503 | Ga0451807_2618503_473_772 | 99 |
| 444 | 3300041494 | Ga0451837_1382718 | Ga0451837_1382718_1937_2236 | 99 |
| 445 | 3300042004 | Ga0439445_0004296 | Ga0439445_0004296_672_971 | 99 |
| 446 | 3300042004 | Ga0439445_0123772 | Ga0439445_0123772_214_516 | 99 |
| 447 | 3300042006 | Ga0439432_008540 | Ga0439432_008540_1415_1714 | 99 |
| 448 | 3300042007 | Ga0439449_0019101 | Ga0439449_0019101_1643_1942 | 99 |
| 449 | 3300042012 | Ga0439455_0176088 | Ga0439455_0176088_263_562 | 99 |
| 450 | 3300042015 | Ga0439462_0012694 | Ga0439462_0012694_1490_1789 | 99 |
| 451 | 3300042876 | Ga0451577_0050976 | Ga0451577_0050976_2960_3262 | 99 |
| 452 | 3300042876 | Ga0451577_0087260 | Ga0451577_0087260_2253_2552 | 99 |
| 453 | 3300042876 | Ga0451577_0119469 | Ga0451577_0119469_1616_1918 | 99 |
| 454 | 3300042876 | Ga0451577_0264760 | Ga0451577_0264760_1139_1441 | 99 |
| 455 | 3300042876 | Ga0451577_0269066 | Ga0451577_0269066_1186_1485 | 99 |
| 456 | 3300042876 | Ga0451577_0874135 | Ga0451577_0874135_202_507 | 99 |
| 457 | 3300042876 | Ga0451577_0908700 | Ga0451577_0908700_346_648 | 99 |
| 458 | 3300044656 | Ga0466969_0008592 | Ga0466969_0008592_2060_2362 | 99 |
| 459 | 3300044656 | Ga0466969_0022510 | Ga0466969_0022510_688_990 | 99 |
| 460 | 3300044661 | Ga0466975_0340179 | Ga0466975_0340179_593_895 | 99 |
| 461 | 3300044673 | Ga0453683_0204910 | Ga0453683_0204910_903_1205 | 99 |
| 462 | 3300044683 | Ga0466965_0011487 | Ga0466965_0011487_1375_1677 | 99 |
| 463 | 3300044684 | Ga0466966_0011013 | Ga0466966_0011013_2083_2385 | 99 |
| 464 | 3300044684 | Ga0466966_0024354 | Ga0466966_0024354_3359_3661 | 99 |
| 465 | 3300044693 | Ga0466961_0000131 | Ga0466961_0000131_38337_38639 | 99 |
| 466 | 3300044693 | Ga0466961_0003687 | Ga0466961_0003687_9005_9307 | 99 |
| 467 | 3300044693 | Ga0466961_0004743 | Ga0466961_0004743_435_737 | 99 |
| 468 | 3300044712 | Ga0453684_0004710 | Ga0453684_0004710_4445_4744 | 99 |
| 469 | 3300044712 | Ga0453684_0007598 | Ga0453684_0007598_19235_19537 | 99 |
| 470 | 3300044712 | Ga0453684_0013476 | Ga0453684_0013476_10762_11064 | 99 |
| 471 | 3300044712 | Ga0453684_0212635 | Ga0453684_0212635_797_1099 | 99 |
| 472 | 3300044712 | Ga0453684_0237233 | Ga0453684_0237233_1479_1781 | 99 |
| 473 | 3300044712 | Ga0453684_0778832 | Ga0453684_0778832_314_613 | 99 |
| 474 | 3300044712 | Ga0453684_1795844 | Ga0453684_1795844_308_610 | 99 |
| 475 | 3300044765 | Ga0466970_0052824 | Ga0466970_0052824_424_726 | 99 |
| 476 | 3300044765 | Ga0466970_0109262 | Ga0466970_0109262_735_1037 | 99 |
| 477 | 3300044842 | Ga0466957_0109237 | Ga0466957_0109237_1194_1496 | 99 |
| 478 | 3300045049 | Ga0466959_0000232 | Ga0466959_0000232_16587_16889 | 99 |
| 479 | 3300045049 | Ga0466959_0000838 | Ga0466959_0000838_16617_16919 | 99 |
| 480 | 3300045049 | Ga0466959_1073702 | Ga0466959_1073702_177_479 | 99 |
| 481 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_217491_217793 | 99 |
| 482 | 3300045051 | Ga0451576_0000250 | Ga0451576_0000250_110203_110508 | 99 |
| 483 | 3300045051 | Ga0451576_0001427 | Ga0451576_0001427_38474_38776 | 99 |
| 484 | 3300045051 | Ga0451576_0026520 | Ga0451576_0026520_861_1163 | 99 |
| 485 | 3300045051 | Ga0451576_0029526 | Ga0451576_0029526_722_1024 | 99 |
| 486 | 3300045051 | Ga0451576_0044995 | Ga0451576_0044995_3077_3379 | 99 |
| 487 | 3300045051 | Ga0451576_0070946 | Ga0451576_0070946_181_483 | 99 |
| 488 | 3300045051 | Ga0451576_0259649 | Ga0451576_0259649_317_619 | 99 |
| 489 | 3300045051 | Ga0451576_1042154 | Ga0451576_1042154_271_573 | 99 |
| 490 | 3300045051 | Ga0451576_1051696 | Ga0451576_1051696_368_670 | 99 |
| 491 | 3300045051 | Ga0451576_1077088 | Ga0451576_1077088_268_570 | 99 |
| 492 | 3300045051 | Ga0451576_1115684 | Ga0451576_1115684_227_526 | 99 |
| 493 | 3300045051 | Ga0451576_1232305 | Ga0451576_1232305_168_470 | 99 |
| 494 | 3300045836 | Ga0466958_0031465 | Ga0466958_0031465_2543_2845 | 99 |
| 495 | 3300046452 | Ga0495617_000288 | Ga0495617_000288_24965_25264 | 99 |
| 496 | 3300046452 | Ga0495617_000874 | Ga0495617_000874_409_708 | 99 |
| 497 | 3300046453 | Ga0495627_000778 | Ga0495627_000778_4465_4764 | 99 |
| 498 | 3300046457 | Ga0495590_0011311 | Ga0495590_0011311_2729_3028 | 99 |
| 499 | 3300046460 | Ga0495638_0000584 | Ga0495638_0000584_30621_30920 | 99 |
| 500 | 3300046471 | Ga0495650_0008270 | Ga0495650_0008270_1837_2136 | 99 |
| 501 | 3300046471 | Ga0495650_0146583 | Ga0495650_0146583_405_704 | 99 |
| 502 | 3300046474 | Ga0495605_0062734 | Ga0495605_0062734_1109_1408 | 99 |
| 503 | 3300046491 | Ga0495584_0010943 | Ga0495584_0010943_372_671 | 99 |
| 504 | 3300046492 | Ga0495585_0000019 | Ga0495585_0000019_25621_25920 | 99 |
| 505 | 3300046492 | Ga0495585_0231149 | Ga0495585_0231149_344_643 | 99 |
| 506 | 3300046501 | Ga0495607_0000430 | Ga0495607_0000430_40372_40671 | 99 |
| 507 | 3300046501 | Ga0495607_0252086 | Ga0495607_0252086_204_503 | 99 |
| 508 | 3300046506 | Ga0495583_0036562 | Ga0495583_0036562_1389_1688 | 99 |
| 509 | 3300046507 | Ga0495606_0000665 | Ga0495606_0000665_25034_25333 | 99 |
| 510 | 3300046507 | Ga0495606_0000888 | Ga0495606_0000888_474_773 | 99 |
| 511 | 3300046507 | Ga0495606_0002803 | Ga0495606_0002803_17279_17578 | 99 |
| 512 | 3300046507 | Ga0495606_0314611 | Ga0495606_0314611_373_672 | 99 |
| 513 | 3300046512 | Ga0495610_0024167 | Ga0495610_0024167_292_591 | 99 |
| 514 | 3300046512 | Ga0495610_0099501 | Ga0495610_0099501_214_513 | 99 |
| 515 | 3300046513 | Ga0495616_0000047 | Ga0495616_0000047_408_707 | 99 |
| 516 | 3300046513 | Ga0495616_0129543 | Ga0495616_0129543_450_749 | 99 |
| 517 | 3300046513 | Ga0495616_0238355 | Ga0495616_0238355_450_749 | 99 |
| 518 | 3300046515 | Ga0495620_0007968 | Ga0495620_0007968_1834_2133 | 99 |
| 519 | 3300046515 | Ga0495620_0012378 | Ga0495620_0012378_453_752 | 99 |
| 520 | 3300046517 | Ga0495630_0466972 | Ga0495630_0466972_100_399 | 99 |
| 521 | 3300046518 | Ga0495631_0000361 | Ga0495631_0000361_1611_1910 | 99 |
| 522 | 3300046518 | Ga0495631_0000705 | Ga0495631_0000705_373_672 | 99 |
| 523 | 3300046518 | Ga0495631_0000767 | Ga0495631_0000767_6622_6921 | 99 |
| 524 | 3300046519 | Ga0495632_0045045 | Ga0495632_0045045_1543_1842 | 99 |
| 525 | 3300046519 | Ga0495632_0046221 | Ga0495632_0046221_1768_2067 | 99 |
| 526 | 3300046519 | Ga0495632_0210392 | Ga0495632_0210392_358_657 | 99 |
| 527 | 3300046524 | Ga0495648_0000947 | Ga0495648_0000947_26157_26456 | 99 |
| 528 | 3300046524 | Ga0495648_0003270 | Ga0495648_0003270_13655_13954 | 99 |
| 529 | 3300046525 | Ga0495663_0073966 | Ga0495663_0073966_179_478 | 99 |
| 530 | 3300046530 | Ga0495654_0000922 | Ga0495654_0000922_2539_2838 | 99 |
| 531 | 3300046531 | Ga0495665_0086171 | Ga0495665_0086171_420_719 | 99 |
| 532 | 3300046538 | Ga0495609_0001428 | Ga0495609_0001428_13716_14015 | 99 |
| 533 | 3300046539 | Ga0495621_0108453 | Ga0495621_0108453_327_626 | 99 |
| 534 | 3300046615 | Ga0495656_0038020 | Ga0495656_0038020_340_639 | 99 |
| 535 | 3300046616 | Ga0495668_0006146 | Ga0495668_0006146_1807_2106 | 99 |
| 536 | 3300046616 | Ga0495668_0216334 | Ga0495668_0216334_387_686 | 99 |
| 537 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_630833_631132 | 99 |
| 538 | 3300046648 | Ga0495611_0000239 | Ga0495611_0000239_24535_24834 | 99 |
| 539 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_1284915_1285214 | 99 |
| 540 | 3300046660 | Ga0495625_0434806 | Ga0495625_0434806_135_434 | 99 |
| 541 | 3300046665 | Ga0495661_0001751 | Ga0495661_0001751_3372_3671 | 99 |
| 542 | 3300046691 | Ga0495670_0010116 | Ga0495670_0010116_2658_2957 | 99 |
| 543 | 3300046691 | Ga0495670_0050033 | Ga0495670_0050033_1434_1733 | 99 |
| 544 | 3300046691 | Ga0495670_0275207 | Ga0495670_0275207_275_574 | 99 |
| 545 | 3300046692 | Ga0495671_0000272 | Ga0495671_0000272_41232_41531 | 99 |
| 546 | 3300046794 | Ga0495589_0000329 | Ga0495589_0000329_3296_3595 | 99 |
| 547 | 3300046810 | Ga0495660_0047556 | Ga0495660_0047556_531_830 | 99 |
| 548 | 3300046810 | Ga0495660_0047561 | Ga0495660_0047561_531_830 | 99 |
| 549 | 3300047318 | Ga0495636_0110047 | Ga0495636_0110047_715_1014 | 99 |
| 550 | 3300047320 | Ga0495672_0006584 | Ga0495672_0006584_3498_3797 | 99 |
| 551 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_957464_957763 | 99 |
| 552 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_1357060_1357359 | 99 |
| 553 | 3300047469 | Ga0495673_0000099 | Ga0495673_0000099_32076_32375 | 99 |
| 554 | 3300047469 | Ga0495673_0035008 | Ga0495673_0035008_1545_1844 | 99 |
| 555 | 3300047469 | Ga0495673_0285818 | Ga0495673_0285818_39_338 | 99 |
| 556 | 3300047472 | Ga0495686_0000255 | Ga0495686_0000255_71156_71455 | 99 |
| 557 | 3300047472 | Ga0495686_0052579 | Ga0495686_0052579_382_681 | 99 |
| 558 | 3300047472 | Ga0495686_0065153 | Ga0495686_0065153_368_667 | 99 |
| 559 | 3300047472 | Ga0495686_0372021 | Ga0495686_0372021_455_754 | 99 |
| 560 | 3300047472 | Ga0495686_0547305 | Ga0495686_0547305_228_527 | 99 |
| 561 | 3300048903 | Ga0496100_0160269 | Ga0496100_0160269_318_617 | 99 |
| 562 | 3300048903 | Ga0496100_1118917 | Ga0496100_1118917_236_535 | 99 |
| 563 | 3300048904 | Ga0496101_0063136 | Ga0496101_0063136_896_1195 | 99 |
| 564 | 3300048905 | Ga0496102_0332424 | Ga0496102_0332424_34_333 | 99 |
| 565 | 3300048905 | Ga0496102_0642306 | Ga0496102_0642306_424_723 | 99 |
| 566 | 3300048906 | Ga0496103_0369715 | Ga0496103_0369715_486_785 | 99 |
| 567 | 3300048909 | Ga0496106_0002577 | Ga0496106_0002577_7684_7983 | 99 |
| 568 | 3300048910 | Ga0496107_1112225 | Ga0496107_1112225_195_494 | 99 |
| 569 | 3300048911 | Ga0496108_0298956 | Ga0496108_0298956_532_834 | 99 |
| 570 | 3300048912 | Ga0496109_0542389 | Ga0496109_0542389_466_768 | 99 |
| 571 | 3300048918 | Ga0496115_0302808 | Ga0496115_0302808_490_792 | 99 |
| 572 | 3300048919 | Ga0496116_0168745 | Ga0496116_0168745_240_539 | 99 |
| 573 | 3300048920 | Ga0496117_0068320 | Ga0496117_0068320_1867_2166 | 99 |
| 574 | 3300048920 | Ga0496117_0221893 | Ga0496117_0221893_702_1001 | 99 |
| 575 | 3300048921 | Ga0496118_0002292 | Ga0496118_0002292_7911_8210 | 99 |
| 576 | 3300048921 | Ga0496118_0015532 | Ga0496118_0015532_5001_5300 | 99 |
| 577 | 3300048921 | Ga0496118_0029973 | Ga0496118_0029973_3457_3756 | 99 |
| 578 | 3300048924 | Ga0496121_0000210 | Ga0496121_0000210_82661_82960 | 99 |
| 579 | 3300048924 | Ga0496121_0002725 | Ga0496121_0002725_24553_24852 | 99 |
| 580 | 3300048924 | Ga0496121_0074823 | Ga0496121_0074823_407_706 | 99 |
| 581 | 3300048924 | Ga0496121_0311210 | Ga0496121_0311210_459_758 | 99 |
| 582 | 3300048924 | Ga0496121_0415780 | Ga0496121_0415780_307_606 | 99 |
| 583 | 3300048925 | Ga0496122_0032475 | Ga0496122_0032475_282_581 | 99 |
| 584 | 3300048925 | Ga0496122_0100938 | Ga0496122_0100938_70_369 | 99 |
| 585 | 3300048925 | Ga0496122_0227339 | Ga0496122_0227339_734_1033 | 99 |
| 586 | 3300048925 | Ga0496122_0256459 | Ga0496122_0256459_90_389 | 99 |
| 587 | 3300048926 | Ga0496123_0058141 | Ga0496123_0058141_1908_2207 | 99 |
| 588 | 3300048926 | Ga0496123_0071913 | Ga0496123_0071913_295_594 | 99 |
| 589 | 3300048928 | Ga0496125_0012647 | Ga0496125_0012647_1117_1416 | 99 |
| 590 | 3300048929 | Ga0496126_1263775 | Ga0496126_1263775_104_403 | 99 |
| 591 | 3300049459 | Ga0495678_000664 | Ga0495678_000664_21183_21482 | 99 |
| 592 | 3300049460 | Ga0495682_0020684 | Ga0495682_0020684_1762_2061 | 99 |
| 593 | 3300049460 | Ga0495682_0041271 | Ga0495682_0041271_984_1283 | 99 |
| 594 | 3300049523 | Ga0501300_072364 | Ga0501300_072364_169_471 | 99 |
| 595 | 3300049568 | Ga0501031_0036335 | Ga0501031_0036335_547_846 | 99 |
| 596 | 3300049568 | Ga0501031_0819665 | Ga0501031_0819665_38_352 | 99 |
| 597 | 3300049569 | Ga0501032_0000744 | Ga0501032_0000744_17896_18195 | 99 |
| 598 | 3300049569 | Ga0501032_0021539 | Ga0501032_0021539_3448_3750 | 99 |
| 599 | 3300049569 | Ga0501032_0869784 | Ga0501032_0869784_237_536 | 99 |
| 600 | 3300049570 | Ga0501033_0003954 | Ga0501033_0003954_644_958 | 99 |
| 601 | 3300049570 | Ga0501033_0010512 | Ga0501033_0010512_4675_4974 | 99 |
| 602 | 3300049570 | Ga0501033_0083570 | Ga0501033_0083570_2025_2324 | 99 |
| 603 | 3300049571 | Ga0501034_0000996 | Ga0501034_0000996_28900_29199 | 99 |
| 604 | 3300049571 | Ga0501034_0002335 | Ga0501034_0002335_20040_20339 | 99 |
| 605 | 3300049571 | Ga0501034_0104860 | Ga0501034_0104860_2422_2724 | 99 |
| 606 | 3300049571 | Ga0501034_0484912 | Ga0501034_0484912_540_839 | 99 |
| 607 | 3300049571 | Ga0501034_0659861 | Ga0501034_0659861_454_753 | 99 |
| 608 | 3300049571 | Ga0501034_0798819 | Ga0501034_0798819_304_609 | 99 |
| 609 | 3300049572 | Ga0501036_0043683 | Ga0501036_0043683_1294_1593 | 99 |
| 610 | 3300049572 | Ga0501036_0207362 | Ga0501036_0207362_368_673 | 99 |
| 611 | 3300049573 | Ga0501037_0000566 | Ga0501037_0000566_3157_3456 | 99 |
| 612 | 3300049573 | Ga0501037_0004006 | Ga0501037_0004006_936_1235 | 99 |
| 613 | 3300049573 | Ga0501037_0007619 | Ga0501037_0007619_1420_1719 | 99 |
| 614 | 3300049573 | Ga0501037_0095314 | Ga0501037_0095314_82_381 | 99 |
| 615 | 3300049573 | Ga0501037_0327745 | Ga0501037_0327745_691_993 | 99 |
| 616 | 3300049573 | Ga0501037_0458867 | Ga0501037_0458867_543_842 | 99 |
| 617 | 3300049573 | Ga0501037_0820218 | Ga0501037_0820218_53_352 | 99 |
| 618 | 3300049573 | Ga0501037_0950502 | Ga0501037_0950502_229_531 | 99 |
| 619 | 3300049574 | Ga0501038_0000746 | Ga0501038_0000746_18356_18655 | 99 |
| 620 | 3300049574 | Ga0501038_0005436 | Ga0501038_0005436_6460_6759 | 99 |
| 621 | 3300049574 | Ga0501038_0007938 | Ga0501038_0007938_4592_4891 | 99 |
| 622 | 3300049574 | Ga0501038_0014627 | Ga0501038_0014627_819_1124 | 99 |
| 623 | 3300049574 | Ga0501038_0371693 | Ga0501038_0371693_285_584 | 99 |
| 624 | 3300049575 | Ga0501039_0012430 | Ga0501039_0012430_4058_4357 | 99 |
| 625 | 3300049575 | Ga0501039_0067110 | Ga0501039_0067110_2077_2376 | 99 |
| 626 | 3300049575 | Ga0501039_0257096 | Ga0501039_0257096_145_444 | 99 |
| 627 | 3300049578 | Ga0501042_0322089 | Ga0501042_0322089_599_898 | 99 |
| 628 | 3300049578 | Ga0501042_0363175 | Ga0501042_0363175_656_955 | 99 |
| 629 | 3300049579 | Ga0501043_0005586 | Ga0501043_0005586_6010_6309 | 99 |
| 630 | 3300049579 | Ga0501043_0024289 | Ga0501043_0024289_4159_4461 | 99 |
| 631 | 3300049579 | Ga0501043_0054377 | Ga0501043_0054377_425_724 | 99 |
| 632 | 3300049579 | Ga0501043_0339815 | Ga0501043_0339815_280_579 | 99 |
| 633 | 3300049579 | Ga0501043_1334928 | Ga0501043_1334928_146_445 | 99 |
| 634 | 3300049580 | Ga0501046_0000760 | Ga0501046_0000760_17084_17383 | 99 |
| 635 | 3300049580 | Ga0501046_0314335 | Ga0501046_0314335_499_798 | 99 |
| 636 | 3300049580 | Ga0501046_0340015 | Ga0501046_0340015_520_819 | 99 |
| 637 | 3300049581 | Ga0501047_0001682 | Ga0501047_0001682_17546_17845 | 99 |
| 638 | 3300049581 | Ga0501047_0006314 | Ga0501047_0006314_3345_3644 | 99 |
| 639 | 3300049581 | Ga0501047_0224359 | Ga0501047_0224359_305_604 | 99 |
| 640 | 3300049581 | Ga0501047_0224384 | Ga0501047_0224384_1393_1692 | 99 |
| 641 | 3300049581 | Ga0501047_0291289 | Ga0501047_0291289_900_1199 | 99 |
| 642 | 3300049581 | Ga0501047_0540519 | Ga0501047_0540519_504_803 | 99 |
| 643 | 3300049581 | Ga0501047_0597252 | Ga0501047_0597252_397_696 | 99 |
| 644 | 3300049581 | Ga0501047_0822098 | Ga0501047_0822098_160_459 | 99 |
| 645 | 3300049582 | Ga0501048_0283698 | Ga0501048_0283698_731_1030 | 99 |
| 646 | 3300049583 | Ga0501067_0037230 | Ga0501067_0037230_529_828 | 99 |
| 647 | 3300049583 | Ga0501067_0048538 | Ga0501067_0048538_685_984 | 99 |
| 648 | 3300049583 | Ga0501067_0085285 | Ga0501067_0085285_1319_1618 | 99 |
| 649 | 3300049585 | Ga0501069_0028355 | Ga0501069_0028355_301_600 | 99 |
| 650 | 3300049585 | Ga0501069_0047385 | Ga0501069_0047385_1033_1335 | 99 |
| 651 | 3300049585 | Ga0501069_0246042 | Ga0501069_0246042_57_359 | 99 |
| 652 | 3300049586 | Ga0501070_0003644 | Ga0501070_0003644_8718_9017 | 99 |
| 653 | 3300049586 | Ga0501070_0003853 | Ga0501070_0003853_10235_10534 | 99 |
| 654 | 3300049586 | Ga0501070_0021411 | Ga0501070_0021411_1632_1931 | 99 |
| 655 | 3300049586 | Ga0501070_0033976 | Ga0501070_0033976_536_835 | 99 |
| 656 | 3300049586 | Ga0501070_0047614 | Ga0501070_0047614_3026_3325 | 99 |
| 657 | 3300049586 | Ga0501070_0080426 | Ga0501070_0080426_1515_1817 | 99 |
| 658 | 3300049586 | Ga0501070_0102947 | Ga0501070_0102947_909_1211 | 99 |
| 659 | 3300049588 | Ga0501072_0000714 | Ga0501072_0000714_2989_3288 | 99 |
| 660 | 3300049589 | Ga0501073_0001389 | Ga0501073_0001389_10178_10477 | 99 |
| 661 | 3300049589 | Ga0501073_0060100 | Ga0501073_0060100_409_708 | 99 |
| 662 | 3300049589 | Ga0501073_0091460 | Ga0501073_0091460_461_760 | 99 |
| 663 | 3300049589 | Ga0501073_0998950 | Ga0501073_0998950_142_441 | 99 |
| 664 | 3300049590 | Ga0501074_0000672 | Ga0501074_0000672_19101_19400 | 99 |
| 665 | 3300049590 | Ga0501074_0031093 | Ga0501074_0031093_1040_1339 | 99 |
| 666 | 3300049590 | Ga0501074_1320589 | Ga0501074_1320589_41_343 | 99 |
| 667 | 3300049591 | Ga0501075_0075495 | Ga0501075_0075495_927_1226 | 99 |
| 668 | 3300049593 | Ga0501077_0200093 | Ga0501077_0200093_167_469 | 99 |
| 669 | 3300049741 | Ga0501079_0088598 | Ga0501079_0088598_2073_2372 | 99 |
| 670 | 3300049741 | Ga0501079_0507019 | Ga0501079_0507019_258_560 | 99 |
| 671 | 3300049742 | Ga0501080_0010993 | Ga0501080_0010993_4361_4660 | 99 |
| 672 | 3300049742 | Ga0501080_0023507 | Ga0501080_0023507_1295_1594 | 99 |
| 673 | 3300049742 | Ga0501080_0025335 | Ga0501080_0025335_3284_3583 | 99 |
| 674 | 3300049742 | Ga0501080_0194744 | Ga0501080_0194744_269_571 | 99 |
| 675 | 3300049742 | Ga0501080_0194865 | Ga0501080_0194865_243_542 | 99 |
| 676 | 3300049742 | Ga0501080_1529515 | Ga0501080_1529515_113_412 | 99 |
| 677 | 3300049744 | Ga0501083_0020036 | Ga0501083_0020036_2173_2472 | 99 |
| 678 | 3300049776 | Ga0501280_000116 | Ga0501280_000116_10994_11296 | 99 |
| 679 | 3300049822 | Ga0501035_0003276 | Ga0501035_0003276_3345_3644 | 99 |
| 680 | 3300049822 | Ga0501035_0040291 | Ga0501035_0040291_2574_2879 | 99 |
| 681 | 3300049822 | Ga0501035_0060626 | Ga0501035_0060626_1045_1344 | 99 |
| 682 | 3300049822 | Ga0501035_0063180 | Ga0501035_0063180_1220_1519 | 99 |
| 683 | 3300049822 | Ga0501035_0333878 | Ga0501035_0333878_685_984 | 99 |
| 684 | 3300049822 | Ga0501035_1006512 | Ga0501035_1006512_171_470 | 99 |
| 685 | 3300049822 | Ga0501035_1558208 | Ga0501035_1558208_160_459 | 99 |
| 686 | 3300049823 | Ga0501044_0000190 | Ga0501044_0000190_9975_10280 | 99 |
| 687 | 3300049823 | Ga0501044_0002882 | Ga0501044_0002882_13631_13930 | 99 |
| 688 | 3300049823 | Ga0501044_0025830 | Ga0501044_0025830_2615_2914 | 99 |
| 689 | 3300049823 | Ga0501044_0062309 | Ga0501044_0062309_1467_1766 | 99 |
| 690 | 3300049823 | Ga0501044_0133563 | Ga0501044_0133563_1750_2160 | 99 |
| 691 | 3300049823 | Ga0501044_0204715 | Ga0501044_0204715_1039_1338 | 99 |
| 692 | 3300049823 | Ga0501044_0907414 | Ga0501044_0907414_106_405 | 99 |
| 693 | 3300049823 | Ga0501044_1047509 | Ga0501044_1047509_258_560 | 99 |
| 694 | 3300049823 | Ga0501044_1416828 | Ga0501044_1416828_117_419 | 99 |
| 695 | 3300050491 | nmdc:mga00v17_37036_c1 | nmdc:mga00v17_37036_c1_1670_1972 | 99 |
| 696 | 3300050492 | nmdc:mga0yw44_1241947_c1 | nmdc:mga0yw44_1241947_c1_156_458 | 99 |
| 697 | 3300050493 | nmdc:mga0k408_160022_c1 | nmdc:mga0k408_160022_c1_95_403 | 99 |
| 698 | 3300050493 | nmdc:mga0k408_32718_c1 | nmdc:mga0k408_32718_c1_1742_2044 | 99 |
| 699 | 3300050493 | nmdc:mga0k408_7088_c1 | nmdc:mga0k408_7088_c1_5439_5747 | 99 |
| 700 | 3300050494 | nmdc:mga06z11_540788_c1 | nmdc:mga06z11_540788_c1_72_380 | 99 |
| 701 | 3300050496 | nmdc:mga07m45_84427_c1 | nmdc:mga07m45_84427_c1_254_556 | 99 |
| 702 | 3300050510 | nmdc:mga06r32_680441_c1 | nmdc:mga06r32_680441_c1_445_744 | 99 |
| 703 | 3300050516 | nmdc:mga0sz30_51816_c1 | nmdc:mga0sz30_51816_c1_83_385 | 99 |
| 704 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_1193242_1193541 | 99 |
| 705 | 3300053094 | Ga0500566_0466051 | Ga0500566_0466051_94_393 | 99 |
| 706 | 3300053096 | Ga0500641_0002680 | Ga0500641_0002680_110_412 | 99 |
| 707 | 3300053103 | Ga0500555_000245 | Ga0500555_000245_21731_22030 | 99 |
| 708 | 3300053136 | Ga0500559_0039706 | Ga0500559_0039706_60_362 | 99 |
| 709 | 3300053156 | Ga0500622_0000023 | Ga0500622_0000023_89330_89632 | 99 |
| 710 | 3300053177 | Ga0500636_0000837 | Ga0500636_0000837_3656_3958 | 99 |
| 711 | 3300053178 | Ga0500637_0028995 | Ga0500637_0028995_1156_1458 | 99 |
| 712 | 3300053730 | Ga0500645_000235 | Ga0500645_000235_27981_28280 | 99 |
| 713 | 3300054114 | Ga0501084_0115255 | Ga0501084_0115255_37_336 | 99 |
| 714 | 3300055283 | Ga0500661_025343 | Ga0500661_025343_316_618 | 99 |
| 715 | 3300060353 | Ga0501082_0077132 | Ga0501082_0077132_1884_2183 | 99 |
| 716 | 3300060353 | Ga0501082_1315532 | Ga0501082_1315532_205_504 | 99 |
| 717 | 3300060353 | Ga0501082_1484152 | Ga0501082_1484152_139_438 | 99 |
| 718 | 3300061719 | Ga0466962_0368067 | Ga0466962_0368067_104_406 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mwq-assembly1.cif.gz_A | structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine | 0.9976 | 1 | 98 |
| 1mwq-assembly1.cif.gz_A | structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine | 0.9777 | 1 | 98 |
| 4lbp-assembly1.cif.gz_A | 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone | 0.8967 | 1 | 95 |
| 4lbp-assembly1.cif.gz_A | 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone | 0.838 | 1 | 95 |
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.6913 | 1 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 1.005 | 1 | 98 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.9949 | 1 | 98 | 3.30.70.1060 |
| 4lbiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8905 | 3 | 96 | 3.30.70.1060 |
| 4lbiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8637 | 3 | 96 | 3.30.70.1060 |
| af_Q5A784_25_117_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7872 | 2 | 96 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H3KWQ4-F1-model_v4 | Protein YciI | 1.006 | 1 | 98 |
|
| AF-A0A7Z1UAA2-F1-model_v4 | deleted | 1.005 | 1 | 98 |
|
| AF-A0A0L7ZB45-F1-model_v4 | deleted | 1.005 | 1 | 98 |
|
| AF-A0A7X1LMW3-F1-model_v4 | YciI family protein | 1.005 | 1 | 99 |
|
| AF-A0A4V2W5I5-F1-model_v4 | YCII-related domain-containing protein | 1.005 | 2 | 98 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar