F477155

General Info

Members Datasets Scaffolds Average Seq Length
718 319 718 100

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10375128|Ga0105245_103751283
Length 121
Sequence MDAYHALHPLDCHRADHEKELHMLYAIIGTDRPESLPARLAARPPHLARLQALRDAGRMVLAGPFPAIDSVDPGPAGFSGSLIVAEFASLQDAQAWADADPYIAAGVYEKVDVRPFRQTLP

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
160 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
183 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
184 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
185 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
186 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
187 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
188 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
189 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
190 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 3.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 0
Rhizoplane 2.09
Rhizosphere 85.24
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10075712 3300003215 Bacteria 855
2 Ga0055539_1000969 3300003752 Bacteria 6314
3 Ga0055533_1000728 3300003756 Bacteria 10638
4 Ga0055527_1000689 3300003760 Bacteria 9874
5 Ga0055535_1001681 3300003761 Bacteria 10147
6 Ga0055542_1001628 3300003762 Bacteria 10147
7 Ga0055529_1001211 3300003763 Bacteria 10147
8 Ga0070658_11265300 3300005327 Bacteria 641
9 Ga0070670_100049790 3300005331 Bacteria 3601
10 Ga0070670_100477308 3300005331 Bacteria 1107
11 Ga0068869_100036368 3300005334 Bacteria 3496
12 Ga0070666_10175091 3300005335 Bacteria 1504
13 Ga0070666_10435552 3300005335 Bacteria 946
14 Ga0068868_100103557 3300005338 Bacteria 2306
15 Ga0068868_100292769 3300005338 Bacteria 1381
16 Ga0070660_101499926 3300005339 Bacteria 573
17 Ga0070689_100063654 3300005340 Bacteria 2870
18 Ga0070687_100078080 3300005343 Bacteria 1798
19 Ga0070661_100323668 3300005344 Bacteria 1204
20 Ga0070661_100371567 3300005344 Bacteria 1126
21 Ga0070668_100799529 3300005347 Bacteria 838
22 Ga0070669_100080888 3300005353 Bacteria 2419
23 Ga0070675_100635982 3300005354 Bacteria 969
24 Ga0070671_100176346 3300005355 Bacteria 1809
25 Ga0070673_101259562 3300005364 Bacteria 694
26 Ga0070659_100579156 3300005366 Bacteria 963
27 Ga0070667_100218838 3300005367 Bacteria 1695
28 Ga0070667_100613544 3300005367 Bacteria 1003
29 Ga0070714_100003135 3300005435 Bacteria 12279
30 Ga0070714_101128759 3300005435 Bacteria 764
31 Ga0070711_100383056 3300005439 Bacteria 1138
32 Ga0070711_100466163 3300005439 Bacteria 1036
33 Ga0070708_100033183 3300005445 Bacteria 4485
34 Ga0070708_100332715 3300005445 Bacteria 1431
35 Ga0070663_100490265 3300005455 Bacteria 1019
36 Ga0070681_11284927 3300005458 Unclassified 654
37 Ga0068867_100816346 3300005459 Bacteria 833
38 Ga0070706_100343571 3300005467 Bacteria 1391
39 Ga0070699_100784912 3300005518 Bacteria 872
40 Ga0070697_100058903 3300005536 Bacteria 3126
41 Ga0070697_100922230 3300005536 Bacteria 775
42 Ga0068853_100005942 3300005539 Bacteria 9640
43 Ga0068853_100096609 3300005539 Bacteria 2607
44 Ga0068853_100330528 3300005539 Bacteria 1414
45 Ga0068853_101183174 3300005539 Bacteria 738
46 Ga0070672_100003097 3300005543 Bacteria 10729
47 Ga0070672_100006127 3300005543 Bacteria 8048
48 Ga0070696_100224466 3300005546 Bacteria 1411
49 Ga0070665_100023062 3300005548 Bacteria 6269
50 Ga0070665_100043640 3300005548 Bacteria 4505
51 Ga0068855_100005893 3300005563 Bacteria 14940
52 Ga0068855_100085911 3300005563 Bacteria 3639
53 Ga0068855_101751500 3300005563 Bacteria 632
54 Ga0070664_100375476 3300005564 Bacteria 1297
55 Ga0068857_100034950 3300005577 Bacteria 4448
56 Ga0068854_100849100 3300005578 Bacteria 799
57 Ga0068856_100001563 3300005614 Bacteria 23973
58 Ga0068856_100083087 3300005614 Bacteria 3180
59 Ga0068856_100787046 3300005614 Bacteria 971
60 Ga0068866_10703429 3300005718 Unclassified 693
61 Ga0068861_101682402 3300005719 Bacteria 627
62 Ga0068863_100524601 3300005841 Bacteria 1168
63 Ga0075365_11189769 3300006038 Bacteria 536
64 Ga0075364_10022744 3300006051 Bacteria 3963
65 Ga0070712_101491878 3300006175 Bacteria 591
66 Ga0070712_101711802 3300006175 Unclassified 550
67 Ga0075369_10027825 3300006186 Bacteria 2365
68 Ga0075366_10019991 3300006195 Bacteria 3881
69 Ga0075366_10062156 3300006195 Unclassified 2220
70 Ga0075366_10099444 3300006195 Bacteria 1745
71 Ga0075366_10221389 3300006195 Bacteria 1153
72 Ga0097621_100018815 3300006237 Bacteria 5287
73 Ga0097621_100051918 3300006237 Bacteria 3338
74 Ga0068871_100008112 3300006358 Bacteria 7539
75 Ga0068871_100070200 3300006358 Bacteria 2879
76 Ga0068871_100187299 3300006358 Bacteria 1781
77 Ga0075430_101250026 3300006846 Unclassified 611
78 Ga0068865_100047406 3300006881 Bacteria 2952
79 Ga0105250_10000398 3300009092 Bacteria 32150
80 Ga0105250_10047216 3300009092 Bacteria 1727
81 Ga0105240_10012696 3300009093 Bacteria 11610
82 Ga0105240_10020043 3300009093 Bacteria 8928
83 Ga0105240_11262537 3300009093 Bacteria 780
84 Ga0105245_10375128 3300009098 Bacteria 1415
85 Ga0105245_11594672 3300009098 Unclassified 704
86 Ga0105245_11921735 3300009098 Bacteria 645
87 Ga0105245_13287675 3300009098 Bacteria 500
88 Ga0105243_11122627 3300009148 Bacteria 796
89 Ga0105241_10007901 3300009174 Bacteria 7820
90 Ga0105241_10568076 3300009174 Bacteria 1020
91 Ga0105242_10035574 3300009176 Bacteria 3993
92 Ga0105242_10415718 3300009176 Bacteria 1259
93 Ga0105237_10230058 3300009545 Bacteria 1855
94 Ga0105237_10659516 3300009545 Bacteria 1053
95 Ga0105238_10078836 3300009551 Bacteria 3284
96 Ga0105238_11999375 3300009551 Unclassified 613
97 Ga0105249_10641648 3300009553 Bacteria 1119
98 Ga0105249_10949011 3300009553 Bacteria 928
99 Ga0105239_11025634 3300010375 Bacteria 949
100 Ga0105239_13650391 3300010375 Bacteria 500
101 Ga0105246_11503899 3300011119 Bacteria 632
102 Ga0157373_10672199 3300013100 Bacteria 757
103 Ga0157370_10082368 3300013104 Bacteria 3026
104 Ga0157370_10225213 3300013104 Bacteria 1736
105 Ga0157370_10454415 3300013104 Bacteria 1177
106 Ga0157370_10725149 3300013104 Bacteria 906
107 Ga0157370_10925468 3300013104 Bacteria 791
108 Ga0157369_10000107 3300013105 Bacteria 117307
109 Ga0157374_10001069 3300013296 Bacteria 23735
110 Ga0157374_10189321 3300013296 Bacteria 2012
111 Ga0157374_11212395 3300013296 Bacteria 776
112 Ga0157378_10133862 3300013297 Bacteria 2297
113 Ga0163162_10000003 3300013306 Bacteria 698280
114 Ga0163162_10018484 3300013306 Bacteria 6830
115 Ga0163162_10129315 3300013306 Bacteria 2634
116 Ga0163162_10146958 3300013306 Bacteria 2474
117 Ga0163162_12364566 3300013306 Bacteria 611
118 Ga0157372_10130695 3300013307 Bacteria 2889
119 Ga0157372_10153701 3300013307 Bacteria 2657
120 Ga0157372_10197696 3300013307 Bacteria 2329
121 Ga0157372_10529701 3300013307 Bacteria 1373
122 Ga0157375_10008003 3300013308 Bacteria 9256
123 Ga0157375_10017610 3300013308 Bacteria 6451
124 Ga0157375_10346480 3300013308 Bacteria 1651
125 Ga0157375_10394930 3300013308 Bacteria 1550
126 Ga0157375_11529536 3300013308 Bacteria 788
127 Ga0163163_10000877 3300014325 Bacteria 25623
128 Ga0157380_10271205 3300014326 Bacteria 1547
129 Ga0182008_10498293 3300014497 Bacteria 669
130 Ga0157376_10036763 3300014969 Bacteria 3969
131 Ga0157376_10069159 3300014969 Bacteria 2992
132 Ga0157376_10084090 3300014969 Bacteria 2739
133 Ga0157376_10329284 3300014969 Bacteria 1455
134 Ga0157376_10341116 3300014969 Bacteria 1431
135 Ga0182006_1000027 3300015261 Bacteria 252946
136 Ga0182007_10026262 3300015262 Bacteria 2021
137 Ga0182005_1116436 3300015265 Bacteria 758
138 Ga0182005_1133497 3300015265 Bacteria 713
139 Ga0163161_10028934 3300017792 Bacteria 3937
140 Ga0163161_10171676 3300017792 Bacteria 1658
141 Ga0163161_10277407 3300017792 Bacteria 1314
142 Ga0213872_10000114 3300021361 Bacteria 74773
143 Ga0213872_10001215 3300021361 Bacteria 17431
144 Ga0213872_10003003 3300021361 Bacteria 9533
145 Ga0213872_10043645 3300021361 Bacteria 2042
146 Ga0209674_100108 3300025226 Bacteria 150893
147 Ga0209674_100193 3300025226 Bacteria 65447
148 Ga0209672_100078 3300025228 Bacteria 156926
149 Ga0209258_100012 3300025242 Bacteria 825544
150 Ga0209677_100725 3300025253 Bacteria 16786
151 Ga0209148_1000013 3300025254 Bacteria 956684
152 Ga0209129_1001003 3300025258 Bacteria 16831
153 Ga0209455_1000126 3300025272 Bacteria 165771
154 Ga0209758_1017824 3300025297 Bacteria 3511
155 Ga0209051_1017881 3300025303 Bacteria 3156
156 Ga0209051_1020949 3300025303 Bacteria 2799
157 Ga0207696_1000034 3300025711 Bacteria 350426
158 Ga0207713_1000014 3300025735 Bacteria 432450
159 Ga0207680_10036335 3300025903 Bacteria 2837
160 Ga0207680_10097066 3300025903 Bacteria 1886
161 Ga0207647_10000228 3300025904 Bacteria 46540
162 Ga0207699_10767495 3300025906 Bacteria 708
163 Ga0207645_10004105 3300025907 Bacteria 10836
164 Ga0207645_10597737 3300025907 Bacteria 749
165 Ga0207705_11355132 3300025909 Bacteria 542
166 Ga0207684_10155282 3300025910 Bacteria 1970
167 Ga0207654_10003007 3300025911 Bacteria 8558
168 Ga0207695_10010495 3300025913 Bacteria 11330
169 Ga0207695_10016538 3300025913 Bacteria 8625
170 Ga0207671_10645067 3300025914 Bacteria 843
171 Ga0207693_11057425 3300025915 Bacteria 618
172 Ga0207663_10428932 3300025916 Bacteria 1016
173 Ga0207663_11170712 3300025916 Unclassified 619
174 Ga0207663_11496001 3300025916 Bacteria 544
175 Ga0207662_10097766 3300025918 Bacteria 1815
176 Ga0207662_10670909 3300025918 Bacteria 725
177 Ga0207657_10737573 3300025919 Bacteria 764
178 Ga0207649_10299750 3300025920 Bacteria 1175
179 Ga0207649_11182276 3300025920 Bacteria 604
180 Ga0207650_10272912 3300025925 Bacteria 1375
181 Ga0207650_11888316 3300025925 Bacteria 505
182 Ga0207659_10122833 3300025926 Bacteria 1992
183 Ga0207659_10993861 3300025926 Bacteria 722
184 Ga0207687_10717413 3300025927 Unclassified 849
185 Ga0207687_11391297 3300025927 Bacteria 603
186 Ga0207700_10127745 3300025928 Bacteria 2071
187 Ga0207700_10869651 3300025928 Unclassified 807
188 Ga0207664_10003195 3300025929 Bacteria 10890
189 Ga0207664_10741864 3300025929 Bacteria 883
190 Ga0207664_11356738 3300025929 Bacteria 631
191 Ga0207644_10241602 3300025931 Bacteria 1438
192 Ga0207690_10045337 3300025932 Bacteria 2904
193 Ga0207686_10041543 3300025934 Bacteria 2805
194 Ga0207686_10733287 3300025934 Bacteria 788
195 Ga0207670_10099376 3300025936 Bacteria 2076
196 Ga0207669_10837794 3300025937 Bacteria 765
197 Ga0207704_10050600 3300025938 Bacteria 2507
198 Ga0207704_10193768 3300025938 Bacteria 1480
199 Ga0207691_10007159 3300025940 Bacteria 10762
200 Ga0207691_10015655 3300025940 Bacteria 7208
201 Ga0207711_10611663 3300025941 Bacteria 1017
202 Ga0207689_10021038 3300025942 Bacteria 5484
203 Ga0207689_10041169 3300025942 Bacteria 3823
204 Ga0207679_10398126 3300025945 Bacteria 1211
205 Ga0207667_10002442 3300025949 Bacteria 23238
206 Ga0207667_10266294 3300025949 Bacteria 1752
207 Ga0207651_10067790 3300025960 Bacteria 2513
208 Ga0207712_10625661 3300025961 Bacteria 933
209 Ga0207668_11932808 3300025972 Bacteria 532
210 Ga0207658_10458919 3300025986 Bacteria 1129
211 Ga0207658_10471470 3300025986 Bacteria 1114
212 Ga0207677_10841785 3300026023 Bacteria 824
213 Ga0207639_10001611 3300026041 Bacteria 15191
214 Ga0207639_10141071 3300026041 Bacteria 2008
215 Ga0207639_11116685 3300026041 Bacteria 739
216 Ga0207639_12293897 3300026041 Unclassified 501
217 Ga0207678_10351673 3300026067 Bacteria 1271
218 Ga0207702_10000265 3300026078 Bacteria 60212
219 Ga0207648_10122465 3300026089 Bacteria 2287
220 Ga0207648_11224352 3300026089 Bacteria 705
221 Ga0207674_10132242 3300026116 Bacteria 2458
222 Ga0207674_10612777 3300026116 Bacteria 1051
223 Ga0207683_10027916 3300026121 Bacteria 4878
224 Ga0207698_10673496 3300026142 Bacteria 1027
225 Ga0268266_10050113 3300028379 Bacteria 3582
226 Ga0265336_10000635 3300028666 Bacteria 19337
227 Ga0265336_10006849 3300028666 Bacteria 4080
228 Ga0265324_10000006 3300029957 Bacteria 267048
229 Ga0265324_10001952 3300029957 Bacteria 11051
230 Ga0265324_10102855 3300029957 Bacteria 970
231 Ga0265324_10119162 3300029957 Bacteria 896
232 Ga0265330_10036623 3300031235 Bacteria 2186
233 Ga0265328_10049087 3300031239 Bacteria 1550
234 Ga0265328_10365586 3300031239 Bacteria 563
235 Ga0265325_10001045 3300031241 Bacteria 19966
236 Ga0265325_10012166 3300031241 Bacteria 4925
237 Ga0265331_10005415 3300031250 Bacteria 7707
238 Ga0265331_10011631 3300031250 Bacteria 4812
239 Ga0265331_10036638 3300031250 Bacteria 2407
240 Ga0265331_10079529 3300031250 Bacteria 1525
241 Ga0265331_10159281 3300031250 Bacteria 1023
242 Ga0265331_10161473 3300031250 Bacteria 1015
243 Ga0265331_10175274 3300031250 Bacteria 969
244 Ga0265327_10000217 3300031251 Bacteria 117085
245 Ga0265327_10000263 3300031251 Bacteria 104045
246 Ga0265327_10000384 3300031251 Bacteria 83284
247 Ga0265327_10000451 3300031251 Bacteria 73966
248 Ga0265327_10001651 3300031251 Bacteria 26917
249 Ga0265327_10003428 3300031251 Bacteria 15161
250 Ga0265327_10014981 3300031251 Bacteria 5041
251 Ga0265327_10075927 3300031251 Bacteria 1671
252 Ga0265327_10088011 3300031251 Bacteria 1520
253 Ga0265327_10183608 3300031251 Bacteria 955
254 Ga0265327_10366397 3300031251 Bacteria 628
255 Ga0265316_10000415 3300031344 Bacteria 48828
256 Ga0265316_10132038 3300031344 Bacteria 1880
257 Ga0265316_10674948 3300031344 Bacteria 729
258 Ga0265316_10793138 3300031344 Bacteria 665
259 Ga0307509_10000033 3300031507 Bacteria 194363
260 Ga0307509_10061303 3300031507 Bacteria 3972
261 Ga0307509_10953348 3300031507 Bacteria 524
262 Ga0307408_100138751 3300031548 Bacteria 1906
263 Ga0307408_100771864 3300031548 Bacteria 870
264 Ga0316575_10006222 3300031665 Bacteria 4283
265 Ga0316575_10042932 3300031665 Bacteria 1791
266 Ga0316575_10133854 3300031665 Bacteria 1018
267 Ga0316575_10196060 3300031665 Bacteria 840
268 Ga0316575_10224117 3300031665 Bacteria 785
269 Ga0316575_10286563 3300031665 Bacteria 695
270 Ga0316575_10410854 3300031665 Bacteria 581
271 Ga0316575_10537856 3300031665 Bacteria 509
272 Ga0316579_10002808 3300031691 Bacteria 6658
273 Ga0316579_10005314 3300031691 Bacteria 5189
274 Ga0316579_10106037 3300031691 Bacteria 1347
275 Ga0316579_10139971 3300031691 Bacteria 1166
276 Ga0316579_10265492 3300031691 Bacteria 830
277 Ga0316579_10308419 3300031691 Bacteria 765
278 Ga0316579_10359585 3300031691 Unclassified 704
279 Ga0265314_10000695 3300031711 Bacteria 40901
280 Ga0265314_10044803 3300031711 Bacteria 3132
281 Ga0265314_10244154 3300031711 Bacteria 1034
282 Ga0265314_10582371 3300031711 Bacteria 578
283 Ga0316576_10012034 3300031727 Bacteria 5700
284 Ga0316576_10023904 3300031727 Bacteria 4263
285 Ga0316576_10092384 3300031727 Bacteria 2255
286 Ga0316576_10111617 3300031727 Bacteria 2049
287 Ga0316576_10228420 3300031727 Bacteria 1399
288 Ga0316576_10234281 3300031727 Bacteria 1380
289 Ga0316576_10604169 3300031727 Bacteria 801
290 Ga0316576_10912995 3300031727 Bacteria 628
291 Ga0316576_11324248 3300031727 Bacteria 506
292 Ga0316578_10007293 3300031728 Bacteria 5533
293 Ga0316578_10010611 3300031728 Bacteria 4789
294 Ga0316578_10056810 3300031728 Bacteria 2299
295 Ga0316578_10061543 3300031728 Bacteria 2212
296 Ga0316578_10062242 3300031728 Bacteria 2200
297 Ga0316578_10149733 3300031728 Bacteria 1406
298 Ga0316578_10239849 3300031728 Bacteria 1088
299 Ga0316578_10316154 3300031728 Bacteria 932
300 Ga0316578_10452038 3300031728 Bacteria 759
301 Ga0316578_10604164 3300031728 Bacteria 642
302 Ga0316577_10004833 3300031733 Bacteria 7006
303 Ga0316577_10013861 3300031733 Bacteria 4419
304 Ga0316577_10023862 3300031733 Bacteria 3396
305 Ga0316577_10134076 3300031733 Bacteria 1394
306 Ga0316577_10197181 3300031733 Bacteria 1138
307 Ga0307413_10068741 3300031824 Bacteria 2220
308 Ga0307413_10082143 3300031824 Bacteria 2069
309 Ga0307407_10894506 3300031903 Bacteria 681
310 Ga0307409_102669715 3300031995 Bacteria 528
311 Ga0307416_100234135 3300032002 Bacteria 1773
312 Ga0307414_10005069 3300032004 Bacteria 7219
313 Ga0307414_10160577 3300032004 Bacteria 1785
314 Ga0307411_10230912 3300032005 Bacteria 1442
315 Ga0316583_10187225 3300032133 Unclassified 719
316 Ga0316585_10062376 3300032137 Bacteria 1205
317 Ga0316585_10200746 3300032137 Bacteria 659
318 Ga0316585_10245587 3300032137 Bacteria 593
319 Ga0316580_10008941 3300032139 Bacteria 3009
320 Ga0316580_10159362 3300032139 Unclassified 693
321 Ga0316593_10001438 3300032168 Bacteria 5250
322 Ga0316593_10005218 3300032168 Bacteria 3408
323 Ga0316593_10007592 3300032168 Bacteria 2984
324 Ga0316593_10009320 3300032168 Bacteria 2767
325 Ga0316593_10021089 3300032168 Bacteria 2034
326 Ga0316593_10030402 3300032168 Bacteria 1753
327 Ga0316593_10038088 3300032168 Bacteria 1591
328 Ga0316593_10051481 3300032168 Bacteria 1392
329 Ga0316593_10239656 3300032168 Bacteria 677
330 Ga0307507_10115035 3300033179 Bacteria 2179
331 Ga0316592_1001647 3300033524 Bacteria 3672
332 Ga0316592_1004031 3300033524 Bacteria 2703
333 Ga0316586_1006539 3300033527 Bacteria 1674
334 Ga0316586_1011285 3300033527 Bacteria 1366
335 Ga0316586_1082190 3300033527 Unclassified 602
336 Ga0316588_1002175 3300033528 Bacteria 3381
337 Ga0316587_1000605 3300033529 Bacteria 3789
338 Ga0316587_1001369 3300033529 Bacteria 2981
339 Ga0316587_1026280 3300033529 Bacteria 1014
340 Ga0316587_1066493 3300033529 Bacteria 672
341 Ga0316596_1002607 3300033541 Bacteria 3868
342 Ga0316596_1003987 3300033541 Bacteria 3274
343 Ga0316596_1005395 3300033541 Bacteria 2919
344 Ga0316596_1017537 3300033541 Bacteria 1801
345 Ga0316596_1156885 3300033541 Bacteria 626
346 Ga0373934_0031476 3300035086 Bacteria 2077
347 Ga0373949_0156436 3300035090 Bacteria 662
348 Ga0373960_0347069 3300035121 Unclassified 562
349 Ga0373955_0280213 3300035172 Bacteria 1003
350 Ga0316574_0000917 3300035398 Bacteria 13080
351 Ga0316574_0006438 3300035398 Bacteria 6349
352 Ga0316574_0016304 3300035398 Bacteria 4328
353 Ga0316574_0017949 3300035398 Bacteria 4149
354 Ga0316574_0024050 3300035398 Bacteria 3642
355 Ga0316574_0031363 3300035398 Bacteria 3224
356 Ga0316574_0043388 3300035398 Bacteria 2779
357 Ga0316574_0063386 3300035398 Bacteria 2324
358 Ga0316574_0065877 3300035398 Bacteria 2281
359 Ga0316574_0070611 3300035398 Bacteria 2205
360 Ga0316574_0158006 3300035398 Bacteria 1461
361 Ga0316574_0197633 3300035398 Bacteria 1292
362 Ga0316574_0322234 3300035398 Unclassified 981
363 Ga0316574_0329566 3300035398 Unclassified 968
364 Ga0316574_0359894 3300035398 Bacteria 920
365 Ga0316574_0470007 3300035398 Bacteria 786
366 Ga0316574_0538927 3300035398 Bacteria 725
367 Ga0316574_0640603 3300035398 Bacteria 655
368 Ga0316574_0785017 3300035398 Bacteria 580
369 Ga0373927_0000003 3300035695 Bacteria 480348
370 Ga0316582_0002409 3300036647 Bacteria 8769
371 Ga0316582_0002944 3300036647 Bacteria 8193
372 Ga0316582_0003473 3300036647 Bacteria 7737
373 Ga0316582_0010224 3300036647 Bacteria 5129
374 Ga0316582_0020160 3300036647 Bacteria 3917
375 Ga0316582_0121405 3300036647 Bacteria 1748
376 Ga0316582_0196440 3300036647 Bacteria 1375
377 Ga0316582_0221996 3300036647 Bacteria 1292
378 Ga0316582_0302263 3300036647 Bacteria 1099
379 Ga0316582_0316738 3300036647 Bacteria 1072
380 Ga0316582_0669850 3300036647 Bacteria 713
381 Ga0316584_0000296 3300036712 Bacteria 25440
382 Ga0316584_0004769 3300036712 Bacteria 8993
383 Ga0316584_0009712 3300036712 Bacteria 6691
384 Ga0316584_0022679 3300036712 Bacteria 4582
385 Ga0316584_0038020 3300036712 Bacteria 3579
386 Ga0316584_0054814 3300036712 Bacteria 2985
387 Ga0316584_0085991 3300036712 Bacteria 2354
388 Ga0316584_0181699 3300036712 Bacteria 1557
389 Ga0316584_0245427 3300036712 Bacteria 1309
390 Ga0316584_0530190 3300036712 Bacteria 824
391 Ga0316584_0719068 3300036712 Bacteria 683
392 Ga0395899_0057003 3300037312 Bacteria 2885
393 Ga0395899_0200134 3300037312 Bacteria 1393
394 Ga0395899_0919260 3300037312 Bacteria 532
395 Ga0395900_0007174 3300037418 Bacteria 11550
396 Ga0395900_0064142 3300037418 Bacteria 3776
397 Ga0395900_0664007 3300037418 Unclassified 978
398 Ga0395898_0044148 3300037466 Bacteria 4390
399 Ga0395898_0127063 3300037466 Bacteria 2442
400 Ga0395905_0093701 3300037471 Bacteria 2817
401 Ga0395905_0143599 3300037471 Bacteria 2246
402 Ga0316581_0020940 3300037588 Bacteria 1918
403 Ga0316581_0045368 3300037588 Bacteria 1342
404 Ga0316581_0067708 3300037588 Bacteria 1096
405 Ga0395901_0009614 3300038443 Bacteria 9807
406 Ga0395901_0077019 3300038443 Bacteria 3480
407 Ga0395901_0085496 3300038443 Bacteria 3298
408 Ga0400484_13421 3300038725 Bacteria 33582
409 Ga0400484_36729 3300038725 Unclassified 2030
410 Ga0400490_57276 3300038726 Bacteria 13433
411 Ga0400490_60783 3300038726 Bacteria 8098
412 Ga0400491_13912 3300038727 Unclassified 2097
413 Ga0400491_26096 3300038727 Bacteria 2362
414 Ga0400485_07884 3300038735 Bacteria 123132
415 Ga0400488_12060 3300038741 Bacteria 10322
416 Ga0400488_14459 3300038741 Bacteria 3518
417 Ga0400488_38117 3300038741 Unclassified 1666
418 Ga0400488_47132 3300038741 Bacteria 1208
419 Ga0400488_62074 3300038741 Bacteria 18243
420 Ga0400486_28685 3300038742 Bacteria 138069
421 Ga0400483_074278 3300039062 Bacteria 2760
422 Ga0400483_078872 3300039062 Bacteria 19759
423 Ga0400483_243724 3300039062 Bacteria 2051
424 Ga0400483_261783 3300039062 Bacteria 2368
425 Ga0400483_262546 3300039062 Unclassified 1925
426 Ga0400489_37628 3300039093 Bacteria 1292
427 Ga0400487_17750 3300039110 Bacteria 2698
428 Ga0400487_19743 3300039110 Bacteria 12773
429 Ga0400487_27243 3300039110 Bacteria 18394
430 Ga0400487_63494 3300039110 Bacteria 48331
431 Ga0436361_0215157 3300039447 Bacteria 166868
432 Ga0436361_0406661 3300039447 Bacteria 15607
433 Ga0436361_0857217 3300039447 Bacteria 1039
434 Ga0436361_0880017 3300039447 Bacteria 8784
435 Ga0436361_0883037 3300039447 Bacteria 610
436 Ga0436361_1012185 3300039447 Bacteria 1084
437 Ga0436361_1132645 3300039447 Bacteria 4350
438 Ga0439436_0010326 3300041404 Bacteria 2850
439 Ga0439439_0001670 3300041406 Bacteria 4499
440 Ga0451795_0341801 3300041456 Bacteria 2087
441 Ga0451802_0570730 3300041460 Bacteria 1095
442 Ga0451807_0581176 3300041486 Bacteria 820
443 Ga0451807_2618503 3300041486 Bacteria 1680
444 Ga0451837_1382718 3300041494 Bacteria 2521
445 Ga0439445_0004296 3300042004 Bacteria 3224
446 Ga0439445_0123772 3300042004 Bacteria 743
447 Ga0439432_008540 3300042006 Bacteria 3594
448 Ga0439449_0019101 3300042007 Bacteria 2570
449 Ga0439455_0176088 3300042012 Bacteria 615
450 Ga0439462_0012694 3300042015 Bacteria 2153
451 Ga0451577_0050976 3300042876 Bacteria 3694
452 Ga0451577_0087260 3300042876 Bacteria 2784
453 Ga0451577_0119469 3300042876 Bacteria 2361
454 Ga0451577_0264760 3300042876 Bacteria 1556
455 Ga0451577_0269066 3300042876 Unclassified 1543
456 Ga0451577_0874135 3300042876 Bacteria 810
457 Ga0451577_0908700 3300042876 Bacteria 793
458 Ga0466969_0008592 3300044656 Bacteria 5417
459 Ga0466969_0022510 3300044656 Bacteria 3252
460 Ga0466975_0340179 3300044661 Bacteria 945
461 Ga0453683_0204910 3300044673 Bacteria 1252
462 Ga0466965_0011487 3300044683 Bacteria 4152
463 Ga0466966_0011013 3300044684 Bacteria 6002
464 Ga0466966_0024354 3300044684 Bacteria 3960
465 Ga0466961_0000131 3300044693 Bacteria 50219
466 Ga0466961_0003687 3300044693 Bacteria 9559
467 Ga0466961_0004743 3300044693 Bacteria 8557
468 Ga0453684_0004710 3300044712 Bacteria 28217
469 Ga0453684_0007598 3300044712 Bacteria 19866
470 Ga0453684_0013476 3300044712 Bacteria 13271
471 Ga0453684_0212635 3300044712 Bacteria 2247
472 Ga0453684_0237233 3300044712 Bacteria 2102
473 Ga0453684_0778832 3300044712 Bacteria 1033
474 Ga0453684_1795844 3300044712 Bacteria 623
475 Ga0466970_0052824 3300044765 Bacteria 2169
476 Ga0466970_0109262 3300044765 Bacteria 1510
477 Ga0466957_0109237 3300044842 Bacteria 1752
478 Ga0466959_0000232 3300045049 Bacteria 35011
479 Ga0466959_0000838 3300045049 Bacteria 18168
480 Ga0466959_1073702 3300045049 Bacteria 535
481 Ga0451576_0000013 3300045051 Bacteria 665120
482 Ga0451576_0000250 3300045051 Bacteria 132101
483 Ga0451576_0001427 3300045051 Bacteria 40849
484 Ga0451576_0026520 3300045051 Bacteria 6233
485 Ga0451576_0029526 3300045051 Bacteria 5866
486 Ga0451576_0044995 3300045051 Bacteria 4651
487 Ga0451576_0070946 3300045051 Bacteria 3626
488 Ga0451576_0259649 3300045051 Bacteria 1815
489 Ga0451576_1042154 3300045051 Bacteria 857
490 Ga0451576_1051696 3300045051 Bacteria 853
491 Ga0451576_1077088 3300045051 Bacteria 841
492 Ga0451576_1115684 3300045051 Bacteria 825
493 Ga0451576_1232305 3300045051 Bacteria 781
494 Ga0466958_0031465 3300045836 Bacteria 3154
495 Ga0495617_000288 3300046452 Bacteria 28911
496 Ga0495617_000874 3300046452 Bacteria 14200
497 Ga0495627_000778 3300046453 Bacteria 23542
498 Ga0495590_0011311 3300046457 Bacteria 3339
499 Ga0495638_0000584 3300046460 Bacteria 41161
500 Ga0495650_0008270 3300046471 Bacteria 6099
501 Ga0495650_0146583 3300046471 Bacteria 850
502 Ga0495605_0062734 3300046474 Bacteria 1775
503 Ga0495584_0010943 3300046491 Bacteria 4655
504 Ga0495585_0000019 3300046492 Bacteria 156966
505 Ga0495585_0231149 3300046492 Bacteria 929
506 Ga0495607_0000430 3300046501 Bacteria 42487
507 Ga0495607_0252086 3300046501 Bacteria 849
508 Ga0495583_0036562 3300046506 Bacteria 2334
509 Ga0495606_0000665 3300046507 Bacteria 53891
510 Ga0495606_0000888 3300046507 Bacteria 44688
511 Ga0495606_0002803 3300046507 Bacteria 19410
512 Ga0495606_0314611 3300046507 Bacteria 843
513 Ga0495610_0024167 3300046512 Bacteria 3284
514 Ga0495610_0099501 3300046512 Bacteria 1305
515 Ga0495616_0000047 3300046513 Bacteria 110592
516 Ga0495616_0129543 3300046513 Bacteria 1157
517 Ga0495616_0238355 3300046513 Bacteria 785
518 Ga0495620_0007968 3300046515 Bacteria 5710
519 Ga0495620_0012378 3300046515 Bacteria 4411
520 Ga0495630_0466972 3300046517 Bacteria 967
521 Ga0495631_0000361 3300046518 Bacteria 31358
522 Ga0495631_0000705 3300046518 Bacteria 21584
523 Ga0495631_0000767 3300046518 Bacteria 20651
524 Ga0495632_0045045 3300046519 Bacteria 2199
525 Ga0495632_0046221 3300046519 Bacteria 2164
526 Ga0495632_0210392 3300046519 Bacteria 882
527 Ga0495648_0000947 3300046524 Bacteria 30046
528 Ga0495648_0003270 3300046524 Bacteria 14341
529 Ga0495663_0073966 3300046525 Bacteria 1089
530 Ga0495654_0000922 3300046530 Bacteria 21861
531 Ga0495665_0086171 3300046531 Bacteria 1651
532 Ga0495609_0001428 3300046538 Bacteria 15911
533 Ga0495621_0108453 3300046539 Bacteria 1063
534 Ga0495656_0038020 3300046615 Bacteria 1991
535 Ga0495668_0006146 3300046616 Bacteria 7948
536 Ga0495668_0216334 3300046616 Bacteria 1049
537 Ga0495611_0000001 3300046648 Bacteria 2628469
538 Ga0495611_0000239 3300046648 Bacteria 38010
539 Ga0495625_0000001 3300046660 Bacteria 1641829
540 Ga0495625_0434806 3300046660 Bacteria 813
541 Ga0495661_0001751 3300046665 Bacteria 17457
542 Ga0495670_0010116 3300046691 Bacteria 4640
543 Ga0495670_0050033 3300046691 Bacteria 2091
544 Ga0495670_0275207 3300046691 Bacteria 900
545 Ga0495671_0000272 3300046692 Bacteria 43513
546 Ga0495589_0000329 3300046794 Bacteria 37186
547 Ga0495660_0047556 3300046810 Bacteria 2348
548 Ga0495660_0047561 3300046810 Bacteria 2348
549 Ga0495636_0110047 3300047318 Bacteria 1211
550 Ga0495672_0006584 3300047320 Bacteria 8947
551 Ga0495679_000001 3300047446 Bacteria 1607568
552 Ga0495673_0000001 3300047469 Bacteria 1630730
553 Ga0495673_0000099 3300047469 Bacteria 179978
554 Ga0495673_0035008 3300047469 Bacteria 2317
555 Ga0495673_0285818 3300047469 Bacteria 594
556 Ga0495686_0000255 3300047472 Bacteria 95600
557 Ga0495686_0052579 3300047472 Bacteria 2553
558 Ga0495686_0065153 3300047472 Bacteria 2253
559 Ga0495686_0372021 3300047472 Bacteria 772
560 Ga0495686_0547305 3300047472 Bacteria 604
561 Ga0496100_0160269 3300048903 Bacteria 1612
562 Ga0496100_1118917 3300048903 Bacteria 621
563 Ga0496101_0063136 3300048904 Bacteria 2695
564 Ga0496102_0332424 3300048905 Bacteria 1431
565 Ga0496102_0642306 3300048905 Bacteria 984
566 Ga0496103_0369715 3300048906 Bacteria 921
567 Ga0496106_0002577 3300048909 Bacteria 13499
568 Ga0496107_1112225 3300048910 Bacteria 570
569 Ga0496108_0298956 3300048911 Bacteria 1402
570 Ga0496109_0542389 3300048912 Bacteria 1097
571 Ga0496115_0302808 3300048918 Bacteria 1310
572 Ga0496116_0168745 3300048919 Bacteria 1189
573 Ga0496117_0068320 3300048920 Bacteria 2399
574 Ga0496117_0221893 3300048920 Bacteria 1051
575 Ga0496118_0002292 3300048921 Bacteria 26037
576 Ga0496118_0015532 3300048921 Bacteria 7043
577 Ga0496118_0029973 3300048921 Bacteria 4553
578 Ga0496121_0000210 3300048924 Bacteria 128287
579 Ga0496121_0002725 3300048924 Bacteria 26358
580 Ga0496121_0074823 3300048924 Bacteria 2707
581 Ga0496121_0311210 3300048924 Bacteria 1064
582 Ga0496121_0415780 3300048924 Bacteria 876
583 Ga0496122_0032475 3300048925 Bacteria 4315
584 Ga0496122_0100938 3300048925 Bacteria 1929
585 Ga0496122_0227339 3300048925 Bacteria 1064
586 Ga0496122_0256459 3300048925 Bacteria 974
587 Ga0496123_0058141 3300048926 Bacteria 2511
588 Ga0496123_0071913 3300048926 Bacteria 2154
589 Ga0496125_0012647 3300048928 Bacteria 8357
590 Ga0496126_1263775 3300048929 Bacteria 539
591 Ga0495678_000664 3300049459 Bacteria 31545
592 Ga0495682_0020684 3300049460 Bacteria 2469
593 Ga0495682_0041271 3300049460 Bacteria 1691
594 Ga0501300_072364 3300049523 Bacteria 559
595 Ga0501031_0036335 3300049568 Bacteria 3213
596 Ga0501031_0819665 3300049568 Bacteria 596
597 Ga0501032_0000744 3300049569 Bacteria 26473
598 Ga0501032_0021539 3300049569 Bacteria 4479
599 Ga0501032_0869784 3300049569 Bacteria 568
600 Ga0501033_0003954 3300049570 Bacteria 12016
601 Ga0501033_0010512 3300049570 Bacteria 7098
602 Ga0501033_0083570 3300049570 Bacteria 2340
603 Ga0501034_0000996 3300049571 Bacteria 40586
604 Ga0501034_0002335 3300049571 Bacteria 23169
605 Ga0501034_0104860 3300049571 Bacteria 2820
606 Ga0501034_0484912 3300049571 Bacteria 1151
607 Ga0501034_0659861 3300049571 Bacteria 947
608 Ga0501034_0798819 3300049571 Unclassified 836
609 Ga0501036_0043683 3300049572 Bacteria 3796
610 Ga0501036_0207362 3300049572 Bacteria 1647
611 Ga0501037_0000566 3300049573 Bacteria 29217
612 Ga0501037_0004006 3300049573 Bacteria 10681
613 Ga0501037_0007619 3300049573 Bacteria 7927
614 Ga0501037_0095314 3300049573 Bacteria 2151
615 Ga0501037_0327745 3300049573 Bacteria 1059
616 Ga0501037_0458867 3300049573 Bacteria 868
617 Ga0501037_0820218 3300049573 Bacteria 613
618 Ga0501037_0950502 3300049573 Bacteria 561
619 Ga0501038_0000746 3300049574 Bacteria 29017
620 Ga0501038_0005436 3300049574 Bacteria 11835
621 Ga0501038_0007938 3300049574 Bacteria 9779
622 Ga0501038_0014627 3300049574 Bacteria 7151
623 Ga0501038_0371693 3300049574 Bacteria 1110
624 Ga0501039_0012430 3300049575 Bacteria 6501
625 Ga0501039_0067110 3300049575 Bacteria 2786
626 Ga0501039_0257096 3300049575 Bacteria 1373
627 Ga0501042_0322089 3300049578 Bacteria 1117
628 Ga0501042_0363175 3300049578 Bacteria 1048
629 Ga0501043_0005586 3300049579 Bacteria 10129
630 Ga0501043_0024289 3300049579 Bacteria 4757
631 Ga0501043_0054377 3300049579 Bacteria 3144
632 Ga0501043_0339815 3300049579 Bacteria 1142
633 Ga0501043_1334928 3300049579 Bacteria 500
634 Ga0501046_0000760 3300049580 Bacteria 31143
635 Ga0501046_0314335 3300049580 Bacteria 1142
636 Ga0501046_0340015 3300049580 Bacteria 1091
637 Ga0501047_0001682 3300049581 Bacteria 21529
638 Ga0501047_0006314 3300049581 Bacteria 11147
639 Ga0501047_0224359 3300049581 Bacteria 1734
640 Ga0501047_0224384 3300049581 Bacteria 1734
641 Ga0501047_0291289 3300049581 Bacteria 1476
642 Ga0501047_0540519 3300049581 Bacteria 990
643 Ga0501047_0597252 3300049581 Bacteria 926
644 Ga0501047_0822098 3300049581 Bacteria 743
645 Ga0501048_0283698 3300049582 Bacteria 1177
646 Ga0501067_0037230 3300049583 Bacteria 2702
647 Ga0501067_0048538 3300049583 Bacteria 2354
648 Ga0501067_0085285 3300049583 Bacteria 1753
649 Ga0501069_0028355 3300049585 Bacteria 3069
650 Ga0501069_0047385 3300049585 Bacteria 2386
651 Ga0501069_0246042 3300049585 Bacteria 1043
652 Ga0501070_0003644 3300049586 Bacteria 13321
653 Ga0501070_0003853 3300049586 Bacteria 12940
654 Ga0501070_0021411 3300049586 Bacteria 5424
655 Ga0501070_0033976 3300049586 Bacteria 4266
656 Ga0501070_0047614 3300049586 Bacteria 3562
657 Ga0501070_0080426 3300049586 Bacteria 2696
658 Ga0501070_0102947 3300049586 Bacteria 2361
659 Ga0501072_0000714 3300049588 Bacteria 24116
660 Ga0501073_0001389 3300049589 Bacteria 17851
661 Ga0501073_0060100 3300049589 Bacteria 2652
662 Ga0501073_0091460 3300049589 Bacteria 2115
663 Ga0501073_0998950 3300049589 Bacteria 576
664 Ga0501074_0000672 3300049590 Bacteria 21334
665 Ga0501074_0031093 3300049590 Bacteria 3868
666 Ga0501074_1320589 3300049590 Bacteria 505
667 Ga0501075_0075495 3300049591 Bacteria 2549
668 Ga0501077_0200093 3300049593 Bacteria 1269
669 Ga0501079_0088598 3300049741 Bacteria 2396
670 Ga0501079_0507019 3300049741 Bacteria 949
671 Ga0501080_0010993 3300049742 Bacteria 8286
672 Ga0501080_0023507 3300049742 Bacteria 5712
673 Ga0501080_0025335 3300049742 Bacteria 5503
674 Ga0501080_0194744 3300049742 Bacteria 1862
675 Ga0501080_0194865 3300049742 Bacteria 1861
676 Ga0501080_1529515 3300049742 Bacteria 566
677 Ga0501083_0020036 3300049744 Bacteria 4655
678 Ga0501280_000116 3300049776 Bacteria 21015
679 Ga0501035_0003276 3300049822 Bacteria 15521
680 Ga0501035_0040291 3300049822 Bacteria 4222
681 Ga0501035_0060626 3300049822 Bacteria 3368
682 Ga0501035_0063180 3300049822 Bacteria 3294
683 Ga0501035_0333878 3300049822 Bacteria 1271
684 Ga0501035_1006512 3300049822 Bacteria 655
685 Ga0501035_1558208 3300049822 Bacteria 502
686 Ga0501044_0000190 3300049823 Bacteria 77415
687 Ga0501044_0002882 3300049823 Bacteria 19574
688 Ga0501044_0025830 3300049823 Bacteria 6225
689 Ga0501044_0062309 3300049823 Bacteria 3812
690 Ga0501044_0133563 3300049823 Bacteria 2474
691 Ga0501044_0204715 3300049823 Bacteria 1930
692 Ga0501044_0907414 3300049823 Bacteria 756
693 Ga0501044_1047509 3300049823 Bacteria 686
694 Ga0501044_1416828 3300049823 Bacteria 560
695 nmdc:mga00v17_37036_c1 3300050491 Bacteria 2910
696 nmdc:mga0yw44_1241947_c1 3300050492 Bacteria 502
697 nmdc:mga0k408_160022_c1 3300050493 Bacteria 1341
698 nmdc:mga0k408_32718_c1 3300050493 Bacteria 2971
699 nmdc:mga0k408_7088_c1 3300050493 Bacteria 5987
700 nmdc:mga06z11_540788_c1 3300050494 Bacteria 707
701 nmdc:mga07m45_84427_c1 3300050496 Bacteria 1494
702 nmdc:mga06r32_680441_c1 3300050510 Bacteria 995
703 nmdc:mga0sz30_51816_c1 3300050516 Bacteria 1742
704 Ga0500643_000002 3300053087 Bacteria 1277657
705 Ga0500566_0466051 3300053094 Bacteria 550
706 Ga0500641_0002680 3300053096 Bacteria 6289
707 Ga0500555_000245 3300053103 Bacteria 24063
708 Ga0500559_0039706 3300053136 Bacteria 2048
709 Ga0500622_0000023 3300053156 Bacteria 251170
710 Ga0500636_0000837 3300053177 Bacteria 16563
711 Ga0500637_0028995 3300053178 Bacteria 3067
712 Ga0500645_000235 3300053730 Bacteria 41905
713 Ga0501084_0115255 3300054114 Bacteria 2259
714 Ga0500661_025343 3300055283 Bacteria 1049
715 Ga0501082_0077132 3300060353 Bacteria 2873
716 Ga0501082_1315532 3300060353 Bacteria 631
717 Ga0501082_1484152 3300060353 Bacteria 592
718 Ga0466962_0368067 3300061719 Bacteria 717

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031665 Ga0316575_10196060 Ga0316575_101960602 98
2 3300031691 Ga0316579_10308419 Ga0316579_103084192 98
3 3300031727 Ga0316576_10912995 Ga0316576_109129952 98
4 3300031728 Ga0316578_10604164 Ga0316578_106041642 98
5 3300035398 Ga0316574_0006438 Ga0316574_0006438_5552_5848 98
6 3300036647 Ga0316582_0002409 Ga0316582_0002409_7109_7405 98
7 3300036712 Ga0316584_0038020 Ga0316584_0038020_152_451 98
8 3300037588 Ga0316581_0067708 Ga0316581_0067708_441_737 98
9 3300003215 JGI25153J46596_10075712 JGI25153J46596_100757122 99
10 3300003752 Ga0055539_1000969 Ga0055539_10009699 99
11 3300003756 Ga0055533_1000728 Ga0055533_10007289 99
12 3300003760 Ga0055527_1000689 Ga0055527_10006899 99
13 3300003761 Ga0055535_1001681 Ga0055535_100168110 99
14 3300003762 Ga0055542_1001628 Ga0055542_100162810 99
15 3300003763 Ga0055529_1001211 Ga0055529_100121110 99
16 3300005327 Ga0070658_11265300 Ga0070658_112653002 99
17 3300005331 Ga0070670_100049790 Ga0070670_1000497901 99
18 3300005331 Ga0070670_100477308 Ga0070670_1004773083 99
19 3300005334 Ga0068869_100036368 Ga0068869_1000363683 99
20 3300005335 Ga0070666_10175091 Ga0070666_101750913 99
21 3300005335 Ga0070666_10435552 Ga0070666_104355521 99
22 3300005338 Ga0068868_100103557 Ga0068868_1001035571 99
23 3300005338 Ga0068868_100292769 Ga0068868_1002927692 99
24 3300005339 Ga0070660_101499926 Ga0070660_1014999261 99
25 3300005340 Ga0070689_100063654 Ga0070689_1000636543 99
26 3300005343 Ga0070687_100078080 Ga0070687_1000780801 99
27 3300005344 Ga0070661_100323668 Ga0070661_1003236682 99
28 3300005344 Ga0070661_100371567 Ga0070661_1003715672 99
29 3300005347 Ga0070668_100799529 Ga0070668_1007995292 99
30 3300005353 Ga0070669_100080888 Ga0070669_1000808883 99
31 3300005354 Ga0070675_100635982 Ga0070675_1006359821 99
32 3300005355 Ga0070671_100176346 Ga0070671_1001763463 99
33 3300005364 Ga0070673_101259562 Ga0070673_1012595622 99
34 3300005366 Ga0070659_100579156 Ga0070659_1005791562 99
35 3300005367 Ga0070667_100218838 Ga0070667_1002188383 99
36 3300005367 Ga0070667_100613544 Ga0070667_1006135441 99
37 3300005435 Ga0070714_100003135 Ga0070714_1000031354 99
38 3300005435 Ga0070714_101128759 Ga0070714_1011287592 99
39 3300005439 Ga0070711_100383056 Ga0070711_1003830563 99
40 3300005439 Ga0070711_100466163 Ga0070711_1004661632 99
41 3300005445 Ga0070708_100033183 Ga0070708_1000331832 99
42 3300005445 Ga0070708_100332715 Ga0070708_1003327152 99
43 3300005455 Ga0070663_100490265 Ga0070663_1004902653 99
44 3300005458 Ga0070681_11284927 Ga0070681_112849272 99
45 3300005459 Ga0068867_100816346 Ga0068867_1008163462 99
46 3300005467 Ga0070706_100343571 Ga0070706_1003435712 99
47 3300005518 Ga0070699_100784912 Ga0070699_1007849122 99
48 3300005536 Ga0070697_100058903 Ga0070697_1000589033 99
49 3300005536 Ga0070697_100922230 Ga0070697_1009222301 99
50 3300005539 Ga0068853_100005942 Ga0068853_1000059425 99
51 3300005539 Ga0068853_100096609 Ga0068853_1000966094 99
52 3300005539 Ga0068853_100330528 Ga0068853_1003305282 99
53 3300005539 Ga0068853_101183174 Ga0068853_1011831741 99
54 3300005543 Ga0070672_100003097 Ga0070672_1000030976 99
55 3300005543 Ga0070672_100006127 Ga0070672_1000061277 99
56 3300005546 Ga0070696_100224466 Ga0070696_1002244662 99
57 3300005548 Ga0070665_100023062 Ga0070665_1000230625 99
58 3300005548 Ga0070665_100043640 Ga0070665_1000436403 99
59 3300005563 Ga0068855_100005893 Ga0068855_1000058939 99
60 3300005563 Ga0068855_100085911 Ga0068855_1000859112 99
61 3300005563 Ga0068855_101751500 Ga0068855_1017515001 99
62 3300005564 Ga0070664_100375476 Ga0070664_1003754762 99
63 3300005577 Ga0068857_100034950 Ga0068857_1000349503 99
64 3300005578 Ga0068854_100849100 Ga0068854_1008491002 99
65 3300005614 Ga0068856_100001563 Ga0068856_1000015635 99
66 3300005614 Ga0068856_100083087 Ga0068856_1000830874 99
67 3300005614 Ga0068856_100787046 Ga0068856_1007870462 99
68 3300005718 Ga0068866_10703429 Ga0068866_107034291 99
69 3300005719 Ga0068861_101682402 Ga0068861_1016824022 99
70 3300005841 Ga0068863_100524601 Ga0068863_1005246012 99
71 3300006038 Ga0075365_11189769 Ga0075365_111897692 99
72 3300006051 Ga0075364_10022744 Ga0075364_100227446 99
73 3300006175 Ga0070712_101491878 Ga0070712_1014918781 99
74 3300006175 Ga0070712_101711802 Ga0070712_1017118022 99
75 3300006186 Ga0075369_10027825 Ga0075369_100278253 99
76 3300006195 Ga0075366_10019991 Ga0075366_100199914 99
77 3300006195 Ga0075366_10062156 Ga0075366_100621562 99
78 3300006195 Ga0075366_10099444 Ga0075366_100994442 99
79 3300006195 Ga0075366_10221389 Ga0075366_102213893 99
80 3300006237 Ga0097621_100018815 Ga0097621_1000188153 99
81 3300006237 Ga0097621_100051918 Ga0097621_1000519185 99
82 3300006358 Ga0068871_100008112 Ga0068871_1000081128 99
83 3300006358 Ga0068871_100070200 Ga0068871_1000702003 99
84 3300006358 Ga0068871_100187299 Ga0068871_1001872994 99
85 3300006846 Ga0075430_101250026 Ga0075430_1012500262 99
86 3300006881 Ga0068865_100047406 Ga0068865_1000474064 99
87 3300009092 Ga0105250_10000398 Ga0105250_100003982 99
88 3300009092 Ga0105250_10047216 Ga0105250_100472163 99
89 3300009093 Ga0105240_10012696 Ga0105240_100126966 99
90 3300009093 Ga0105240_10020043 Ga0105240_100200435 99
91 3300009093 Ga0105240_11262537 Ga0105240_112625372 99
92 3300009098 Ga0105245_10375128 Ga0105245_103751283 99
93 3300009098 Ga0105245_11594672 Ga0105245_115946722 99
94 3300009098 Ga0105245_11921735 Ga0105245_119217351 99
95 3300009098 Ga0105245_13287675 Ga0105245_132876751 99
96 3300009148 Ga0105243_11122627 Ga0105243_111226271 99
97 3300009174 Ga0105241_10007901 Ga0105241_100079017 99
98 3300009174 Ga0105241_10568076 Ga0105241_105680761 99
99 3300009176 Ga0105242_10035574 Ga0105242_100355744 99
100 3300009176 Ga0105242_10415718 Ga0105242_104157182 99
101 3300009545 Ga0105237_10230058 Ga0105237_102300583 99
102 3300009545 Ga0105237_10659516 Ga0105237_106595162 99
103 3300009551 Ga0105238_10078836 Ga0105238_100788363 99
104 3300009551 Ga0105238_11999375 Ga0105238_119993752 99
105 3300009553 Ga0105249_10641648 Ga0105249_106416482 99
106 3300009553 Ga0105249_10949011 Ga0105249_109490111 99
107 3300010375 Ga0105239_11025634 Ga0105239_110256341 99
108 3300010375 Ga0105239_13650391 Ga0105239_136503912 99
109 3300011119 Ga0105246_11503899 Ga0105246_115038992 99
110 3300013100 Ga0157373_10672199 Ga0157373_106721992 99
111 3300013104 Ga0157370_10082368 Ga0157370_100823685 99
112 3300013104 Ga0157370_10225213 Ga0157370_102252132 99
113 3300013104 Ga0157370_10454415 Ga0157370_104544153 99
114 3300013104 Ga0157370_10725149 Ga0157370_107251492 99
115 3300013104 Ga0157370_10925468 Ga0157370_109254681 99
116 3300013105 Ga0157369_10000107 Ga0157369_1000010720 99
117 3300013296 Ga0157374_10001069 Ga0157374_100010696 99
118 3300013296 Ga0157374_10189321 Ga0157374_101893213 99
119 3300013296 Ga0157374_11212395 Ga0157374_112123952 99
120 3300013297 Ga0157378_10133862 Ga0157378_101338622 99
121 3300013306 Ga0163162_10000003 Ga0163162_1000000337 99
122 3300013306 Ga0163162_10018484 Ga0163162_100184845 99
123 3300013306 Ga0163162_10129315 Ga0163162_101293152 99
124 3300013306 Ga0163162_10146958 Ga0163162_101469584 99
125 3300013306 Ga0163162_12364566 Ga0163162_123645662 99
126 3300013307 Ga0157372_10130695 Ga0157372_101306954 99
127 3300013307 Ga0157372_10153701 Ga0157372_101537013 99
128 3300013307 Ga0157372_10197696 Ga0157372_101976963 99
129 3300013307 Ga0157372_10529701 Ga0157372_105297013 99
130 3300013308 Ga0157375_10008003 Ga0157375_100080033 99
131 3300013308 Ga0157375_10017610 Ga0157375_100176103 99
132 3300013308 Ga0157375_10346480 Ga0157375_103464802 99
133 3300013308 Ga0157375_10394930 Ga0157375_103949303 99
134 3300013308 Ga0157375_11529536 Ga0157375_115295361 99
135 3300014325 Ga0163163_10000877 Ga0163163_100008777 99
136 3300014326 Ga0157380_10271205 Ga0157380_102712053 99
137 3300014497 Ga0182008_10498293 Ga0182008_104982931 99
138 3300014969 Ga0157376_10036763 Ga0157376_100367633 99
139 3300014969 Ga0157376_10069159 Ga0157376_100691592 99
140 3300014969 Ga0157376_10084090 Ga0157376_100840903 99
141 3300014969 Ga0157376_10329284 Ga0157376_103292843 99
142 3300014969 Ga0157376_10341116 Ga0157376_103411163 99
143 3300015261 Ga0182006_1000027 Ga0182006_100002715 99
144 3300015262 Ga0182007_10026262 Ga0182007_100262623 99
145 3300015265 Ga0182005_1116436 Ga0182005_11164362 99
146 3300015265 Ga0182005_1133497 Ga0182005_11334972 99
147 3300017792 Ga0163161_10028934 Ga0163161_100289343 99
148 3300017792 Ga0163161_10171676 Ga0163161_101716763 99
149 3300017792 Ga0163161_10277407 Ga0163161_102774072 99
150 3300021361 Ga0213872_10000114 Ga0213872_1000011466 99
151 3300021361 Ga0213872_10001215 Ga0213872_100012157 99
152 3300021361 Ga0213872_10003003 Ga0213872_100030035 99
153 3300021361 Ga0213872_10043645 Ga0213872_100436452 99
154 3300025226 Ga0209674_100108 Ga0209674_100108114 99
155 3300025226 Ga0209674_100193 Ga0209674_10019339 99
156 3300025228 Ga0209672_100078 Ga0209672_10007810 99
157 3300025242 Ga0209258_100012 Ga0209258_100012692 99
158 3300025253 Ga0209677_100725 Ga0209677_1007255 99
159 3300025254 Ga0209148_1000013 Ga0209148_1000013679 99
160 3300025258 Ga0209129_1001003 Ga0209129_10010035 99
161 3300025272 Ga0209455_1000126 Ga0209455_1000126150 99
162 3300025297 Ga0209758_1017824 Ga0209758_10178243 99
163 3300025303 Ga0209051_1017881 Ga0209051_10178813 99
164 3300025303 Ga0209051_1020949 Ga0209051_10209493 99
165 3300025711 Ga0207696_1000034 Ga0207696_100003469 99
166 3300025735 Ga0207713_1000014 Ga0207713_1000014362 99
167 3300025903 Ga0207680_10036335 Ga0207680_100363355 99
168 3300025903 Ga0207680_10097066 Ga0207680_100970663 99
169 3300025904 Ga0207647_10000228 Ga0207647_1000022826 99
170 3300025906 Ga0207699_10767495 Ga0207699_107674952 99
171 3300025907 Ga0207645_10004105 Ga0207645_100041055 99
172 3300025907 Ga0207645_10597737 Ga0207645_105977372 99
173 3300025909 Ga0207705_11355132 Ga0207705_113551322 99
174 3300025910 Ga0207684_10155282 Ga0207684_101552823 99
175 3300025911 Ga0207654_10003007 Ga0207654_100030072 99
176 3300025913 Ga0207695_10010495 Ga0207695_100104958 99
177 3300025913 Ga0207695_10016538 Ga0207695_100165385 99
178 3300025914 Ga0207671_10645067 Ga0207671_106450671 99
179 3300025915 Ga0207693_11057425 Ga0207693_110574252 99
180 3300025916 Ga0207663_10428932 Ga0207663_104289322 99
181 3300025916 Ga0207663_11170712 Ga0207663_111707122 99
182 3300025916 Ga0207663_11496001 Ga0207663_114960012 99
183 3300025918 Ga0207662_10097766 Ga0207662_100977661 99
184 3300025918 Ga0207662_10670909 Ga0207662_106709092 99
185 3300025919 Ga0207657_10737573 Ga0207657_107375732 99
186 3300025920 Ga0207649_10299750 Ga0207649_102997502 99
187 3300025920 Ga0207649_11182276 Ga0207649_111822762 99
188 3300025925 Ga0207650_10272912 Ga0207650_102729123 99
189 3300025925 Ga0207650_11888316 Ga0207650_118883161 99
190 3300025926 Ga0207659_10122833 Ga0207659_101228334 99
191 3300025926 Ga0207659_10993861 Ga0207659_109938612 99
192 3300025927 Ga0207687_10717413 Ga0207687_107174132 99
193 3300025927 Ga0207687_11391297 Ga0207687_113912971 99
194 3300025928 Ga0207700_10127745 Ga0207700_101277452 99
195 3300025928 Ga0207700_10869651 Ga0207700_108696512 99
196 3300025929 Ga0207664_10003195 Ga0207664_100031957 99
197 3300025929 Ga0207664_10741864 Ga0207664_107418642 99
198 3300025929 Ga0207664_11356738 Ga0207664_113567382 99
199 3300025931 Ga0207644_10241602 Ga0207644_102416022 99
200 3300025932 Ga0207690_10045337 Ga0207690_100453373 99
201 3300025934 Ga0207686_10041543 Ga0207686_100415434 99
202 3300025934 Ga0207686_10733287 Ga0207686_107332872 99
203 3300025936 Ga0207670_10099376 Ga0207670_100993762 99
204 3300025937 Ga0207669_10837794 Ga0207669_108377942 99
205 3300025938 Ga0207704_10050600 Ga0207704_100506004 99
206 3300025938 Ga0207704_10193768 Ga0207704_101937681 99
207 3300025940 Ga0207691_10007159 Ga0207691_100071596 99
208 3300025940 Ga0207691_10015655 Ga0207691_100156552 99
209 3300025941 Ga0207711_10611663 Ga0207711_106116631 99
210 3300025942 Ga0207689_10021038 Ga0207689_100210384 99
211 3300025942 Ga0207689_10041169 Ga0207689_100411693 99
212 3300025945 Ga0207679_10398126 Ga0207679_103981263 99
213 3300025949 Ga0207667_10002442 Ga0207667_100024424 99
214 3300025949 Ga0207667_10266294 Ga0207667_102662943 99
215 3300025960 Ga0207651_10067790 Ga0207651_100677902 99
216 3300025961 Ga0207712_10625661 Ga0207712_106256612 99
217 3300025972 Ga0207668_11932808 Ga0207668_119328082 99
218 3300025986 Ga0207658_10458919 Ga0207658_104589192 99
219 3300025986 Ga0207658_10471470 Ga0207658_104714701 99
220 3300026023 Ga0207677_10841785 Ga0207677_108417853 99
221 3300026041 Ga0207639_10001611 Ga0207639_1000161112 99
222 3300026041 Ga0207639_10141071 Ga0207639_101410714 99
223 3300026041 Ga0207639_11116685 Ga0207639_111166852 99
224 3300026041 Ga0207639_12293897 Ga0207639_122938972 99
225 3300026067 Ga0207678_10351673 Ga0207678_103516733 99
226 3300026078 Ga0207702_10000265 Ga0207702_1000026539 99
227 3300026089 Ga0207648_10122465 Ga0207648_101224653 99
228 3300026089 Ga0207648_11224352 Ga0207648_112243522 99
229 3300026116 Ga0207674_10132242 Ga0207674_101322421 99
230 3300026116 Ga0207674_10612777 Ga0207674_106127773 99
231 3300026121 Ga0207683_10027916 Ga0207683_100279164 99
232 3300026142 Ga0207698_10673496 Ga0207698_106734961 99
233 3300028379 Ga0268266_10050113 Ga0268266_100501133 99
234 3300028666 Ga0265336_10000635 Ga0265336_100006352 99
235 3300028666 Ga0265336_10006849 Ga0265336_100068492 99
236 3300029957 Ga0265324_10000006 Ga0265324_1000000637 99
237 3300029957 Ga0265324_10001952 Ga0265324_100019528 99
238 3300029957 Ga0265324_10102855 Ga0265324_101028552 99
239 3300029957 Ga0265324_10119162 Ga0265324_101191622 99
240 3300031235 Ga0265330_10036623 Ga0265330_100366232 99
241 3300031239 Ga0265328_10049087 Ga0265328_100490873 99
242 3300031239 Ga0265328_10365586 Ga0265328_103655862 99
243 3300031241 Ga0265325_10001045 Ga0265325_100010457 99
244 3300031241 Ga0265325_10012166 Ga0265325_100121667 99
245 3300031250 Ga0265331_10005415 Ga0265331_100054151 99
246 3300031250 Ga0265331_10011631 Ga0265331_100116314 99
247 3300031250 Ga0265331_10036638 Ga0265331_100366383 99
248 3300031250 Ga0265331_10079529 Ga0265331_100795293 99
249 3300031250 Ga0265331_10159281 Ga0265331_101592811 99
250 3300031250 Ga0265331_10161473 Ga0265331_101614732 99
251 3300031250 Ga0265331_10175274 Ga0265331_101752742 99
252 3300031251 Ga0265327_10000217 Ga0265327_10000217104 99
253 3300031251 Ga0265327_10000263 Ga0265327_1000026328 99
254 3300031251 Ga0265327_10000384 Ga0265327_1000038475 99
255 3300031251 Ga0265327_10000451 Ga0265327_1000045136 99
256 3300031251 Ga0265327_10001651 Ga0265327_100016519 99
257 3300031251 Ga0265327_10003428 Ga0265327_100034288 99
258 3300031251 Ga0265327_10014981 Ga0265327_100149814 99
259 3300031251 Ga0265327_10075927 Ga0265327_100759272 99
260 3300031251 Ga0265327_10088011 Ga0265327_100880113 99
261 3300031251 Ga0265327_10183608 Ga0265327_101836082 99
262 3300031251 Ga0265327_10366397 Ga0265327_103663972 99
263 3300031344 Ga0265316_10000415 Ga0265316_100004158 99
264 3300031344 Ga0265316_10132038 Ga0265316_101320383 99
265 3300031344 Ga0265316_10674948 Ga0265316_106749482 99
266 3300031344 Ga0265316_10793138 Ga0265316_107931382 99
267 3300031507 Ga0307509_10000033 Ga0307509_1000003321 99
268 3300031507 Ga0307509_10061303 Ga0307509_100613034 99
269 3300031507 Ga0307509_10953348 Ga0307509_109533482 99
270 3300031548 Ga0307408_100138751 Ga0307408_1001387513 99
271 3300031548 Ga0307408_100771864 Ga0307408_1007718642 99
272 3300031665 Ga0316575_10006222 Ga0316575_100062222 99
273 3300031665 Ga0316575_10042932 Ga0316575_100429323 99
274 3300031665 Ga0316575_10133854 Ga0316575_101338542 99
275 3300031665 Ga0316575_10224117 Ga0316575_102241171 99
276 3300031665 Ga0316575_10286563 Ga0316575_102865632 99
277 3300031665 Ga0316575_10410854 Ga0316575_104108542 99
278 3300031665 Ga0316575_10537856 Ga0316575_105378561 99
279 3300031691 Ga0316579_10002808 Ga0316579_100028085 99
280 3300031691 Ga0316579_10005314 Ga0316579_100053143 99
281 3300031691 Ga0316579_10106037 Ga0316579_101060372 99
282 3300031691 Ga0316579_10139971 Ga0316579_101399713 99
283 3300031691 Ga0316579_10265492 Ga0316579_102654922 99
284 3300031691 Ga0316579_10359585 Ga0316579_103595852 99
285 3300031711 Ga0265314_10000695 Ga0265314_1000069517 99
286 3300031711 Ga0265314_10044803 Ga0265314_100448033 99
287 3300031711 Ga0265314_10244154 Ga0265314_102441542 99
288 3300031711 Ga0265314_10582371 Ga0265314_105823712 99
289 3300031727 Ga0316576_10012034 Ga0316576_100120347 99
290 3300031727 Ga0316576_10023904 Ga0316576_100239043 99
291 3300031727 Ga0316576_10092384 Ga0316576_100923843 99
292 3300031727 Ga0316576_10111617 Ga0316576_101116172 99
293 3300031727 Ga0316576_10228420 Ga0316576_102284202 99
294 3300031727 Ga0316576_10234281 Ga0316576_102342813 99
295 3300031727 Ga0316576_10604169 Ga0316576_106041692 99
296 3300031727 Ga0316576_11324248 Ga0316576_113242482 99
297 3300031728 Ga0316578_10007293 Ga0316578_100072935 99
298 3300031728 Ga0316578_10010611 Ga0316578_100106112 99
299 3300031728 Ga0316578_10056810 Ga0316578_100568102 99
300 3300031728 Ga0316578_10061543 Ga0316578_100615433 99
301 3300031728 Ga0316578_10062242 Ga0316578_100622423 99
302 3300031728 Ga0316578_10149733 Ga0316578_101497332 99
303 3300031728 Ga0316578_10239849 Ga0316578_102398492 99
304 3300031728 Ga0316578_10316154 Ga0316578_103161542 99
305 3300031728 Ga0316578_10452038 Ga0316578_104520382 99
306 3300031733 Ga0316577_10004833 Ga0316577_100048338 99
307 3300031733 Ga0316577_10013861 Ga0316577_100138612 99
308 3300031733 Ga0316577_10023862 Ga0316577_100238623 99
309 3300031733 Ga0316577_10134076 Ga0316577_101340763 99
310 3300031733 Ga0316577_10197181 Ga0316577_101971813 99
311 3300031824 Ga0307413_10068741 Ga0307413_100687413 99
312 3300031824 Ga0307413_10082143 Ga0307413_100821433 99
313 3300031903 Ga0307407_10894506 Ga0307407_108945062 99
314 3300031995 Ga0307409_102669715 Ga0307409_1026697151 99
315 3300032002 Ga0307416_100234135 Ga0307416_1002341353 99
316 3300032004 Ga0307414_10005069 Ga0307414_1000506910 99
317 3300032004 Ga0307414_10160577 Ga0307414_101605774 99
318 3300032005 Ga0307411_10230912 Ga0307411_102309123 99
319 3300032133 Ga0316583_10187225 Ga0316583_101872252 99
320 3300032137 Ga0316585_10062376 Ga0316585_100623762 99
321 3300032137 Ga0316585_10200746 Ga0316585_102007462 99
322 3300032137 Ga0316585_10245587 Ga0316585_102455871 99
323 3300032139 Ga0316580_10008941 Ga0316580_100089412 99
324 3300032139 Ga0316580_10159362 Ga0316580_101593621 99
325 3300032168 Ga0316593_10001438 Ga0316593_100014382 99
326 3300032168 Ga0316593_10005218 Ga0316593_100052183 99
327 3300032168 Ga0316593_10007592 Ga0316593_100075923 99
328 3300032168 Ga0316593_10009320 Ga0316593_100093202 99
329 3300032168 Ga0316593_10021089 Ga0316593_100210892 99
330 3300032168 Ga0316593_10030402 Ga0316593_100304022 99
331 3300032168 Ga0316593_10038088 Ga0316593_100380882 99
332 3300032168 Ga0316593_10051481 Ga0316593_100514813 99
333 3300032168 Ga0316593_10239656 Ga0316593_102396562 99
334 3300033179 Ga0307507_10115035 Ga0307507_101150353 99
335 3300033524 Ga0316592_1001647 Ga0316592_10016475 99
336 3300033524 Ga0316592_1004031 Ga0316592_10040313 99
337 3300033527 Ga0316586_1006539 Ga0316586_10065392 99
338 3300033527 Ga0316586_1011285 Ga0316586_10112852 99
339 3300033527 Ga0316586_1082190 Ga0316586_10821902 99
340 3300033528 Ga0316588_1002175 Ga0316588_10021755 99
341 3300033529 Ga0316587_1000605 Ga0316587_10006052 99
342 3300033529 Ga0316587_1001369 Ga0316587_10013693 99
343 3300033529 Ga0316587_1026280 Ga0316587_10262802 99
344 3300033529 Ga0316587_1066493 Ga0316587_10664931 99
345 3300033541 Ga0316596_1002607 Ga0316596_10026073 99
346 3300033541 Ga0316596_1003987 Ga0316596_10039874 99
347 3300033541 Ga0316596_1005395 Ga0316596_10053953 99
348 3300033541 Ga0316596_1017537 Ga0316596_10175373 99
349 3300033541 Ga0316596_1156885 Ga0316596_11568852 99
350 3300035086 Ga0373934_0031476 Ga0373934_0031476_563_871 99
351 3300035090 Ga0373949_0156436 Ga0373949_0156436_262_561 99
352 3300035121 Ga0373960_0347069 Ga0373960_0347069_65_367 99
353 3300035172 Ga0373955_0280213 Ga0373955_0280213_48_347 99
354 3300035398 Ga0316574_0000917 Ga0316574_0000917_6218_6517 99
355 3300035398 Ga0316574_0016304 Ga0316574_0016304_2969_3268 99
356 3300035398 Ga0316574_0017949 Ga0316574_0017949_1605_1904 99
357 3300035398 Ga0316574_0024050 Ga0316574_0024050_2600_2899 99
358 3300035398 Ga0316574_0031363 Ga0316574_0031363_1567_1866 99
359 3300035398 Ga0316574_0043388 Ga0316574_0043388_155_457 99
360 3300035398 Ga0316574_0063386 Ga0316574_0063386_865_1164 99
361 3300035398 Ga0316574_0065877 Ga0316574_0065877_748_1047 99
362 3300035398 Ga0316574_0070611 Ga0316574_0070611_673_975 99
363 3300035398 Ga0316574_0158006 Ga0316574_0158006_800_1099 99
364 3300035398 Ga0316574_0197633 Ga0316574_0197633_413_712 99
365 3300035398 Ga0316574_0322234 Ga0316574_0322234_558_857 99
366 3300035398 Ga0316574_0329566 Ga0316574_0329566_28_327 99
367 3300035398 Ga0316574_0359894 Ga0316574_0359894_309_611 99
368 3300035398 Ga0316574_0470007 Ga0316574_0470007_176_475 99
369 3300035398 Ga0316574_0538927 Ga0316574_0538927_117_416 99
370 3300035398 Ga0316574_0640603 Ga0316574_0640603_26_325 99
371 3300035398 Ga0316574_0785017 Ga0316574_0785017_78_377 99
372 3300035695 Ga0373927_0000003 Ga0373927_0000003_316390_316689 99
373 3300036647 Ga0316582_0002944 Ga0316582_0002944_7553_7852 99
374 3300036647 Ga0316582_0003473 Ga0316582_0003473_1524_1829 99
375 3300036647 Ga0316582_0010224 Ga0316582_0010224_1386_1685 99
376 3300036647 Ga0316582_0020160 Ga0316582_0020160_2087_2386 99
377 3300036647 Ga0316582_0121405 Ga0316582_0121405_236_538 99
378 3300036647 Ga0316582_0196440 Ga0316582_0196440_184_483 99
379 3300036647 Ga0316582_0221996 Ga0316582_0221996_403_705 99
380 3300036647 Ga0316582_0302263 Ga0316582_0302263_214_516 99
381 3300036647 Ga0316582_0316738 Ga0316582_0316738_118_420 99
382 3300036647 Ga0316582_0669850 Ga0316582_0669850_391_693 99
383 3300036712 Ga0316584_0000296 Ga0316584_0000296_14926_15225 99
384 3300036712 Ga0316584_0004769 Ga0316584_0004769_5867_6169 99
385 3300036712 Ga0316584_0009712 Ga0316584_0009712_574_879 99
386 3300036712 Ga0316584_0022679 Ga0316584_0022679_112_411 99
387 3300036712 Ga0316584_0054814 Ga0316584_0054814_1922_2224 99
388 3300036712 Ga0316584_0085991 Ga0316584_0085991_183_482 99
389 3300036712 Ga0316584_0181699 Ga0316584_0181699_351_650 99
390 3300036712 Ga0316584_0245427 Ga0316584_0245427_143_442 99
391 3300036712 Ga0316584_0530190 Ga0316584_0530190_160_459 99
392 3300036712 Ga0316584_0719068 Ga0316584_0719068_129_431 99
393 3300037312 Ga0395899_0057003 Ga0395899_0057003_306_605 99
394 3300037312 Ga0395899_0200134 Ga0395899_0200134_602_901 99
395 3300037312 Ga0395899_0919260 Ga0395899_0919260_200_502 99
396 3300037418 Ga0395900_0007174 Ga0395900_0007174_4205_4504 99
397 3300037418 Ga0395900_0064142 Ga0395900_0064142_1154_1456 99
398 3300037418 Ga0395900_0664007 Ga0395900_0664007_637_939 99
399 3300037466 Ga0395898_0044148 Ga0395898_0044148_777_1076 99
400 3300037466 Ga0395898_0127063 Ga0395898_0127063_1138_1437 99
401 3300037471 Ga0395905_0093701 Ga0395905_0093701_433_732 99
402 3300037471 Ga0395905_0143599 Ga0395905_0143599_769_1068 99
403 3300037588 Ga0316581_0020940 Ga0316581_0020940_518_823 99
404 3300037588 Ga0316581_0045368 Ga0316581_0045368_801_1100 99
405 3300038443 Ga0395901_0009614 Ga0395901_0009614_669_968 99
406 3300038443 Ga0395901_0077019 Ga0395901_0077019_945_1244 99
407 3300038443 Ga0395901_0085496 Ga0395901_0085496_900_1202 99
408 3300038725 Ga0400484_13421 Ga0400484_13421_10232_10534 99
409 3300038725 Ga0400484_36729 Ga0400484_36729_667_969 99
410 3300038726 Ga0400490_57276 Ga0400490_57276_9185_9487 99
411 3300038726 Ga0400490_60783 Ga0400490_60783_3115_3417 99
412 3300038727 Ga0400491_13912 Ga0400491_13912_1686_1988 99
413 3300038727 Ga0400491_26096 Ga0400491_26096_1451_1753 99
414 3300038735 Ga0400485_07884 Ga0400485_07884_52038_52340 99
415 3300038741 Ga0400488_12060 Ga0400488_12060_5902_6204 99
416 3300038741 Ga0400488_14459 Ga0400488_14459_999_1301 99
417 3300038741 Ga0400488_38117 Ga0400488_38117_789_1091 99
418 3300038741 Ga0400488_47132 Ga0400488_47132_491_793 99
419 3300038741 Ga0400488_62074 Ga0400488_62074_17007_17309 99
420 3300038742 Ga0400486_28685 Ga0400486_28685_70753_71055 99
421 3300039062 Ga0400483_074278 Ga0400483_074278_826_1146 99
422 3300039062 Ga0400483_078872 Ga0400483_078872_6982_7284 99
423 3300039062 Ga0400483_243724 Ga0400483_243724_1394_1696 99
424 3300039062 Ga0400483_261783 Ga0400483_261783_1786_2085 99
425 3300039062 Ga0400483_262546 Ga0400483_262546_1165_1485 99
426 3300039093 Ga0400489_37628 Ga0400489_37628_232_531 99
427 3300039110 Ga0400487_17750 Ga0400487_17750_897_1199 99
428 3300039110 Ga0400487_19743 Ga0400487_19743_727_1029 99
429 3300039110 Ga0400487_27243 Ga0400487_27243_1086_1388 99
430 3300039110 Ga0400487_63494 Ga0400487_63494_11765_12067 99
431 3300039447 Ga0436361_0215157 Ga0436361_0215157_109656_109958 99
432 3300039447 Ga0436361_0406661 Ga0436361_0406661_13971_14273 99
433 3300039447 Ga0436361_0857217 Ga0436361_0857217_259_561 99
434 3300039447 Ga0436361_0880017 Ga0436361_0880017_4418_4720 99
435 3300039447 Ga0436361_0883037 Ga0436361_0883037_204_506 99
436 3300039447 Ga0436361_1012185 Ga0436361_1012185_505_807 99
437 3300039447 Ga0436361_1132645 Ga0436361_1132645_2192_2494 99
438 3300041404 Ga0439436_0010326 Ga0439436_0010326_216_515 99
439 3300041406 Ga0439439_0001670 Ga0439439_0001670_783_1082 99
440 3300041456 Ga0451795_0341801 Ga0451795_0341801_727_1026 99
441 3300041460 Ga0451802_0570730 Ga0451802_0570730_534_833 99
442 3300041486 Ga0451807_0581176 Ga0451807_0581176_204_506 99
443 3300041486 Ga0451807_2618503 Ga0451807_2618503_473_772 99
444 3300041494 Ga0451837_1382718 Ga0451837_1382718_1937_2236 99
445 3300042004 Ga0439445_0004296 Ga0439445_0004296_672_971 99
446 3300042004 Ga0439445_0123772 Ga0439445_0123772_214_516 99
447 3300042006 Ga0439432_008540 Ga0439432_008540_1415_1714 99
448 3300042007 Ga0439449_0019101 Ga0439449_0019101_1643_1942 99
449 3300042012 Ga0439455_0176088 Ga0439455_0176088_263_562 99
450 3300042015 Ga0439462_0012694 Ga0439462_0012694_1490_1789 99
451 3300042876 Ga0451577_0050976 Ga0451577_0050976_2960_3262 99
452 3300042876 Ga0451577_0087260 Ga0451577_0087260_2253_2552 99
453 3300042876 Ga0451577_0119469 Ga0451577_0119469_1616_1918 99
454 3300042876 Ga0451577_0264760 Ga0451577_0264760_1139_1441 99
455 3300042876 Ga0451577_0269066 Ga0451577_0269066_1186_1485 99
456 3300042876 Ga0451577_0874135 Ga0451577_0874135_202_507 99
457 3300042876 Ga0451577_0908700 Ga0451577_0908700_346_648 99
458 3300044656 Ga0466969_0008592 Ga0466969_0008592_2060_2362 99
459 3300044656 Ga0466969_0022510 Ga0466969_0022510_688_990 99
460 3300044661 Ga0466975_0340179 Ga0466975_0340179_593_895 99
461 3300044673 Ga0453683_0204910 Ga0453683_0204910_903_1205 99
462 3300044683 Ga0466965_0011487 Ga0466965_0011487_1375_1677 99
463 3300044684 Ga0466966_0011013 Ga0466966_0011013_2083_2385 99
464 3300044684 Ga0466966_0024354 Ga0466966_0024354_3359_3661 99
465 3300044693 Ga0466961_0000131 Ga0466961_0000131_38337_38639 99
466 3300044693 Ga0466961_0003687 Ga0466961_0003687_9005_9307 99
467 3300044693 Ga0466961_0004743 Ga0466961_0004743_435_737 99
468 3300044712 Ga0453684_0004710 Ga0453684_0004710_4445_4744 99
469 3300044712 Ga0453684_0007598 Ga0453684_0007598_19235_19537 99
470 3300044712 Ga0453684_0013476 Ga0453684_0013476_10762_11064 99
471 3300044712 Ga0453684_0212635 Ga0453684_0212635_797_1099 99
472 3300044712 Ga0453684_0237233 Ga0453684_0237233_1479_1781 99
473 3300044712 Ga0453684_0778832 Ga0453684_0778832_314_613 99
474 3300044712 Ga0453684_1795844 Ga0453684_1795844_308_610 99
475 3300044765 Ga0466970_0052824 Ga0466970_0052824_424_726 99
476 3300044765 Ga0466970_0109262 Ga0466970_0109262_735_1037 99
477 3300044842 Ga0466957_0109237 Ga0466957_0109237_1194_1496 99
478 3300045049 Ga0466959_0000232 Ga0466959_0000232_16587_16889 99
479 3300045049 Ga0466959_0000838 Ga0466959_0000838_16617_16919 99
480 3300045049 Ga0466959_1073702 Ga0466959_1073702_177_479 99
481 3300045051 Ga0451576_0000013 Ga0451576_0000013_217491_217793 99
482 3300045051 Ga0451576_0000250 Ga0451576_0000250_110203_110508 99
483 3300045051 Ga0451576_0001427 Ga0451576_0001427_38474_38776 99
484 3300045051 Ga0451576_0026520 Ga0451576_0026520_861_1163 99
485 3300045051 Ga0451576_0029526 Ga0451576_0029526_722_1024 99
486 3300045051 Ga0451576_0044995 Ga0451576_0044995_3077_3379 99
487 3300045051 Ga0451576_0070946 Ga0451576_0070946_181_483 99
488 3300045051 Ga0451576_0259649 Ga0451576_0259649_317_619 99
489 3300045051 Ga0451576_1042154 Ga0451576_1042154_271_573 99
490 3300045051 Ga0451576_1051696 Ga0451576_1051696_368_670 99
491 3300045051 Ga0451576_1077088 Ga0451576_1077088_268_570 99
492 3300045051 Ga0451576_1115684 Ga0451576_1115684_227_526 99
493 3300045051 Ga0451576_1232305 Ga0451576_1232305_168_470 99
494 3300045836 Ga0466958_0031465 Ga0466958_0031465_2543_2845 99
495 3300046452 Ga0495617_000288 Ga0495617_000288_24965_25264 99
496 3300046452 Ga0495617_000874 Ga0495617_000874_409_708 99
497 3300046453 Ga0495627_000778 Ga0495627_000778_4465_4764 99
498 3300046457 Ga0495590_0011311 Ga0495590_0011311_2729_3028 99
499 3300046460 Ga0495638_0000584 Ga0495638_0000584_30621_30920 99
500 3300046471 Ga0495650_0008270 Ga0495650_0008270_1837_2136 99
501 3300046471 Ga0495650_0146583 Ga0495650_0146583_405_704 99
502 3300046474 Ga0495605_0062734 Ga0495605_0062734_1109_1408 99
503 3300046491 Ga0495584_0010943 Ga0495584_0010943_372_671 99
504 3300046492 Ga0495585_0000019 Ga0495585_0000019_25621_25920 99
505 3300046492 Ga0495585_0231149 Ga0495585_0231149_344_643 99
506 3300046501 Ga0495607_0000430 Ga0495607_0000430_40372_40671 99
507 3300046501 Ga0495607_0252086 Ga0495607_0252086_204_503 99
508 3300046506 Ga0495583_0036562 Ga0495583_0036562_1389_1688 99
509 3300046507 Ga0495606_0000665 Ga0495606_0000665_25034_25333 99
510 3300046507 Ga0495606_0000888 Ga0495606_0000888_474_773 99
511 3300046507 Ga0495606_0002803 Ga0495606_0002803_17279_17578 99
512 3300046507 Ga0495606_0314611 Ga0495606_0314611_373_672 99
513 3300046512 Ga0495610_0024167 Ga0495610_0024167_292_591 99
514 3300046512 Ga0495610_0099501 Ga0495610_0099501_214_513 99
515 3300046513 Ga0495616_0000047 Ga0495616_0000047_408_707 99
516 3300046513 Ga0495616_0129543 Ga0495616_0129543_450_749 99
517 3300046513 Ga0495616_0238355 Ga0495616_0238355_450_749 99
518 3300046515 Ga0495620_0007968 Ga0495620_0007968_1834_2133 99
519 3300046515 Ga0495620_0012378 Ga0495620_0012378_453_752 99
520 3300046517 Ga0495630_0466972 Ga0495630_0466972_100_399 99
521 3300046518 Ga0495631_0000361 Ga0495631_0000361_1611_1910 99
522 3300046518 Ga0495631_0000705 Ga0495631_0000705_373_672 99
523 3300046518 Ga0495631_0000767 Ga0495631_0000767_6622_6921 99
524 3300046519 Ga0495632_0045045 Ga0495632_0045045_1543_1842 99
525 3300046519 Ga0495632_0046221 Ga0495632_0046221_1768_2067 99
526 3300046519 Ga0495632_0210392 Ga0495632_0210392_358_657 99
527 3300046524 Ga0495648_0000947 Ga0495648_0000947_26157_26456 99
528 3300046524 Ga0495648_0003270 Ga0495648_0003270_13655_13954 99
529 3300046525 Ga0495663_0073966 Ga0495663_0073966_179_478 99
530 3300046530 Ga0495654_0000922 Ga0495654_0000922_2539_2838 99
531 3300046531 Ga0495665_0086171 Ga0495665_0086171_420_719 99
532 3300046538 Ga0495609_0001428 Ga0495609_0001428_13716_14015 99
533 3300046539 Ga0495621_0108453 Ga0495621_0108453_327_626 99
534 3300046615 Ga0495656_0038020 Ga0495656_0038020_340_639 99
535 3300046616 Ga0495668_0006146 Ga0495668_0006146_1807_2106 99
536 3300046616 Ga0495668_0216334 Ga0495668_0216334_387_686 99
537 3300046648 Ga0495611_0000001 Ga0495611_0000001_630833_631132 99
538 3300046648 Ga0495611_0000239 Ga0495611_0000239_24535_24834 99
539 3300046660 Ga0495625_0000001 Ga0495625_0000001_1284915_1285214 99
540 3300046660 Ga0495625_0434806 Ga0495625_0434806_135_434 99
541 3300046665 Ga0495661_0001751 Ga0495661_0001751_3372_3671 99
542 3300046691 Ga0495670_0010116 Ga0495670_0010116_2658_2957 99
543 3300046691 Ga0495670_0050033 Ga0495670_0050033_1434_1733 99
544 3300046691 Ga0495670_0275207 Ga0495670_0275207_275_574 99
545 3300046692 Ga0495671_0000272 Ga0495671_0000272_41232_41531 99
546 3300046794 Ga0495589_0000329 Ga0495589_0000329_3296_3595 99
547 3300046810 Ga0495660_0047556 Ga0495660_0047556_531_830 99
548 3300046810 Ga0495660_0047561 Ga0495660_0047561_531_830 99
549 3300047318 Ga0495636_0110047 Ga0495636_0110047_715_1014 99
550 3300047320 Ga0495672_0006584 Ga0495672_0006584_3498_3797 99
551 3300047446 Ga0495679_000001 Ga0495679_000001_957464_957763 99
552 3300047469 Ga0495673_0000001 Ga0495673_0000001_1357060_1357359 99
553 3300047469 Ga0495673_0000099 Ga0495673_0000099_32076_32375 99
554 3300047469 Ga0495673_0035008 Ga0495673_0035008_1545_1844 99
555 3300047469 Ga0495673_0285818 Ga0495673_0285818_39_338 99
556 3300047472 Ga0495686_0000255 Ga0495686_0000255_71156_71455 99
557 3300047472 Ga0495686_0052579 Ga0495686_0052579_382_681 99
558 3300047472 Ga0495686_0065153 Ga0495686_0065153_368_667 99
559 3300047472 Ga0495686_0372021 Ga0495686_0372021_455_754 99
560 3300047472 Ga0495686_0547305 Ga0495686_0547305_228_527 99
561 3300048903 Ga0496100_0160269 Ga0496100_0160269_318_617 99
562 3300048903 Ga0496100_1118917 Ga0496100_1118917_236_535 99
563 3300048904 Ga0496101_0063136 Ga0496101_0063136_896_1195 99
564 3300048905 Ga0496102_0332424 Ga0496102_0332424_34_333 99
565 3300048905 Ga0496102_0642306 Ga0496102_0642306_424_723 99
566 3300048906 Ga0496103_0369715 Ga0496103_0369715_486_785 99
567 3300048909 Ga0496106_0002577 Ga0496106_0002577_7684_7983 99
568 3300048910 Ga0496107_1112225 Ga0496107_1112225_195_494 99
569 3300048911 Ga0496108_0298956 Ga0496108_0298956_532_834 99
570 3300048912 Ga0496109_0542389 Ga0496109_0542389_466_768 99
571 3300048918 Ga0496115_0302808 Ga0496115_0302808_490_792 99
572 3300048919 Ga0496116_0168745 Ga0496116_0168745_240_539 99
573 3300048920 Ga0496117_0068320 Ga0496117_0068320_1867_2166 99
574 3300048920 Ga0496117_0221893 Ga0496117_0221893_702_1001 99
575 3300048921 Ga0496118_0002292 Ga0496118_0002292_7911_8210 99
576 3300048921 Ga0496118_0015532 Ga0496118_0015532_5001_5300 99
577 3300048921 Ga0496118_0029973 Ga0496118_0029973_3457_3756 99
578 3300048924 Ga0496121_0000210 Ga0496121_0000210_82661_82960 99
579 3300048924 Ga0496121_0002725 Ga0496121_0002725_24553_24852 99
580 3300048924 Ga0496121_0074823 Ga0496121_0074823_407_706 99
581 3300048924 Ga0496121_0311210 Ga0496121_0311210_459_758 99
582 3300048924 Ga0496121_0415780 Ga0496121_0415780_307_606 99
583 3300048925 Ga0496122_0032475 Ga0496122_0032475_282_581 99
584 3300048925 Ga0496122_0100938 Ga0496122_0100938_70_369 99
585 3300048925 Ga0496122_0227339 Ga0496122_0227339_734_1033 99
586 3300048925 Ga0496122_0256459 Ga0496122_0256459_90_389 99
587 3300048926 Ga0496123_0058141 Ga0496123_0058141_1908_2207 99
588 3300048926 Ga0496123_0071913 Ga0496123_0071913_295_594 99
589 3300048928 Ga0496125_0012647 Ga0496125_0012647_1117_1416 99
590 3300048929 Ga0496126_1263775 Ga0496126_1263775_104_403 99
591 3300049459 Ga0495678_000664 Ga0495678_000664_21183_21482 99
592 3300049460 Ga0495682_0020684 Ga0495682_0020684_1762_2061 99
593 3300049460 Ga0495682_0041271 Ga0495682_0041271_984_1283 99
594 3300049523 Ga0501300_072364 Ga0501300_072364_169_471 99
595 3300049568 Ga0501031_0036335 Ga0501031_0036335_547_846 99
596 3300049568 Ga0501031_0819665 Ga0501031_0819665_38_352 99
597 3300049569 Ga0501032_0000744 Ga0501032_0000744_17896_18195 99
598 3300049569 Ga0501032_0021539 Ga0501032_0021539_3448_3750 99
599 3300049569 Ga0501032_0869784 Ga0501032_0869784_237_536 99
600 3300049570 Ga0501033_0003954 Ga0501033_0003954_644_958 99
601 3300049570 Ga0501033_0010512 Ga0501033_0010512_4675_4974 99
602 3300049570 Ga0501033_0083570 Ga0501033_0083570_2025_2324 99
603 3300049571 Ga0501034_0000996 Ga0501034_0000996_28900_29199 99
604 3300049571 Ga0501034_0002335 Ga0501034_0002335_20040_20339 99
605 3300049571 Ga0501034_0104860 Ga0501034_0104860_2422_2724 99
606 3300049571 Ga0501034_0484912 Ga0501034_0484912_540_839 99
607 3300049571 Ga0501034_0659861 Ga0501034_0659861_454_753 99
608 3300049571 Ga0501034_0798819 Ga0501034_0798819_304_609 99
609 3300049572 Ga0501036_0043683 Ga0501036_0043683_1294_1593 99
610 3300049572 Ga0501036_0207362 Ga0501036_0207362_368_673 99
611 3300049573 Ga0501037_0000566 Ga0501037_0000566_3157_3456 99
612 3300049573 Ga0501037_0004006 Ga0501037_0004006_936_1235 99
613 3300049573 Ga0501037_0007619 Ga0501037_0007619_1420_1719 99
614 3300049573 Ga0501037_0095314 Ga0501037_0095314_82_381 99
615 3300049573 Ga0501037_0327745 Ga0501037_0327745_691_993 99
616 3300049573 Ga0501037_0458867 Ga0501037_0458867_543_842 99
617 3300049573 Ga0501037_0820218 Ga0501037_0820218_53_352 99
618 3300049573 Ga0501037_0950502 Ga0501037_0950502_229_531 99
619 3300049574 Ga0501038_0000746 Ga0501038_0000746_18356_18655 99
620 3300049574 Ga0501038_0005436 Ga0501038_0005436_6460_6759 99
621 3300049574 Ga0501038_0007938 Ga0501038_0007938_4592_4891 99
622 3300049574 Ga0501038_0014627 Ga0501038_0014627_819_1124 99
623 3300049574 Ga0501038_0371693 Ga0501038_0371693_285_584 99
624 3300049575 Ga0501039_0012430 Ga0501039_0012430_4058_4357 99
625 3300049575 Ga0501039_0067110 Ga0501039_0067110_2077_2376 99
626 3300049575 Ga0501039_0257096 Ga0501039_0257096_145_444 99
627 3300049578 Ga0501042_0322089 Ga0501042_0322089_599_898 99
628 3300049578 Ga0501042_0363175 Ga0501042_0363175_656_955 99
629 3300049579 Ga0501043_0005586 Ga0501043_0005586_6010_6309 99
630 3300049579 Ga0501043_0024289 Ga0501043_0024289_4159_4461 99
631 3300049579 Ga0501043_0054377 Ga0501043_0054377_425_724 99
632 3300049579 Ga0501043_0339815 Ga0501043_0339815_280_579 99
633 3300049579 Ga0501043_1334928 Ga0501043_1334928_146_445 99
634 3300049580 Ga0501046_0000760 Ga0501046_0000760_17084_17383 99
635 3300049580 Ga0501046_0314335 Ga0501046_0314335_499_798 99
636 3300049580 Ga0501046_0340015 Ga0501046_0340015_520_819 99
637 3300049581 Ga0501047_0001682 Ga0501047_0001682_17546_17845 99
638 3300049581 Ga0501047_0006314 Ga0501047_0006314_3345_3644 99
639 3300049581 Ga0501047_0224359 Ga0501047_0224359_305_604 99
640 3300049581 Ga0501047_0224384 Ga0501047_0224384_1393_1692 99
641 3300049581 Ga0501047_0291289 Ga0501047_0291289_900_1199 99
642 3300049581 Ga0501047_0540519 Ga0501047_0540519_504_803 99
643 3300049581 Ga0501047_0597252 Ga0501047_0597252_397_696 99
644 3300049581 Ga0501047_0822098 Ga0501047_0822098_160_459 99
645 3300049582 Ga0501048_0283698 Ga0501048_0283698_731_1030 99
646 3300049583 Ga0501067_0037230 Ga0501067_0037230_529_828 99
647 3300049583 Ga0501067_0048538 Ga0501067_0048538_685_984 99
648 3300049583 Ga0501067_0085285 Ga0501067_0085285_1319_1618 99
649 3300049585 Ga0501069_0028355 Ga0501069_0028355_301_600 99
650 3300049585 Ga0501069_0047385 Ga0501069_0047385_1033_1335 99
651 3300049585 Ga0501069_0246042 Ga0501069_0246042_57_359 99
652 3300049586 Ga0501070_0003644 Ga0501070_0003644_8718_9017 99
653 3300049586 Ga0501070_0003853 Ga0501070_0003853_10235_10534 99
654 3300049586 Ga0501070_0021411 Ga0501070_0021411_1632_1931 99
655 3300049586 Ga0501070_0033976 Ga0501070_0033976_536_835 99
656 3300049586 Ga0501070_0047614 Ga0501070_0047614_3026_3325 99
657 3300049586 Ga0501070_0080426 Ga0501070_0080426_1515_1817 99
658 3300049586 Ga0501070_0102947 Ga0501070_0102947_909_1211 99
659 3300049588 Ga0501072_0000714 Ga0501072_0000714_2989_3288 99
660 3300049589 Ga0501073_0001389 Ga0501073_0001389_10178_10477 99
661 3300049589 Ga0501073_0060100 Ga0501073_0060100_409_708 99
662 3300049589 Ga0501073_0091460 Ga0501073_0091460_461_760 99
663 3300049589 Ga0501073_0998950 Ga0501073_0998950_142_441 99
664 3300049590 Ga0501074_0000672 Ga0501074_0000672_19101_19400 99
665 3300049590 Ga0501074_0031093 Ga0501074_0031093_1040_1339 99
666 3300049590 Ga0501074_1320589 Ga0501074_1320589_41_343 99
667 3300049591 Ga0501075_0075495 Ga0501075_0075495_927_1226 99
668 3300049593 Ga0501077_0200093 Ga0501077_0200093_167_469 99
669 3300049741 Ga0501079_0088598 Ga0501079_0088598_2073_2372 99
670 3300049741 Ga0501079_0507019 Ga0501079_0507019_258_560 99
671 3300049742 Ga0501080_0010993 Ga0501080_0010993_4361_4660 99
672 3300049742 Ga0501080_0023507 Ga0501080_0023507_1295_1594 99
673 3300049742 Ga0501080_0025335 Ga0501080_0025335_3284_3583 99
674 3300049742 Ga0501080_0194744 Ga0501080_0194744_269_571 99
675 3300049742 Ga0501080_0194865 Ga0501080_0194865_243_542 99
676 3300049742 Ga0501080_1529515 Ga0501080_1529515_113_412 99
677 3300049744 Ga0501083_0020036 Ga0501083_0020036_2173_2472 99
678 3300049776 Ga0501280_000116 Ga0501280_000116_10994_11296 99
679 3300049822 Ga0501035_0003276 Ga0501035_0003276_3345_3644 99
680 3300049822 Ga0501035_0040291 Ga0501035_0040291_2574_2879 99
681 3300049822 Ga0501035_0060626 Ga0501035_0060626_1045_1344 99
682 3300049822 Ga0501035_0063180 Ga0501035_0063180_1220_1519 99
683 3300049822 Ga0501035_0333878 Ga0501035_0333878_685_984 99
684 3300049822 Ga0501035_1006512 Ga0501035_1006512_171_470 99
685 3300049822 Ga0501035_1558208 Ga0501035_1558208_160_459 99
686 3300049823 Ga0501044_0000190 Ga0501044_0000190_9975_10280 99
687 3300049823 Ga0501044_0002882 Ga0501044_0002882_13631_13930 99
688 3300049823 Ga0501044_0025830 Ga0501044_0025830_2615_2914 99
689 3300049823 Ga0501044_0062309 Ga0501044_0062309_1467_1766 99
690 3300049823 Ga0501044_0133563 Ga0501044_0133563_1750_2160 99
691 3300049823 Ga0501044_0204715 Ga0501044_0204715_1039_1338 99
692 3300049823 Ga0501044_0907414 Ga0501044_0907414_106_405 99
693 3300049823 Ga0501044_1047509 Ga0501044_1047509_258_560 99
694 3300049823 Ga0501044_1416828 Ga0501044_1416828_117_419 99
695 3300050491 nmdc:mga00v17_37036_c1 nmdc:mga00v17_37036_c1_1670_1972 99
696 3300050492 nmdc:mga0yw44_1241947_c1 nmdc:mga0yw44_1241947_c1_156_458 99
697 3300050493 nmdc:mga0k408_160022_c1 nmdc:mga0k408_160022_c1_95_403 99
698 3300050493 nmdc:mga0k408_32718_c1 nmdc:mga0k408_32718_c1_1742_2044 99
699 3300050493 nmdc:mga0k408_7088_c1 nmdc:mga0k408_7088_c1_5439_5747 99
700 3300050494 nmdc:mga06z11_540788_c1 nmdc:mga06z11_540788_c1_72_380 99
701 3300050496 nmdc:mga07m45_84427_c1 nmdc:mga07m45_84427_c1_254_556 99
702 3300050510 nmdc:mga06r32_680441_c1 nmdc:mga06r32_680441_c1_445_744 99
703 3300050516 nmdc:mga0sz30_51816_c1 nmdc:mga0sz30_51816_c1_83_385 99
704 3300053087 Ga0500643_000002 Ga0500643_000002_1193242_1193541 99
705 3300053094 Ga0500566_0466051 Ga0500566_0466051_94_393 99
706 3300053096 Ga0500641_0002680 Ga0500641_0002680_110_412 99
707 3300053103 Ga0500555_000245 Ga0500555_000245_21731_22030 99
708 3300053136 Ga0500559_0039706 Ga0500559_0039706_60_362 99
709 3300053156 Ga0500622_0000023 Ga0500622_0000023_89330_89632 99
710 3300053177 Ga0500636_0000837 Ga0500636_0000837_3656_3958 99
711 3300053178 Ga0500637_0028995 Ga0500637_0028995_1156_1458 99
712 3300053730 Ga0500645_000235 Ga0500645_000235_27981_28280 99
713 3300054114 Ga0501084_0115255 Ga0501084_0115255_37_336 99
714 3300055283 Ga0500661_025343 Ga0500661_025343_316_618 99
715 3300060353 Ga0501082_0077132 Ga0501082_0077132_1884_2183 99
716 3300060353 Ga0501082_1315532 Ga0501082_1315532_205_504 99
717 3300060353 Ga0501082_1484152 Ga0501082_1484152_139_438 99
718 3300061719 Ga0466962_0368067 Ga0466962_0368067_104_406 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

23

117

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.9976 1 98
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.9777 1 98
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.8967 1 95
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.838 1 95
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6913 1 96
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 1.005 1 98 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9949 1 98 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8905 3 96 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8637 3 96 3.30.70.1060
af_Q5A784_25_117_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7872 2 96 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A0H3KWQ4-F1-model_v4 Protein YciI 1.006 1 98
AF-A0A7Z1UAA2-F1-model_v4 deleted 1.005 1 98
AF-A0A0L7ZB45-F1-model_v4 deleted 1.005 1 98
AF-A0A7X1LMW3-F1-model_v4 YciI family protein 1.005 1 99
AF-A0A4V2W5I5-F1-model_v4 YCII-related domain-containing protein 1.005 2 98

Feature Viewer

pLDDT pTM Quality
97.78 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map