F477076

General Info

Members Datasets Scaffolds Average Seq Length
716 411 649 429

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0016788|Ga0501031_0016788_1743_3203
Length 486
Sequence MKNLPDTLDGWLHYCEHLHPHTIEMGLDRVALVKERLGLHLDCPVITVAGTNGKGSTCAMIEAVALQAGYRPGVYTSPHLVHFEERCRIHGETVKPEELLPHFEAVERARTEGGEVQLTYFEFTTLAILRLISQARVDVAVLEVGMGGRLDAVNVIDADCAVITMIDVDHAEFLGPDRESIGREKAGIMRPGRPVVVCDPVPPESVIEHAKAIGARLWRFGTDFNYSGDKLQWSWAGRGRRYAGMSYPALRGANQLFNASGALAALEAIREKLPISAQAVRAGLALVELPGRFEVAPGQPVVVLDVAHNPHAVATLAASMSTMGHFRLTHAVFGAMADKDITGIFEKIGPLIDRWYFTDLPTARAETAAHLQERWERFHAQQEALQTPPAVVQDDAPRMDLAEAVKQQDDKPHLSVTRSRRGSSGEGXXXRRIVKSEVFADPQTALDAAIAASRLTDRIVVFGSFYTVGGILKNGMPQMHGKHFDL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221609 Acidovorax sp. Root217 Isolate Unclassified
15 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
18 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221672 Variovorax sp. Root434 Isolate Unclassified
22 2643221683 Variovorax sp. Root473 Isolate Unclassified
23 2643221717 Acidovorax sp. Root267 Isolate Unclassified
24 2721755523 Delftia sp. HK171 Isolate Unclassified
25 2738541277 Variovorax sp. GV051 Isolate Unclassified
26 2738541307 Variovorax sp. GV008 Isolate Unclassified
27 2738543012 Acidovorax sp. CF301 Isolate Unclassified
28 2738543013 Variovorax sp. BT01 Isolate Unclassified
29 2738543019 Variovorax sp. GV040 Isolate Unclassified
30 2816332133 Acidovorax radicis 2721A Isolate Unclassified
31 2818991446 Variovorax sp. 1180 Isolate Unclassified
32 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
35 2842677519 Variovorax sp. R-72495 Isolate Unclassified
36 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
37 2842733646 Variovorax sp. R-72446 Isolate Unclassified
38 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
39 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
40 2885198086 Variovorax sp. 679 Isolate Unclassified
41 2885211737 Variovorax sp. 553 Isolate Unclassified
42 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
43 2899924645 Variovorax sp. 369 Isolate Unclassified
44 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
45 2904456579 Variovorax sp. 2002 Isolate Unclassified
46 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
47 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
48 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
49 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
50 2928037797 Variovorax sp. 1126 Isolate Unclassified
51 2928044640 Variovorax sp. 1128 Isolate Unclassified
52 2928051484 Variovorax sp. 1133 Isolate Unclassified
53 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
54 2928070936 Variovorax gossypii 1167 Isolate Unclassified
55 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
56 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
57 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
58 2929520902 Variovorax beijingensis 502 Isolate Unclassified
59 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
60 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
61 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
62 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
63 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
64 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
65 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
66 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
67 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
68 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
69 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
70 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
71 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
72 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
73 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
74 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
75 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
76 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
77 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
78 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
79 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
80 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
81 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
82 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
83 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
84 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
85 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
86 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
87 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
88 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
89 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
90 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
91 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
92 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
93 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
94 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
95 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
98 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
99 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
102 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
103 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
106 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
107 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
108 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
109 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
110 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
115 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
122 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
123 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
127 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
128 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
129 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
132 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
133 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
134 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
135 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
136 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
137 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
143 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
144 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
145 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
146 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
150 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
151 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
152 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
154 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
155 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
170 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
171 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
181 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
182 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
186 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
187 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
188 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
248 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
252 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
257 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
258 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
259 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
260 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
261 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
262 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
263 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
269 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
270 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
273 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
274 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
277 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
278 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
279 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
280 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
281 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
282 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
292 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
293 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
294 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
295 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
296 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
297 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
298 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
299 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
300 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
301 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
302 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
303 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
304 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
305 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
306 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
307 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
308 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
309 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
310 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
314 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
315 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
327 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
332 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
374 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
375 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
389 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
394 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
395 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
396 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
397 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
398 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
399 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
400 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
401 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
402 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
403 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
404 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.5
Metatranscriptomes 0.14
Isolates 9.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.05
Nodule 0.84
Rhizoplane 3.21
Rhizosphere 53.07
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000005 3300002704 Bacteria 261712
2 JGI25156J39149_1000006 3300002705 Bacteria 261778
3 JGI25156J39149_1000580 3300002705 Bacteria 20874
4 JGI25154J39366_1000015 3300002738 Bacteria 261778
5 JGI25154J39366_1002077 3300002738 Bacteria 5690
6 JGI25157J39369_1000016 3300002741 Bacteria 192349
7 JGI25157J39369_1000018 3300002741 Bacteria 177410
8 JGI25152J39213_1004936 3300002773 Bacteria 4044
9 JGI25152J39213_1005343 3300002773 Bacteria 3774
10 JGI25152J39213_1012061 3300002773 Bacteria 1875
11 JGI25150J39212_1001393 3300002774 Bacteria 6845
12 JGI25150J39212_1002644 3300002774 Bacteria 4389
13 JGI25159J45721_1002711 3300002987 Bacteria 6575
14 JGI25159J45721_1003763 3300002987 Bacteria 5246
15 JGI25159J45721_1004844 3300002987 Bacteria 4346
16 JGI25151J46595_10001831 3300003187 Bacteria 13709
17 JGI25151J46595_10005441 3300003187 Bacteria 6579
18 JGI25151J46595_10009197 3300003187 Bacteria 4699
19 JGI25151J46595_10018787 3300003187 Bacteria 2955
20 JGI25153J46596_10005823 3300003215 Bacteria 6405
21 JGI25153J46596_10011446 3300003215 Bacteria 3919
22 JGI25153J46596_10014727 3300003215 Bacteria 3232
23 rootH1_10012602 3300003316 Bacteria 4934
24 rootH2_10053692 3300003320 Bacteria 3877
25 rootL2_10006461 3300003322 Bacteria 12808
26 JGI26128J50194_1000266 3300003347 Bacteria 2615
27 JGI25160J50197_1000689 3300003354 Bacteria 18663
28 JGI25160J50197_1010564 3300003354 Bacteria 3327
29 JGI25160J50197_1011159 3300003354 Bacteria 3203
30 JGI25161J50226_1000008 3300003374 Bacteria 239245
31 JGI25161J50226_1004628 3300003374 Bacteria 2834
32 JGI25161J50226_1006980 3300003374 Bacteria 1966
33 Ga0006562J51391_1006645 3300003578 Bacteria 9473
34 Ga0055539_1001838 3300003752 Bacteria 3587
35 Ga0055535_1000087 3300003761 Bacteria 102655
36 Ga0055535_1000341 3300003761 Bacteria 46538
37 Ga0055542_1000369 3300003762 Bacteria 46540
38 Ga0055529_1000139 3300003763 Bacteria 102943
39 Ga0055526_1002276 3300003771 Bacteria 13116
40 Ga0055526_1006373 3300003771 Bacteria 6416
41 Ga0055526_1007426 3300003771 Bacteria 5697
42 Ga0055526_1014054 3300003771 Bacteria 3327
43 Ga0055526_1014663 3300003771 Bacteria 3204
44 Ga0055537_1000280 3300003773 Bacteria 36696
45 Ga0055537_1000383 3300003773 Bacteria 29757
46 Ga0055537_1005896 3300003773 Bacteria 3203
47 Ga0055537_1011949 3300003773 Bacteria 1724
48 Ga0055524_1000079 3300003775 Bacteria 120203
49 Ga0055524_1000107 3300003775 Bacteria 100962
50 Ga0055524_1012124 3300003775 Bacteria 3327
51 Ga0055524_1012783 3300003775 Bacteria 3204
52 Ga0055536_1004671 3300003781 Bacteria 6907
53 Ga0055536_1007647 3300003781 Bacteria 4794
54 Ga0055536_1009113 3300003781 Bacteria 4161
55 Ga0055534_1000064 3300003784 Bacteria 81486
56 Ga0055534_1000791 3300003784 Bacteria 14727
57 Ga0055534_1004009 3300003784 Bacteria 4416
58 Ga0055534_1006789 3300003784 Bacteria 2827
59 Ga0055534_1007865 3300003784 Bacteria 2482
60 Ga0055528_1001653 3300003790 Bacteria 13080
61 Ga0055528_1002261 3300003790 Bacteria 10462
62 Ga0055528_1012925 3300003790 Bacteria 3203
63 Ga0055530_10000121 3300003791 Bacteria 67516
64 Ga0055530_10001020 3300003791 Bacteria 22404
65 Ga0055530_10004609 3300003791 Bacteria 7017
66 Ga0055530_10016452 3300003791 Bacteria 2362
67 Ga0055540_1000021 3300003792 Bacteria 208733
68 Ga0055540_1001724 3300003792 Bacteria 12582
69 Ga0055540_1002881 3300003792 Bacteria 8726
70 Ga0055531_10000774 3300003794 Bacteria 26616
71 Ga0055531_10001576 3300003794 Bacteria 16671
72 Ga0055531_10001925 3300003794 Bacteria 14520
73 Ga0055543_1000259 3300004625 Bacteria 39835
74 Ga0055543_1003413 3300004625 Bacteria 4711
75 Ga0065165_1006821 3300005262 Bacteria 5825
76 Ga0065165_1008660 3300005262 Bacteria 4713
77 Ga0065714_10005593 3300005288 Bacteria 4577
78 Ga0070658_10024241 3300005327 Bacteria 4868
79 Ga0070658_10031609 3300005327 Bacteria 4251
80 Ga0070658_10243920 3300005327 Bacteria 1523
81 Ga0070676_10022583 3300005328 Bacteria 3529
82 Ga0070683_100109166 3300005329 Bacteria 2610
83 Ga0070690_100032656 3300005330 Bacteria 3253
84 Ga0070670_100005784 3300005331 Bacteria 10450
85 Ga0070670_100154711 3300005331 Bacteria 1985
86 Ga0070670_100165460 3300005331 Bacteria 1917
87 Ga0070677_10000217 3300005333 Bacteria 19892
88 Ga0068869_100000287 3300005334 Bacteria 26922
89 Ga0070666_10156426 3300005335 Bacteria 1592
90 Ga0070680_100038104 3300005336 Bacteria 3887
91 Ga0070660_100041992 3300005339 Bacteria 3489
92 Ga0070660_100058455 3300005339 Bacteria 2989
93 Ga0070660_100120676 3300005339 Bacteria 2092
94 Ga0070661_100001326 3300005344 Bacteria 17338
95 Ga0070661_100046547 3300005344 Bacteria 3173
96 Ga0070669_100008450 3300005353 Bacteria 7349
97 Ga0070669_100024209 3300005353 Bacteria 4352
98 Ga0070669_100056027 3300005353 Bacteria 2890
99 Ga0070675_100003222 3300005354 Bacteria 12362
100 Ga0070675_100034185 3300005354 Bacteria 4124
101 Ga0070675_100173509 3300005354 Bacteria 1860
102 Ga0070671_100001257 3300005355 Bacteria 19002
103 Ga0070671_100004463 3300005355 Bacteria 11080
104 Ga0070671_100006195 3300005355 Bacteria 9531
105 Ga0070671_100063638 3300005355 Bacteria 3072
106 Ga0070671_100199313 3300005355 Bacteria 1697
107 Ga0070674_100004729 3300005356 Bacteria 7797
108 Ga0070674_100034524 3300005356 Bacteria 3379
109 Ga0070673_100007267 3300005364 Bacteria 7292
110 Ga0070673_100143009 3300005364 Bacteria 2020
111 Ga0070659_100000336 3300005366 Bacteria 36297
112 Ga0070659_100020087 3300005366 Bacteria 5072
113 Ga0070659_100025222 3300005366 Bacteria 4563
114 Ga0070667_100012223 3300005367 Bacteria 7101
115 Ga0070663_100000305 3300005455 Bacteria 25223
116 Ga0070663_100008422 3300005455 Bacteria 6343
117 Ga0070678_100002650 3300005456 Bacteria 9852
118 Ga0070662_100044278 3300005457 Bacteria 3187
119 Ga0070662_100098211 3300005457 Bacteria 2211
120 Ga0068867_100000005 3300005459 Bacteria 174097
121 Ga0068867_100063045 3300005459 Bacteria 2755
122 Ga0070679_100012199 3300005530 Bacteria 8209
123 Ga0070684_100055868 3300005535 Bacteria 3444
124 Ga0068853_100012659 3300005539 Bacteria 6868
125 Ga0068853_100031348 3300005539 Bacteria 4496
126 Ga0068853_100041702 3300005539 Bacteria 3922
127 Ga0070672_100000137 3300005543 Bacteria 38969
128 Ga0070672_100226214 3300005543 Bacteria 1570
129 Ga0070693_100058619 3300005547 Bacteria 2229
130 Ga0070665_100005645 3300005548 Bacteria 12862
131 Ga0070665_100093378 3300005548 Bacteria 3014
132 Ga0068855_100028957 3300005563 Bacteria 6625
133 Ga0068855_100046677 3300005563 Bacteria 5120
134 Ga0070664_100033391 3300005564 Bacteria 4310
135 Ga0070664_100060889 3300005564 Bacteria 3216
136 Ga0070664_100062437 3300005564 Bacteria 3176
137 Ga0070664_100228165 3300005564 Bacteria 1668
138 Ga0068857_100023278 3300005577 Bacteria 5452
139 Ga0068857_100157107 3300005577 Bacteria 2062
140 Ga0068854_100115156 3300005578 Bacteria 2033
141 Ga0068856_100003216 3300005614 Bacteria 16632
142 Ga0068856_100044244 3300005614 Bacteria 4381
143 Ga0070702_100016784 3300005615 Bacteria 3764
144 Ga0068852_100036080 3300005616 Bacteria 4133
145 Ga0068852_100038370 3300005616 Bacteria 4025
146 Ga0068852_100091838 3300005616 Bacteria 2718
147 Ga0068852_100123030 3300005616 Bacteria 2378
148 Ga0068852_100161112 3300005616 Bacteria 2095
149 Ga0068852_100191672 3300005616 Bacteria 1929
150 Ga0068859_100190764 3300005617 Bacteria 2134
151 Ga0068864_100025113 3300005618 Bacteria 5016
152 Ga0068861_100003637 3300005719 Bacteria 10276
153 Ga0068863_100073540 3300005841 Bacteria 3234
154 Ga0068863_100076670 3300005841 Bacteria 3162
155 Ga0068863_100146913 3300005841 Bacteria 2255
156 Ga0068863_100150167 3300005841 Bacteria 2229
157 Ga0068858_100021085 3300005842 Bacteria 6086
158 Ga0068860_100014733 3300005843 Bacteria 7647
159 Ga0068860_100065460 3300005843 Bacteria 3452
160 Ga0068860_100274664 3300005843 Bacteria 1645
161 Ga0068862_100033948 3300005844 Bacteria 4316
162 Ga0075365_10040741 3300006038 Bacteria 3030
163 Ga0075365_10075041 3300006038 Bacteria 2281
164 Ga0075368_10040295 3300006042 Bacteria 1834
165 Ga0075363_100023932 3300006048 Bacteria 3101
166 Ga0075363_100054333 3300006048 Bacteria 2142
167 Ga0075363_100058828 3300006048 Bacteria 2065
168 Ga0075362_10009242 3300006177 Bacteria 3803
169 Ga0075362_10009848 3300006177 Bacteria 3712
170 Ga0075362_10032338 3300006177 Bacteria 2269
171 Ga0075367_10024473 3300006178 Bacteria 3406
172 Ga0075367_10102503 3300006178 Bacteria 1751
173 Ga0075366_10001021 3300006195 Bacteria 13727
174 Ga0075366_10003258 3300006195 Bacteria 8533
175 Ga0075366_10029726 3300006195 Bacteria 3211
176 Ga0075366_10030314 3300006195 Bacteria 3180
177 Ga0075366_10033555 3300006195 Bacteria 3024
178 Ga0075366_10042171 3300006195 Bacteria 2701
179 Ga0097621_100090546 3300006237 Bacteria 2560
180 Ga0075370_10000147 3300006353 Bacteria 24004
181 Ga0075370_10003113 3300006353 Bacteria 7830
182 Ga0075370_10010078 3300006353 Bacteria 4928
183 Ga0075370_10036382 3300006353 Bacteria 2765
184 Ga0075370_10105845 3300006353 Bacteria 1631
185 Ga0068871_100094982 3300006358 Bacteria 2489
186 Ga0068871_100161165 3300006358 Bacteria 1919
187 Ga0068871_100173105 3300006358 Bacteria 1852
188 Ga0075429_100001204 3300006880 Bacteria 20973
189 Ga0097620_100190765 3300006931 Bacteria 2134
190 Ga0079104_1000025 3300006946 Bacteria 218785
191 Ga0099826_10010348 3300006948 Bacteria 6985
192 Ga0105244_10005429 3300009036 Bacteria 8477
193 Ga0105240_10012099 3300009093 Bacteria 11953
194 Ga0105245_10012538 3300009098 Bacteria 7376
195 Ga0105245_10124303 3300009098 Bacteria 2413
196 Ga0105243_10002660 3300009148 Bacteria 14842
197 Ga0105243_10024244 3300009148 Bacteria 4627
198 Ga0105243_10043399 3300009148 Bacteria 3524
199 Ga0105241_10044114 3300009174 Bacteria 3378
200 Ga0105248_10021275 3300009177 Bacteria 7188
201 Ga0105248_10286801 3300009177 Bacteria 1854
202 Ga0105238_10164108 3300009551 Bacteria 2197
203 Ga0105249_10030259 3300009553 Bacteria 4894
204 Ga0105239_10015144 3300010375 Bacteria 8546
205 Ga0157373_10004841 3300013100 Bacteria 10129
206 Ga0157371_10059889 3300013102 Bacteria 2699
207 Ga0157369_10027568 3300013105 Bacteria 6294
208 Ga0157369_10058774 3300013105 Bacteria 4147
209 Ga0157369_10081780 3300013105 Bacteria 3456
210 Ga0157369_10125342 3300013105 Bacteria 2724
211 Ga0163162_10015372 3300013306 Bacteria 7477
212 Ga0163162_10291449 3300013306 Bacteria 1764
213 Ga0163162_10307654 3300013306 Bacteria 1717
214 Ga0157372_10027798 3300013307 Bacteria 6165
215 Ga0157372_10035793 3300013307 Bacteria 5467
216 Ga0157375_10003841 3300013308 Bacteria 13033
217 Ga0157375_10030763 3300013308 Bacteria 5067
218 Ga0157375_10115965 3300013308 Bacteria 2782
219 Ga0157375_10249124 3300013308 Bacteria 1937
220 Ga0163163_10338984 3300014325 Bacteria 1558
221 Ga0157380_10030446 3300014326 Bacteria 4133
222 Ga0157380_10268146 3300014326 Bacteria 1555
223 Ga0182008_10007715 3300014497 Bacteria 5923
224 Ga0182008_10012582 3300014497 Bacteria 4466
225 Ga0157377_10000244 3300014745 Bacteria 27334
226 Ga0157379_10155785 3300014968 Bacteria 2061
227 Ga0157379_10233151 3300014968 Bacteria 1669
228 Ga0157376_10022619 3300014969 Bacteria 4904
229 Ga0182006_1009229 3300015261 Bacteria 4431
230 Ga0182007_10004000 3300015262 Bacteria 6801
231 Ga0182007_10005239 3300015262 Bacteria 5725
232 Ga0183362_10001 3300015683 Bacteria 2046624
233 Ga0163161_10000732 3300017792 Bacteria 25846
234 Ga0163161_10008119 3300017792 Bacteria 7260
235 Ga0163161_10033240 3300017792 Bacteria 3686
236 Ga0163161_10040498 3300017792 Bacteria 3347
237 Ga0163161_10041194 3300017792 Bacteria 3319
238 Ga0163161_10063515 3300017792 Bacteria 2692
239 Ga0213872_10010301 3300021361 Bacteria 4453
240 Ga0209435_100010 3300025206 Bacteria 475373
241 Ga0209147_101975 3300025229 Bacteria 6001
242 Ga0207427_100446 3300025231 Bacteria 22821
243 Ga0209258_100044 3300025242 Bacteria 376336
244 Ga0209258_100133 3300025242 Bacteria 174846
245 Ga0207425_1000144 3300025245 Bacteria 61877
246 Ga0207425_1005421 3300025245 Bacteria 3638
247 Ga0207425_1010655 3300025245 Bacteria 2228
248 Ga0209646_1000001 3300025246 Bacteria 3092932
249 Ga0209646_1000188 3300025246 Bacteria 76972
250 Ga0209026_1000001 3300025250 Bacteria 1228671
251 Ga0209026_1000033 3300025250 Bacteria 318512
252 Ga0209677_100481 3300025253 Bacteria 22719
253 Ga0209677_101298 3300025253 Bacteria 11118
254 Ga0209148_1000361 3300025254 Bacteria 57663
255 Ga0209759_1000001 3300025256 Bacteria 2799452
256 Ga0209759_1000024 3300025256 Bacteria 318512
257 Ga0209759_1015090 3300025256 Bacteria 2008
258 Ga0209129_1000033 3300025258 Bacteria 336894
259 Ga0209129_1000041 3300025258 Bacteria 307590
260 Ga0209129_1001468 3300025258 Bacteria 13112
261 Ga0209129_1005418 3300025258 Bacteria 4526
262 Ga0209565_1000088 3300025263 Bacteria 151644
263 Ga0209565_1000102 3300025263 Bacteria 127545
264 Ga0209565_1001197 3300025263 Bacteria 12378
265 Ga0209455_1000048 3300025272 Bacteria 376260
266 Ga0209673_1000064 3300025273 Bacteria 254712
267 Ga0209673_1000189 3300025273 Bacteria 123470
268 Ga0209673_1003717 3300025273 Bacteria 8739
269 Ga0209673_1014147 3300025273 Bacteria 3103
270 Ga0209130_1000186 3300025284 Bacteria 87096
271 Ga0209130_1000401 3300025284 Bacteria 47425
272 Ga0209130_1000885 3300025284 Bacteria 24420
273 Ga0209130_1004900 3300025284 Bacteria 4862
274 Ga0209675_1000036 3300025291 Bacteria 254712
275 Ga0209675_1000503 3300025291 Bacteria 29292
276 Ga0209675_1000714 3300025291 Bacteria 22673
277 Ga0209675_1001680 3300025291 Bacteria 12299
278 Ga0209675_1004727 3300025291 Bacteria 5938
279 Ga0209676_1000069 3300025292 Bacteria 312462
280 Ga0209676_1000111 3300025292 Bacteria 213411
281 Ga0209676_1001319 3300025292 Bacteria 25125
282 Ga0209676_1001516 3300025292 Bacteria 21147
283 Ga0209676_1001878 3300025292 Bacteria 17183
284 Ga0209676_1015056 3300025292 Bacteria 2869
285 Ga0209676_1029281 3300025292 Bacteria 1702
286 Ga0209025_1000424 3300025294 Bacteria 83948
287 Ga0209025_1000641 3300025294 Bacteria 61686
288 Ga0209025_1001578 3300025294 Bacteria 28809
289 Ga0209025_1015764 3300025294 Bacteria 4524
290 Ga0209025_1016017 3300025294 Bacteria 4463
291 Ga0209025_1028524 3300025294 Bacteria 2731
292 Ga0209025_1051435 3300025294 Bacteria 1637
293 Ga0209564_1000029 3300025295 Bacteria 505995
294 Ga0209564_1000070 3300025295 Bacteria 303126
295 Ga0209564_1000964 3300025295 Bacteria 36352
296 Ga0209564_1001104 3300025295 Bacteria 31907
297 Ga0209564_1001141 3300025295 Bacteria 31135
298 Ga0209758_1000027 3300025297 Bacteria 549650
299 Ga0209758_1000043 3300025297 Bacteria 402310
300 Ga0209758_1000057 3300025297 Bacteria 333111
301 Ga0209758_1010287 3300025297 Bacteria 5626
302 Ga0209050_1000023 3300025298 Bacteria 537172
303 Ga0209050_1000111 3300025298 Bacteria 213411
304 Ga0209050_1000529 3300025298 Bacteria 63410
305 Ga0209050_1000571 3300025298 Bacteria 59772
306 Ga0209256_1000003 3300025299 Bacteria 1661127
307 Ga0209256_1000011 3300025299 Bacteria 865309
308 Ga0209256_1000047 3300025299 Bacteria 314709
309 Ga0209256_1000903 3300025299 Bacteria 36352
310 Ga0207426_1000115 3300025302 Bacteria 227423
311 Ga0207426_1000153 3300025302 Bacteria 182839
312 Ga0207426_1000742 3300025302 Bacteria 36678
313 Ga0209051_1000017 3300025303 Bacteria 537172
314 Ga0209051_1000046 3300025303 Bacteria 296424
315 Ga0209051_1000344 3300025303 Bacteria 69935
316 Ga0209051_1000609 3300025303 Bacteria 41505
317 Ga0209051_1001576 3300025303 Bacteria 18805
318 Ga0209051_1004457 3300025303 Bacteria 8619
319 Ga0209051_1004714 3300025303 Bacteria 8286
320 Ga0209051_1009297 3300025303 Bacteria 5078
321 Ga0209051_1018349 3300025303 Bacteria 3097
322 Ga0209257_1000039 3300025304 Bacteria 591694
323 Ga0209257_1000041 3300025304 Bacteria 537172
324 Ga0209257_1000344 3300025304 Bacteria 96578
325 Ga0209257_1002876 3300025304 Bacteria 16025
326 Ga0209257_1010960 3300025304 Bacteria 4464
327 Ga0207656_10028124 3300025321 Bacteria 2305
328 Ga0207655_1001858 3300025728 Bacteria 18229
329 Ga0207682_10001876 3300025893 Bacteria 9581
330 Ga0207682_10064533 3300025893 Bacteria 1539
331 Ga0207680_10173246 3300025903 Bacteria 1455
332 Ga0207645_10006998 3300025907 Bacteria 8030
333 Ga0207645_10045497 3300025907 Bacteria 2805
334 Ga0207705_10015877 3300025909 Bacteria 5407
335 Ga0207705_10154284 3300025909 Bacteria 1722
336 Ga0207695_10212642 3300025913 Bacteria 1844
337 Ga0207671_10066282 3300025914 Bacteria 2687
338 Ga0207660_10065531 3300025917 Bacteria 2625
339 Ga0207662_10028972 3300025918 Bacteria 3205
340 Ga0207657_10042354 3300025919 Bacteria 4018
341 Ga0207657_10065328 3300025919 Bacteria 3102
342 Ga0207657_10102433 3300025919 Bacteria 2374
343 Ga0207649_10005941 3300025920 Bacteria 6618
344 Ga0207649_10123145 3300025920 Bacteria 1751
345 Ga0207652_10028749 3300025921 Bacteria 4640
346 Ga0207681_10012637 3300025923 Bacteria 5213
347 Ga0207681_10035178 3300025923 Bacteria 3299
348 Ga0207694_10053316 3300025924 Bacteria 3136
349 Ga0207694_10114119 3300025924 Bacteria 2151
350 Ga0207650_10000909 3300025925 Bacteria 22299
351 Ga0207650_10002632 3300025925 Bacteria 12423
352 Ga0207650_10081398 3300025925 Bacteria 2456
353 Ga0207659_10001432 3300025926 Bacteria 14215
354 Ga0207659_10052298 3300025926 Bacteria 2909
355 Ga0207644_10002037 3300025931 Bacteria 13083
356 Ga0207644_10011269 3300025931 Bacteria 5910
357 Ga0207644_10079599 3300025931 Bacteria 2418
358 Ga0207706_10018240 3300025933 Bacteria 6315
359 Ga0207706_10024971 3300025933 Bacteria 5357
360 Ga0207706_10027020 3300025933 Bacteria 5134
361 Ga0207686_10007360 3300025934 Bacteria 5925
362 Ga0207686_10093634 3300025934 Bacteria 1990
363 Ga0207709_10000459 3300025935 Bacteria 37691
364 Ga0207709_10000963 3300025935 Bacteria 21558
365 Ga0207709_10006267 3300025935 Bacteria 6682
366 Ga0207669_10001718 3300025937 Bacteria 9295
367 Ga0207691_10001983 3300025940 Bacteria 20016
368 Ga0207691_10049434 3300025940 Bacteria 3853
369 Ga0207691_10267235 3300025940 Bacteria 1473
370 Ga0207711_10003076 3300025941 Bacteria 14559
371 Ga0207711_10028938 3300025941 Bacteria 4668
372 Ga0207689_10000612 3300025942 Bacteria 34213
373 Ga0207679_10014320 3300025945 Bacteria 5211
374 Ga0207679_10039026 3300025945 Bacteria 3389
375 Ga0207667_10025652 3300025949 Bacteria 6449
376 Ga0207667_10241059 3300025949 Bacteria 1850
377 Ga0207651_10003939 3300025960 Bacteria 7368
378 Ga0207651_10013818 3300025960 Bacteria 4637
379 Ga0207651_10086738 3300025960 Bacteria 2276
380 Ga0207668_10050027 3300025972 Bacteria 2877
381 Ga0207668_10082079 3300025972 Bacteria 2341
382 Ga0207658_10013798 3300025986 Bacteria 5526
383 Ga0207658_10035048 3300025986 Bacteria 3592
384 Ga0207703_10028371 3300026035 Bacteria 4412
385 Ga0207639_10045284 3300026041 Bacteria 3312
386 Ga0207678_10001071 3300026067 Bacteria 25052
387 Ga0207678_10022647 3300026067 Bacteria 5501
388 Ga0207678_10194045 3300026067 Bacteria 1736
389 Ga0207702_10003082 3300026078 Bacteria 15468
390 Ga0207702_10030039 3300026078 Bacteria 4527
391 Ga0207702_10034860 3300026078 Bacteria 4209
392 Ga0207641_10088860 3300026088 Bacteria 2699
393 Ga0207641_10107015 3300026088 Bacteria 2473
394 Ga0207641_10112844 3300026088 Bacteria 2412
395 Ga0207641_10141180 3300026088 Bacteria 2173
396 Ga0207648_10000541 3300026089 Bacteria 42157
397 Ga0207648_10015115 3300026089 Bacteria 7105
398 Ga0207648_10085317 3300026089 Bacteria 2755
399 Ga0207676_10096598 3300026095 Bacteria 2439
400 Ga0207674_10005245 3300026116 Bacteria 15429
401 Ga0207674_10047633 3300026116 Bacteria 4392
402 Ga0207675_100026328 3300026118 Bacteria 5414
403 Ga0207683_10067726 3300026121 Bacteria 3150
404 Ga0207698_10051771 3300026142 Bacteria 3141
405 Ga0207698_10107427 3300026142 Bacteria 2330
406 Ga0209281_1000007 3300027111 Bacteria 938265
407 Ga0209973_1002196 3300027252 Bacteria 1797
408 Ga0209968_1000181 3300027526 Bacteria 10958
409 Ga0209970_1001500 3300027614 Bacteria 4064
410 Ga0209282_1015920 3300027666 Bacteria 4783
411 Ga0209966_1000013 3300027695 Bacteria 83121
412 Ga0209974_10005911 3300027876 Bacteria 4290
413 Ga0268266_10113816 3300028379 Bacteria 2400
414 Ga0268264_10004874 3300028381 Bacteria 11372
415 Ga0268264_10048502 3300028381 Bacteria 3533
416 Ga0265334_10034907 3300028573 Bacteria 1994
417 Ga0265336_10000293 3300028666 Bacteria 34148
418 Ga0307515_10001017 3300028794 Bacteria 64033
419 Ga0307515_10001540 3300028794 Bacteria 51551
420 Ga0307515_10002116 3300028794 Bacteria 43530
421 Ga0307515_10004876 3300028794 Bacteria 27436
422 Ga0307515_10005604 3300028794 Bacteria 25377
423 Ga0307515_10007089 3300028794 Bacteria 22262
424 Ga0265324_10004430 3300029957 Bacteria 6354
425 Ga0307512_10029293 3300030522 Bacteria 4814
426 Ga0316177_1172157 3300030731 Bacteria 2558
427 Ga0316180_1073943 3300030736 Bacteria 1761
428 Ga0316182_1299437 3300030745 Bacteria 3484
429 Ga0265330_10000108 3300031235 Bacteria 69468
430 Ga0265332_10000020 3300031238 Bacteria 219119
431 Ga0265332_10000072 3300031238 Bacteria 86029
432 Ga0265327_10004992 3300031251 Bacteria 11381
433 Ga0307513_10000004 3300031456 Bacteria 558931
434 Ga0307513_10000015 3300031456 Bacteria 296183
435 Ga0307513_10012208 3300031456 Bacteria 10620
436 Ga0307513_10014115 3300031456 Bacteria 9776
437 Ga0307513_10086262 3300031456 Bacteria 3219
438 Ga0307408_100019661 3300031548 Bacteria 4549
439 Ga0307508_10000140 3300031616 Bacteria 85941
440 Ga0307514_10000864 3300031649 Bacteria 48175
441 Ga0307514_10000906 3300031649 Bacteria 45659
442 Ga0307514_10058457 3300031649 Bacteria 2949
443 Ga0265314_10000874 3300031711 Bacteria 35850
444 Ga0307516_10002516 3300031730 Bacteria 24408
445 Ga0307516_10002985 3300031730 Bacteria 22095
446 Ga0307516_10173207 3300031730 Bacteria 1897
447 Ga0307405_10010625 3300031731 Bacteria 4783
448 Ga0307410_10008468 3300031852 Bacteria 5704
449 Ga0307406_10004684 3300031901 Bacteria 7454
450 Ga0307406_10012613 3300031901 Bacteria 4820
451 Ga0307406_10024354 3300031901 Bacteria 3615
452 Ga0307412_10079086 3300031911 Bacteria 2267
453 Ga0307409_100220645 3300031995 Bacteria 1711
454 Ga0307416_100089342 3300032002 Bacteria 2637
455 Ga0307411_10009715 3300032005 Bacteria 5080
456 Ga0307411_10056464 3300032005 Bacteria 2588
457 Ga0307507_10057228 3300033179 Bacteria 3674
458 Ga0307510_10001745 3300033180 Bacteria 24235
459 Ga0373934_0023631 3300035086 Bacteria 2375
460 Ga0373937_0065202 3300036401 Bacteria 3352
461 Ga0395899_0009628 3300037312 Bacteria 7415
462 Ga0395900_0048025 3300037418 Bacteria 4396
463 Ga0395898_0006475 3300037466 Bacteria 12504
464 Ga0395898_0090952 3300037466 Bacteria 2936
465 Ga0395905_0000290 3300037471 Bacteria 73649
466 Ga0395905_0005564 3300037471 Bacteria 12847
467 Ga0395905_0007643 3300037471 Bacteria 10728
468 Ga0395905_0018855 3300037471 Bacteria 6544
469 Ga0395905_0022523 3300037471 Bacteria 5958
470 Ga0395905_0043408 3300037471 Bacteria 4218
471 Ga0395905_0209480 3300037471 Bacteria 1826
472 Ga0395905_0287238 3300037471 Bacteria 1532
473 Ga0395901_0002361 3300038443 Bacteria 19197
474 Ga0395901_0082509 3300038443 Bacteria 3359
475 Ga0436361_0348943 3300039447 Bacteria 40158
476 Ga0436363_0017561 3300039450 Bacteria 2248
477 Ga0439465_0006250 3300041413 Bacteria 3784
478 Ga0439445_0001699 3300042004 Bacteria 4834
479 Ga0439449_0000699 3300042007 Bacteria 12822
480 Ga0439449_0006001 3300042007 Bacteria 4639
481 Ga0439452_005680 3300042010 Bacteria 3991
482 Ga0439457_006531 3300042014 Bacteria 2854
483 Ga0439462_0002448 3300042015 Bacteria 4314
484 Ga0439462_0003230 3300042015 Bacteria 3889
485 Ga0450911_000854 3300042115 Bacteria 8313
486 Ga0450919_000116 3300042121 Bacteria 7995
487 Ga0450897_000191 3300042128 Bacteria 3058
488 Ga0450899_003007 3300042135 Bacteria 1817
489 Ga0450900_005977 3300042136 Bacteria 1457
490 Ga0450906_003885 3300042145 Bacteria 3170
491 Ga0450910_000924 3300042147 Bacteria 3553
492 Ga0439434_0002935 3300042435 Bacteria 4982
493 Ga0439434_0003276 3300042435 Bacteria 4754
494 Ga0450918_000016 3300042531 Bacteria 34446
495 Ga0451577_0000825 3300042876 Bacteria 46324
496 Ga0451577_0005521 3300042876 Bacteria 12911
497 Ga0451577_0010087 3300042876 Bacteria 9051
498 Ga0451577_0015023 3300042876 Bacteria 7204
499 Ga0451577_0023550 3300042876 Bacteria 5614
500 Ga0466969_0040205 3300044656 Bacteria 2343
501 Ga0466972_0052631 3300044658 Bacteria 1961
502 Ga0453683_0001803 3300044673 Bacteria 17691
503 Ga0466965_0030575 3300044683 Bacteria 2624
504 Ga0466965_0042945 3300044683 Bacteria 2231
505 Ga0466966_0004262 3300044684 Bacteria 9434
506 Ga0466966_0031299 3300044684 Bacteria 3451
507 Ga0466963_0074533 3300044694 Bacteria 2289
508 Ga0453684_0002253 3300044712 Bacteria 47789
509 Ga0453684_0019186 3300044712 Bacteria 10426
510 Ga0453684_0330143 3300044712 Bacteria 1725
511 Ga0466971_0014151 3300044719 Bacteria 3507
512 Ga0466970_0018325 3300044765 Bacteria 3623
513 Ga0466957_0057058 3300044842 Bacteria 2389
514 Ga0466959_0131630 3300045049 Bacteria 1772
515 Ga0451576_0009978 3300045051 Bacteria 10949
516 Ga0451576_0015926 3300045051 Bacteria 8312
517 Ga0451576_0261999 3300045051 Bacteria 1807
518 Ga0495638_0036450 3300046460 Bacteria 3134
519 Ga0495639_0006660 3300046475 Bacteria 4970
520 Ga0495583_0002724 3300046506 Bacteria 14632
521 Ga0495606_0003052 3300046507 Bacteria 18248
522 Ga0495610_0078948 3300046512 Bacteria 1516
523 Ga0495616_0011837 3300046513 Bacteria 4976
524 Ga0495631_0010173 3300046518 Bacteria 4666
525 Ga0495632_0057832 3300046519 Bacteria 1892
526 Ga0495637_0006481 3300046520 Bacteria 5872
527 Ga0495666_0065639 3300046526 Bacteria 1731
528 Ga0495642_0003027 3300046528 Bacteria 6696
529 Ga0495621_0003480 3300046539 Bacteria 4347
530 Ga0495621_0013490 3300046539 Bacteria 2569
531 Ga0495597_0003090 3300046542 Bacteria 10018
532 Ga0495633_0006679 3300046558 Bacteria 6794
533 Ga0495656_0000042 3300046615 Bacteria 62167
534 Ga0495656_0025279 3300046615 Bacteria 2353
535 Ga0495625_0000292 3300046660 Bacteria 77369
536 Ga0495635_0161516 3300046663 Bacteria 1525
537 Ga0495635_0169570 3300046663 Bacteria 1485
538 Ga0495588_0014266 3300046674 Bacteria 3800
539 Ga0495647_0035008 3300046681 Bacteria 1884
540 Ga0495647_0053416 3300046681 Bacteria 1576
541 Ga0495658_0006741 3300046683 Bacteria 5649
542 Ga0495658_0036561 3300046683 Bacteria 2710
543 Ga0495649_0004838 3300046694 Bacteria 8711
544 Ga0495589_0014386 3300046794 Bacteria 4076
545 Ga0495600_0049804 3300046809 Bacteria 2733
546 Ga0495676_0033248 3300047321 Bacteria 4346
547 Ga0495593_0016559 3300047673 Bacteria 4156
548 Ga0495593_0051717 3300047673 Bacteria 2173
549 Ga0496100_0008667 3300048903 Bacteria 5678
550 Ga0496101_0014829 3300048904 Bacteria 5243
551 Ga0496101_0018801 3300048904 Bacteria 4705
552 Ga0496102_0007033 3300048905 Bacteria 9607
553 Ga0496102_0008548 3300048905 Bacteria 8779
554 Ga0496103_0048814 3300048906 Bacteria 2616
555 Ga0496104_0012951 3300048907 Bacteria 7509
556 Ga0496104_0055347 3300048907 Bacteria 3751
557 Ga0496105_0026935 3300048908 Bacteria 4691
558 Ga0496105_0148611 3300048908 Bacteria 1927
559 Ga0496105_0237734 3300048908 Bacteria 1479
560 Ga0496106_0006571 3300048909 Bacteria 8609
561 Ga0496106_0114856 3300048909 Bacteria 2099
562 Ga0496107_0112337 3300048910 Bacteria 2003
563 Ga0496108_0045772 3300048911 Bacteria 3654
564 Ga0496110_0047354 3300048913 Bacteria 3764
565 Ga0496111_0062504 3300048914 Bacteria 2700
566 Ga0496112_0172800 3300048915 Bacteria 2126
567 Ga0496114_0018269 3300048917 Bacteria 5668
568 Ga0496114_0069210 3300048917 Bacteria 2964
569 Ga0496116_0141726 3300048919 Bacteria 1351
570 Ga0496117_0003590 3300048920 Bacteria 17899
571 Ga0496117_0070880 3300048920 Bacteria 2338
572 Ga0496118_0029380 3300048921 Bacteria 4610
573 Ga0496118_0040534 3300048921 Bacteria 3701
574 Ga0496118_0147820 3300048921 Bacteria 1476
575 Ga0496121_0002132 3300048924 Bacteria 31087
576 Ga0496121_0024041 3300048924 Bacteria 5840
577 Ga0496122_0026483 3300048925 Bacteria 4996
578 Ga0496123_0065375 3300048926 Bacteria 2312
579 Ga0496124_0040134 3300048927 Bacteria 4051
580 Ga0496124_0050534 3300048927 Bacteria 3542
581 Ga0496124_0063507 3300048927 Bacteria 3085
582 Ga0496124_0101627 3300048927 Bacteria 2329
583 Ga0496125_0004737 3300048928 Bacteria 15506
584 Ga0496125_0011749 3300048928 Bacteria 8728
585 Ga0496125_0031631 3300048928 Bacteria 4713
586 Ga0496125_0033201 3300048928 Bacteria 4572
587 Ga0496126_0041394 3300048929 Bacteria 4264
588 Ga0496126_0251997 3300048929 Bacteria 1471
589 Ga0501031_0016788 3300049568 Bacteria 4755
590 Ga0501034_0003465 3300049571 Bacteria 17957
591 Ga0501036_0054150 3300049572 Bacteria 3398
592 Ga0501043_0000108 3300049579 Bacteria 77329
593 Ga0501043_0158691 3300049579 Bacteria 1768
594 Ga0501046_0000050 3300049580 Bacteria 134922
595 Ga0501047_0000012 3300049581 Bacteria 368824
596 Ga0501047_0034461 3300049581 Bacteria 4888
597 Ga0501048_0001920 3300049582 Bacteria 15783
598 Ga0501198_000004 3300049649 Bacteria 175146
599 Ga0501222_000038 3300049662 Bacteria 51424
600 Ga0501225_0005517 3300049705 Bacteria 3709
601 Ga0501080_0029262 3300049742 Bacteria 5127
602 Ga0501262_000089 3300049759 Bacteria 11464
603 Ga0501035_0027582 3300049822 Bacteria 5190
604 Ga0501044_0125424 3300049823 Bacteria 2565
605 nmdc:mga03683_30727_c1 3300050489 Bacteria 2150
606 nmdc:mga03683_6077_c1 3300050489 Bacteria 4117
607 nmdc:mga03n38_11395_c1 3300050490 Bacteria 3311
608 nmdc:mga0yw44_47317_c1 3300050492 Bacteria 2588
609 nmdc:mga0yw44_87248_c1 3300050492 Bacteria 1967
610 nmdc:mga0k408_12821_c1 3300050493 Bacteria 4587
611 nmdc:mga0k408_19542_c1 3300050493 Bacteria 1648
612 nmdc:mga0k408_31195_c1 3300050493 Bacteria 3042
613 nmdc:mga0k408_66695_c1 3300050493 Bacteria 2097
614 nmdc:mga0k408_83979_c1 3300050493 Bacteria 1868
615 nmdc:mga06z11_15487_c1 3300050494 Bacteria 3405
616 nmdc:mga07m45_18698_c1 3300050496 Bacteria 3747
617 nmdc:mga07m45_2629_c1 3300050496 Bacteria 8453
618 nmdc:mga07m45_43_c1 3300050496 Bacteria 58364
619 nmdc:mga07m45_6037_c1 3300050496 Bacteria 6097
620 nmdc:mga07m45_8516_c1 3300050496 Bacteria 5276
621 nmdc:mga07m45_96992_c1 3300050496 Bacteria 1692
622 nmdc:mga09592_38208_c1 3300050508 Bacteria 4029
623 Ga0495601_0005518 3300053077 Bacteria 7380
624 Ga0500635_0000083 3300053080 Bacteria 61980
625 Ga0500578_0001187 3300053086 Bacteria 27526
626 Ga0500643_005807 3300053087 Bacteria 5260
627 Ga0500644_0008921 3300053088 Bacteria 2663
628 Ga0500651_0000060 3300053093 Bacteria 71500
629 Ga0500571_000072 3300053110 Bacteria 31639
630 Ga0500592_005993 3300053116 Bacteria 1934
631 Ga0500593_000719 3300053117 Bacteria 12590
632 Ga0500607_000307 3300053121 Bacteria 46367
633 Ga0500608_016465 3300053122 Bacteria 3340
634 Ga0500628_006231 3300053129 Bacteria 2010
635 Ga0500652_005313 3300053131 Bacteria 4045
636 Ga0500655_000073 3300053133 Bacteria 26840
637 Ga0500658_0000402 3300053134 Bacteria 18742
638 Ga0500658_0005354 3300053134 Bacteria 4774
639 Ga0500568_0000566 3300053139 Bacteria 27162
640 Ga0500574_022373 3300053141 Bacteria 1613
641 Ga0500590_043658 3300053148 Bacteria 2298
642 Ga0500616_0011263 3300053153 Bacteria 5296
643 Ga0500622_0005574 3300053156 Bacteria 7513
644 Ga0500627_0000611 3300053158 Bacteria 9530
645 Ga0500634_0056048 3300053161 Bacteria 2106
646 Ga0500636_0015791 3300053177 Bacteria 4450
647 Ga0500636_0021077 3300053177 Bacteria 3860
648 Ga0500645_000551 3300053730 Bacteria 24776
649 Ga0466962_0042682 3300061719 Bacteria 2170

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100173509 Ga0070675_1001735092 360
2 3300014325 Ga0163163_10338984 Ga0163163_103389842 360
3 3300025960 Ga0207651_10013818 Ga0207651_100138185 360
4 3300046519 Ga0495632_0057832 Ga0495632_0057832_739_1881 372
5 3300046663 Ga0495635_0169570 Ga0495635_0169570_22_1152 374
6 3300053141 Ga0500574_022373 Ga0500574_022373_469_1599 374
7 3300005564 Ga0070664_100062437 Ga0070664_1000624372 376
8 3300025945 Ga0207679_10039026 Ga0207679_100390263 376
9 3300050493 nmdc:mga0k408_19542_c1 nmdc:mga0k408_19542_c1_115_1365 390
10 3300005334 Ga0068869_100000287 Ga0068869_1000002874 394
11 3300005339 Ga0070660_100120676 Ga0070660_1001206762 394
12 3300005353 Ga0070669_100056027 Ga0070669_1000560273 394
13 3300005354 Ga0070675_100034185 Ga0070675_1000341853 394
14 3300005455 Ga0070663_100008422 Ga0070663_1000084223 394
15 3300005457 Ga0070662_100044278 Ga0070662_1000442783 394
16 3300005539 Ga0068853_100012659 Ga0068853_1000126596 394
17 3300005614 Ga0068856_100044244 Ga0068856_1000442444 394
18 3300005615 Ga0070702_100016784 Ga0070702_1000167844 394
19 3300005616 Ga0068852_100036080 Ga0068852_1000360804 394
20 3300005719 Ga0068861_100003637 Ga0068861_10000363711 394
21 3300005844 Ga0068862_100033948 Ga0068862_1000339483 394
22 3300006358 Ga0068871_100161165 Ga0068871_1001611652 394
23 3300009098 Ga0105245_10012538 Ga0105245_100125386 394
24 3300013105 Ga0157369_10081780 Ga0157369_100817804 394
25 3300013308 Ga0157375_10115965 Ga0157375_101159653 394
26 3300014969 Ga0157376_10022619 Ga0157376_100226194 394
27 3300017792 Ga0163161_10040498 Ga0163161_100404984 394
28 3300025923 Ga0207681_10012637 Ga0207681_100126373 394
29 3300025926 Ga0207659_10052298 Ga0207659_100522983 394
30 3300025933 Ga0207706_10018240 Ga0207706_100182404 394
31 3300025941 Ga0207711_10003076 Ga0207711_1000307611 394
32 3300025942 Ga0207689_10000612 Ga0207689_1000061216 394
33 3300025972 Ga0207668_10050027 Ga0207668_100500273 394
34 3300026067 Ga0207678_10022647 Ga0207678_100226474 394
35 3300026118 Ga0207675_100026328 Ga0207675_1000263284 394
36 3300039450 Ga0436363_0017561 Ga0436363_0017561_607_1887 394
37 3300048908 Ga0496105_0148611 Ga0496105_0148611_194_1477 394
38 3300048909 Ga0496106_0114856 Ga0496106_0114856_559_1842 394
39 3300009174 Ga0105241_10044114 Ga0105241_100441142 395
40 3300013102 Ga0157371_10059889 Ga0157371_100598892 395
41 3300025940 Ga0207691_10049434 Ga0207691_100494344 395
42 3300026088 Ga0207641_10088860 Ga0207641_100888602 395
43 3300045051 Ga0451576_0261999 Ga0451576_0261999_162_1490 395
44 3300048915 Ga0496112_0172800 Ga0496112_0172800_810_2096 395
45 3300005547 Ga0070693_100058619 Ga0070693_1000586192 396
46 3300005578 Ga0068854_100115156 Ga0068854_1001151562 396
47 3300013105 Ga0157369_10125342 Ga0157369_101253422 396
48 3300013105 Ga0157369_10058774 Ga0157369_100587742 397
49 3300048926 Ga0496123_0065375 Ga0496123_0065375_1064_2278 400
50 3300005841 Ga0068863_100076670 Ga0068863_1000766702 401
51 3300009177 Ga0105248_10286801 Ga0105248_102868012 401
52 3300013308 Ga0157375_10003841 Ga0157375_100038418 401
53 3300025918 Ga0207662_10028972 Ga0207662_100289722 401
54 3300026088 Ga0207641_10141180 Ga0207641_101411802 401
55 3300042136 Ga0450900_005977 Ga0450900_005977_35_1252 401
56 3300002705 JGI25156J39149_1000580 JGI25156J39149_10005806 402
57 3300002738 JGI25154J39366_1002077 JGI25154J39366_10020772 402
58 3300002741 JGI25157J39369_1000018 JGI25157J39369_100001852 402
59 3300003752 Ga0055539_1001838 Ga0055539_10018384 402
60 3300005327 Ga0070658_10031609 Ga0070658_100316092 402
61 3300005329 Ga0070683_100109166 Ga0070683_1001091663 402
62 3300005339 Ga0070660_100058455 Ga0070660_1000584554 402
63 3300005344 Ga0070661_100046547 Ga0070661_1000465473 402
64 3300005366 Ga0070659_100020087 Ga0070659_1000200874 402
65 3300005535 Ga0070684_100055868 Ga0070684_1000558681 402
66 3300005539 Ga0068853_100041702 Ga0068853_1000417022 402
67 3300005564 Ga0070664_100060889 Ga0070664_1000608893 402
68 3300005577 Ga0068857_100023278 Ga0068857_1000232783 402
69 3300005577 Ga0068857_100157107 Ga0068857_1001571072 402
70 3300005614 Ga0068856_100003216 Ga0068856_1000032163 402
71 3300005616 Ga0068852_100038370 Ga0068852_1000383701 402
72 3300010375 Ga0105239_10015144 Ga0105239_100151446 402
73 3300013100 Ga0157373_10004841 Ga0157373_100048417 402
74 3300013307 Ga0157372_10027798 Ga0157372_100277984 402
75 3300013307 Ga0157372_10035793 Ga0157372_100357934 402
76 3300025246 Ga0209646_1000188 Ga0209646_100018851 402
77 3300025250 Ga0209026_1000033 Ga0209026_1000033243 402
78 3300025253 Ga0209677_100481 Ga0209677_10048114 402
79 3300025256 Ga0209759_1000024 Ga0209759_1000024243 402
80 3300025909 Ga0207705_10154284 Ga0207705_101542842 402
81 3300025919 Ga0207657_10065328 Ga0207657_100653282 402
82 3300025920 Ga0207649_10005941 Ga0207649_100059414 402
83 3300025924 Ga0207694_10114119 Ga0207694_101141192 402
84 3300025945 Ga0207679_10014320 Ga0207679_100143204 402
85 3300025949 Ga0207667_10241059 Ga0207667_102410591 402
86 3300026041 Ga0207639_10045284 Ga0207639_100452842 402
87 3300026078 Ga0207702_10003082 Ga0207702_1000308214 402
88 3300026078 Ga0207702_10030039 Ga0207702_100300393 402
89 3300026116 Ga0207674_10005245 Ga0207674_1000524516 402
90 3300026116 Ga0207674_10047633 Ga0207674_100476333 402
91 3300005367 Ga0070667_100012223 Ga0070667_1000122233 403
92 3300005617 Ga0068859_100190764 Ga0068859_1001907642 403
93 3300005842 Ga0068858_100021085 Ga0068858_1000210857 403
94 3300005843 Ga0068860_100014733 Ga0068860_1000147336 403
95 3300006931 Ga0097620_100190765 Ga0097620_1001907652 403
96 3300013308 Ga0157375_10030763 Ga0157375_100307634 403
97 3300014326 Ga0157380_10030446 Ga0157380_100304462 403
98 3300014968 Ga0157379_10155785 Ga0157379_101557852 403
99 3300025909 Ga0207705_10015877 Ga0207705_100158771 403
100 3300025986 Ga0207658_10013798 Ga0207658_100137985 403
101 3300026035 Ga0207703_10028371 Ga0207703_100283712 403
102 3300028381 Ga0268264_10004874 Ga0268264_1000487410 403
103 3300031649 Ga0307514_10000906 Ga0307514_1000090623 406
104 3300042876 Ga0451577_0005521 Ga0451577_0005521_9274_10554 407
105 3300005364 Ga0070673_100143009 Ga0070673_1001430092 410
106 3300025925 Ga0207650_10081398 Ga0207650_100813982 410
107 3300035086 Ga0373934_0023631 Ga0373934_0023631_618_2051 410
108 3300028794 Ga0307515_10007089 Ga0307515_100070895 411
109 3300025294 Ga0209025_1016017 Ga0209025_10160173 413
110 3300048929 Ga0496126_0251997 Ga0496126_0251997_39_1292 413
111 3300046460 Ga0495638_0036450 Ga0495638_0036450_1083_2345 415
112 3300005336 Ga0070680_100038104 Ga0070680_1000381044 417
113 3300005530 Ga0070679_100012199 Ga0070679_1000121992 417
114 3300025917 Ga0207660_10065531 Ga0207660_100655313 417
115 3300025921 Ga0207652_10028749 Ga0207652_100287493 417
116 3300044656 Ga0466969_0040205 Ga0466969_0040205_893_2203 418
117 3300044683 Ga0466965_0030575 Ga0466965_0030575_160_1470 418
118 3300044684 Ga0466966_0004262 Ga0466966_0004262_7499_8809 418
119 3300044694 Ga0466963_0074533 Ga0466963_0074533_912_2222 418
120 3300044765 Ga0466970_0018325 Ga0466970_0018325_2155_3465 418
121 3300045049 Ga0466959_0131630 Ga0466959_0131630_74_1384 418
122 3300003316 rootH1_10012602 rootH1_100126023 419
123 3300003320 rootH2_10053692 rootH2_100536922 419
124 3300003322 rootL2_10006461 rootL2_100064614 419
125 3300044719 Ga0466971_0014151 Ga0466971_0014151_1871_3322 419
126 3300061719 Ga0466962_0042682 Ga0466962_0042682_551_2002 419
127 3300003347 JGI26128J50194_1000266 JGI26128J50194_10002663 420
128 3300003794 Ga0055531_10001576 Ga0055531_1000157610 420
129 3300025303 Ga0209051_1004714 Ga0209051_10047145 420
130 3300025304 Ga0209257_1000039 Ga0209257_1000039185 420
131 3300027526 Ga0209968_1000181 Ga0209968_10001815 420
132 3300027695 Ga0209966_1000013 Ga0209966_100001332 420
133 3300053080 Ga0500635_0000083 Ga0500635_0000083_25396_26706 420
134 3300017792 Ga0163161_10000732 Ga0163161_100007329 423
135 3300042876 Ga0451577_0023550 Ga0451577_0023550_2789_4066 423
136 3300005327 Ga0070658_10243920 Ga0070658_102439201 424
137 3300005330 Ga0070690_100032656 Ga0070690_1000326561 424
138 3300005331 Ga0070670_100154711 Ga0070670_1001547112 424
139 3300005331 Ga0070670_100165460 Ga0070670_1001654601 424
140 3300005355 Ga0070671_100001257 Ga0070671_1000012574 424
141 3300005355 Ga0070671_100063638 Ga0070671_1000636383 424
142 3300005355 Ga0070671_100199313 Ga0070671_1001993131 424
143 3300005457 Ga0070662_100098211 Ga0070662_1000982112 424
144 3300005543 Ga0070672_100226214 Ga0070672_1002262142 424
145 3300005616 Ga0068852_100123030 Ga0068852_1001230302 424
146 3300005616 Ga0068852_100191672 Ga0068852_1001916722 424
147 3300005841 Ga0068863_100146913 Ga0068863_1001469132 424
148 3300005843 Ga0068860_100065460 Ga0068860_1000654602 424
149 3300005843 Ga0068860_100274664 Ga0068860_1002746642 424
150 3300006353 Ga0075370_10003113 Ga0075370_100031132 424
151 3300006358 Ga0068871_100094982 Ga0068871_1000949822 424
152 3300009177 Ga0105248_10021275 Ga0105248_100212756 424
153 3300009553 Ga0105249_10030259 Ga0105249_100302595 424
154 3300014326 Ga0157380_10268146 Ga0157380_102681462 424
155 3300025907 Ga0207645_10045497 Ga0207645_100454973 424
156 3300025925 Ga0207650_10002632 Ga0207650_100026327 424
157 3300025931 Ga0207644_10011269 Ga0207644_100112694 424
158 3300025933 Ga0207706_10024971 Ga0207706_100249714 424
159 3300025940 Ga0207691_10267235 Ga0207691_102672352 424
160 3300025941 Ga0207711_10028938 Ga0207711_100289383 424
161 3300026088 Ga0207641_10112844 Ga0207641_101128442 424
162 3300026121 Ga0207683_10067726 Ga0207683_100677262 424
163 3300026142 Ga0207698_10051771 Ga0207698_100517712 424
164 3300028381 Ga0268264_10048502 Ga0268264_100485024 424
165 3300028794 Ga0307515_10002116 Ga0307515_1000211623 424
166 3300030745 Ga0316182_1299437 Ga0316182_12994375 424
167 3300031730 Ga0307516_10002516 Ga0307516_100025167 424
168 3300036401 Ga0373937_0065202 Ga0373937_0065202_493_1779 424
169 3300037471 Ga0395905_0022523 Ga0395905_0022523_563_1849 424
170 3300042876 Ga0451577_0015023 Ga0451577_0015023_182_1504 424
171 3300046681 Ga0495647_0035008 Ga0495647_0035008_102_1388 424
172 3300046681 Ga0495647_0053416 Ga0495647_0053416_185_1477 424
173 3300048907 Ga0496104_0055347 Ga0496104_0055347_436_1728 424
174 3300050496 nmdc:mga07m45_8516_c1 nmdc:mga07m45_8516_c1_471_1757 424
175 3300053077 Ga0495601_0005518 Ga0495601_0005518_5988_7274 424
176 3300006237 Ga0097621_100090546 Ga0097621_1000905462 425
177 3300025893 Ga0207682_10064533 Ga0207682_100645331 425
178 3300031730 Ga0307516_10002985 Ga0307516_100029857 425
179 3300044658 Ga0466972_0052631 Ga0466972_0052631_303_1601 425
180 iso_pu_bacteria 2585428057 2587726337 425
181 iso_pu_bacteria 2585428058 2587731767 425
182 iso_pu_bacteria 2588253510 2588292273 425
183 iso_pu_bacteria 2643221592 2643970874 425
184 iso_pu_bacteria 2643221625 2644138876 425
185 iso_pu_bacteria 2643221644 2644245421 425
186 iso_pu_bacteria 2643221648 2644273893 425
187 iso_pu_bacteria 2738543013 2739248489 425
188 iso_pu_bacteria 2831265667 2831268345 425
189 iso_pu_bacteria 2838054893 2838060526 425
190 iso_pu_bacteria 2839138175 2839138324 425
191 iso_pu_bacteria 2842677519 2842679202 425
192 iso_pu_bacteria 2842733646 2842735415 425
193 iso_pu_bacteria 2881101125 2881103768 425
194 iso_pu_bacteria 2885192300 2885193471 425
195 iso_pu_bacteria 2885198086 2885198108 425
196 iso_pu_bacteria 2885211737 2885212512 425
197 iso_pu_bacteria 2899924645 2899928859 425
198 iso_pu_bacteria 2904449895 2904452185 425
199 iso_pu_bacteria 2904456579 2904458671 425
200 iso_pu_bacteria 2904541872 2904549443 425
201 iso_pu_bacteria 2919462493 2919466236 425
202 iso_pu_bacteria 2928037797 2928043205 425
203 iso_pu_bacteria 2928044640 2928051082 425
204 iso_pu_bacteria 2928051484 2928058698 425
205 iso_pu_bacteria 2928064002 2928066070 425
206 iso_pu_bacteria 2928070936 2928078094 425
207 iso_pu_bacteria 2928084124 2928087997 425
208 iso_pu_bacteria 2929160207 2929164812 425
209 iso_pu_bacteria 2929520902 2929523274 425
210 3300003187 JGI25151J46595_10009197 JGI25151J46595_100091973 426
211 3300006177 Ga0075362_10032338 Ga0075362_100323382 426
212 3300025292 Ga0209676_1015056 Ga0209676_10150562 426
213 3300028794 Ga0307515_10001540 Ga0307515_100015405 426
214 3300038443 Ga0395901_0002361 Ga0395901_0002361_15410_16717 426
215 3300046539 Ga0495621_0013490 Ga0495621_0013490_941_2242 426
216 3300048910 Ga0496107_0112337 Ga0496107_0112337_653_1954 426
217 3300048911 Ga0496108_0045772 Ga0496108_0045772_488_1789 426
218 3300048913 Ga0496110_0047354 Ga0496110_0047354_2042_3343 426
219 3300048914 Ga0496111_0062504 Ga0496111_0062504_454_1755 426
220 3300048917 Ga0496114_0069210 Ga0496114_0069210_227_1528 426
221 iso_pu_bacteria 2904479285 2904479669 426
222 3300005339 Ga0070660_100041992 Ga0070660_1000419921 427
223 3300005563 Ga0068855_100046677 Ga0068855_1000466772 427
224 3300009093 Ga0105240_10012099 Ga0105240_1001209910 427
225 3300009551 Ga0105238_10164108 Ga0105238_101641082 427
226 3300025303 Ga0209051_1009297 Ga0209051_10092975 427
227 3300025913 Ga0207695_10212642 Ga0207695_102126421 427
228 3300037312 Ga0395899_0009628 Ga0395899_0009628_3313_4596 427
229 3300037418 Ga0395900_0048025 Ga0395900_0048025_1572_2855 427
230 3300037466 Ga0395898_0006475 Ga0395898_0006475_2676_3959 427
231 3300037466 Ga0395898_0090952 Ga0395898_0090952_899_2182 427
232 3300037471 Ga0395905_0000290 Ga0395905_0000290_71103_72386 427
233 3300037471 Ga0395905_0005564 Ga0395905_0005564_3396_4679 427
234 3300037471 Ga0395905_0018855 Ga0395905_0018855_1759_3042 427
235 3300044683 Ga0466965_0042945 Ga0466965_0042945_461_1759 427
236 3300044712 Ga0453684_0330143 Ga0453684_0330143_280_1581 427
237 3300046528 Ga0495642_0003027 Ga0495642_0003027_2171_3484 427
238 3300049571 Ga0501034_0003465 Ga0501034_0003465_1369_2652 427
239 3300049572 Ga0501036_0054150 Ga0501036_0054150_1194_2477 427
240 3300049579 Ga0501043_0158691 Ga0501043_0158691_348_1631 427
241 3300049581 Ga0501047_0034461 Ga0501047_0034461_2937_4220 427
242 3300049742 Ga0501080_0029262 Ga0501080_0029262_1523_2806 427
243 3300049822 Ga0501035_0027582 Ga0501035_0027582_2101_3384 427
244 3300049823 Ga0501044_0125424 Ga0501044_0125424_534_1817 427
245 3300002773 JGI25152J39213_1012061 JGI25152J39213_10120612 428
246 3300003215 JGI25153J46596_10005823 JGI25153J46596_100058236 428
247 3300003771 Ga0055526_1002276 Ga0055526_100227618 428
248 3300003775 Ga0055524_1000079 Ga0055524_100007996 428
249 3300005262 Ga0065165_1006821 Ga0065165_10068215 428
250 3300005328 Ga0070676_10022583 Ga0070676_100225831 428
251 3300005331 Ga0070670_100005784 Ga0070670_1000057845 428
252 3300005333 Ga0070677_10000217 Ga0070677_100002179 428
253 3300005335 Ga0070666_10156426 Ga0070666_101564262 428
254 3300005344 Ga0070661_100001326 Ga0070661_1000013265 428
255 3300005353 Ga0070669_100008450 Ga0070669_1000084502 428
256 3300005354 Ga0070675_100003222 Ga0070675_1000032229 428
257 3300005355 Ga0070671_100004463 Ga0070671_10000446313 428
258 3300005356 Ga0070674_100004729 Ga0070674_1000047292 428
259 3300005356 Ga0070674_100034524 Ga0070674_1000345241 428
260 3300005364 Ga0070673_100007267 Ga0070673_1000072674 428
261 3300005366 Ga0070659_100000336 Ga0070659_10000033634 428
262 3300005456 Ga0070678_100002650 Ga0070678_1000026504 428
263 3300005459 Ga0068867_100063045 Ga0068867_1000630451 428
264 3300005543 Ga0070672_100000137 Ga0070672_10000013715 428
265 3300005564 Ga0070664_100033391 Ga0070664_1000333914 428
266 3300005564 Ga0070664_100228165 Ga0070664_1002281652 428
267 3300005616 Ga0068852_100091838 Ga0068852_1000918382 428
268 3300005616 Ga0068852_100161112 Ga0068852_1001611122 428
269 3300005618 Ga0068864_100025113 Ga0068864_1000251134 428
270 3300005841 Ga0068863_100150167 Ga0068863_1001501671 428
271 3300006048 Ga0075363_100058828 Ga0075363_1000588282 428
272 3300017792 Ga0163161_10063515 Ga0163161_100635152 428
273 3300025245 Ga0207425_1010655 Ga0207425_10106552 428
274 3300025258 Ga0209129_1000041 Ga0209129_100004127 428
275 3300025295 Ga0209564_1000029 Ga0209564_1000029173 428
276 3300025297 Ga0209758_1000043 Ga0209758_1000043267 428
277 3300025297 Ga0209758_1000057 Ga0209758_10000577 428
278 3300025299 Ga0209256_1000011 Ga0209256_100001197 428
279 3300025893 Ga0207682_10001876 Ga0207682_100018761 428
280 3300025903 Ga0207680_10173246 Ga0207680_101732462 428
281 3300025907 Ga0207645_10006998 Ga0207645_100069985 428
282 3300025920 Ga0207649_10123145 Ga0207649_101231452 428
283 3300025923 Ga0207681_10035178 Ga0207681_100351782 428
284 3300025925 Ga0207650_10000909 Ga0207650_100009099 428
285 3300025926 Ga0207659_10001432 Ga0207659_1000143211 428
286 3300025931 Ga0207644_10002037 Ga0207644_100020378 428
287 3300025931 Ga0207644_10079599 Ga0207644_100795993 428
288 3300025937 Ga0207669_10001718 Ga0207669_100017189 428
289 3300025940 Ga0207691_10001983 Ga0207691_100019836 428
290 3300025960 Ga0207651_10003939 Ga0207651_100039394 428
291 3300026067 Ga0207678_10194045 Ga0207678_101940452 428
292 3300026088 Ga0207641_10107015 Ga0207641_101070154 428
293 3300026089 Ga0207648_10015115 Ga0207648_100151155 428
294 3300026089 Ga0207648_10085317 Ga0207648_100853173 428
295 3300026095 Ga0207676_10096598 Ga0207676_100965982 428
296 3300026142 Ga0207698_10107427 Ga0207698_101074272 428
297 3300030522 Ga0307512_10029293 Ga0307512_100292934 428
298 3300031616 Ga0307508_10000140 Ga0307508_1000014032 428
299 3300031731 Ga0307405_10010625 Ga0307405_100106255 428
300 3300031852 Ga0307410_10008468 Ga0307410_100084685 428
301 3300031995 Ga0307409_100220645 Ga0307409_1002206451 428
302 3300032002 Ga0307416_100089342 Ga0307416_1000893423 428
303 3300032005 Ga0307411_10009715 Ga0307411_100097152 428
304 3300037471 Ga0395905_0043408 Ga0395905_0043408_859_2175 428
305 3300042007 Ga0439449_0006001 Ga0439449_0006001_1174_2460 428
306 3300042015 Ga0439462_0002448 Ga0439462_0002448_1233_2519 428
307 3300042121 Ga0450919_000116 Ga0450919_000116_6444_7745 428
308 3300042531 Ga0450918_000016 Ga0450918_000016_4412_5713 428
309 3300044673 Ga0453683_0001803 Ga0453683_0001803_10395_11681 428
310 3300044684 Ga0466966_0031299 Ga0466966_0031299_214_1554 428
311 3300048905 Ga0496102_0007033 Ga0496102_0007033_5833_7134 428
312 3300048908 Ga0496105_0237734 Ga0496105_0237734_90_1397 428
313 3300048917 Ga0496114_0018269 Ga0496114_0018269_1962_3263 428
314 3300049649 Ga0501198_000004 Ga0501198_000004_67091_68416 428
315 3300049662 Ga0501222_000038 Ga0501222_000038_6582_7907 428
316 3300050493 nmdc:mga0k408_66695_c1 nmdc:mga0k408_66695_c1_268_1569 428
317 3300053129 Ga0500628_006231 Ga0500628_006231_376_1677 428
318 3300053148 Ga0500590_043658 Ga0500590_043658_618_1925 428
319 3300053156 Ga0500622_0005574 Ga0500622_0005574_5808_7109 428
320 3300003761 Ga0055535_1000087 Ga0055535_10000878 429
321 3300003761 Ga0055535_1000341 Ga0055535_100034117 429
322 3300003762 Ga0055542_1000369 Ga0055542_100036925 429
323 3300003763 Ga0055529_1000139 Ga0055529_100013915 429
324 3300003781 Ga0055536_1009113 Ga0055536_10091132 429
325 3300003784 Ga0055534_1000791 Ga0055534_100079116 429
326 3300003791 Ga0055530_10016452 Ga0055530_100164522 429
327 3300003792 Ga0055540_1001724 Ga0055540_10017243 429
328 3300003794 Ga0055531_10001925 Ga0055531_1000192514 429
329 3300005327 Ga0070658_10024241 Ga0070658_100242414 429
330 3300005355 Ga0070671_100006195 Ga0070671_1000061953 429
331 3300005366 Ga0070659_100025222 Ga0070659_1000252223 429
332 3300005455 Ga0070663_100000305 Ga0070663_10000030516 429
333 3300005459 Ga0068867_100000005 Ga0068867_10000000518 429
334 3300005548 Ga0070665_100005645 Ga0070665_1000056452 429
335 3300005548 Ga0070665_100093378 Ga0070665_1000933784 429
336 3300005563 Ga0068855_100028957 Ga0068855_1000289576 429
337 3300005841 Ga0068863_100073540 Ga0068863_1000735403 429
338 3300006038 Ga0075365_10075041 Ga0075365_100750413 429
339 3300006042 Ga0075368_10040295 Ga0075368_100402952 429
340 3300006177 Ga0075362_10009242 Ga0075362_100092422 429
341 3300006177 Ga0075362_10009848 Ga0075362_100098482 429
342 3300006195 Ga0075366_10001021 Ga0075366_1000102111 429
343 3300006195 Ga0075366_10003258 Ga0075366_100032583 429
344 3300006195 Ga0075366_10030314 Ga0075366_100303142 429
345 3300006353 Ga0075370_10000147 Ga0075370_1000014712 429
346 3300006358 Ga0068871_100173105 Ga0068871_1001731052 429
347 3300006880 Ga0075429_100001204 Ga0075429_1000012042 429
348 3300009098 Ga0105245_10124303 Ga0105245_101243032 429
349 3300009148 Ga0105243_10043399 Ga0105243_100433992 429
350 3300013105 Ga0157369_10027568 Ga0157369_100275685 429
351 3300013306 Ga0163162_10015372 Ga0163162_100153724 429
352 3300013306 Ga0163162_10291449 Ga0163162_102914492 429
353 3300013306 Ga0163162_10307654 Ga0163162_103076542 429
354 3300013308 Ga0157375_10249124 Ga0157375_102491242 429
355 3300014497 Ga0182008_10007715 Ga0182008_100077154 429
356 3300014497 Ga0182008_10012582 Ga0182008_100125825 429
357 3300014745 Ga0157377_10000244 Ga0157377_1000024419 429
358 3300014968 Ga0157379_10233151 Ga0157379_102331512 429
359 3300015262 Ga0182007_10004000 Ga0182007_100040005 429
360 3300015683 Ga0183362_10001 Ga0183362_10001415 429
361 3300017792 Ga0163161_10008119 Ga0163161_100081194 429
362 3300017792 Ga0163161_10033240 Ga0163161_100332402 429
363 3300025231 Ga0207427_100446 Ga0207427_10044616 429
364 3300025242 Ga0209258_100044 Ga0209258_10004415 429
365 3300025253 Ga0209677_101298 Ga0209677_10129814 429
366 3300025256 Ga0209759_1015090 Ga0209759_10150902 429
367 3300025272 Ga0209455_1000048 Ga0209455_100004815 429
368 3300025291 Ga0209675_1000714 Ga0209675_100071410 429
369 3300025292 Ga0209676_1001516 Ga0209676_10015165 429
370 3300025294 Ga0209025_1000641 Ga0209025_100064126 429
371 3300025294 Ga0209025_1051435 Ga0209025_10514351 429
372 3300025298 Ga0209050_1000529 Ga0209050_100052925 429
373 3300025298 Ga0209050_1000571 Ga0209050_100057118 429
374 3300025303 Ga0209051_1001576 Ga0209051_10015766 429
375 3300025303 Ga0209051_1004457 Ga0209051_100445711 429
376 3300025303 Ga0209051_1018349 Ga0209051_10183493 429
377 3300025304 Ga0209257_1002876 Ga0209257_10028765 429
378 3300025728 Ga0207655_1001858 Ga0207655_10018586 429
379 3300025914 Ga0207671_10066282 Ga0207671_100662822 429
380 3300025919 Ga0207657_10042354 Ga0207657_100423543 429
381 3300025924 Ga0207694_10053316 Ga0207694_100533162 429
382 3300025934 Ga0207686_10093634 Ga0207686_100936342 429
383 3300025935 Ga0207709_10006267 Ga0207709_100062674 429
384 3300025949 Ga0207667_10025652 Ga0207667_100256526 429
385 3300025960 Ga0207651_10086738 Ga0207651_100867383 429
386 3300025972 Ga0207668_10082079 Ga0207668_100820792 429
387 3300025986 Ga0207658_10035048 Ga0207658_100350483 429
388 3300026067 Ga0207678_10001071 Ga0207678_1000107111 429
389 3300026078 Ga0207702_10034860 Ga0207702_100348603 429
390 3300026089 Ga0207648_10000541 Ga0207648_1000054120 429
391 3300028379 Ga0268266_10113816 Ga0268266_101138163 429
392 3300028666 Ga0265336_10000293 Ga0265336_1000029319 429
393 3300028794 Ga0307515_10001017 Ga0307515_1000101725 429
394 3300028794 Ga0307515_10004876 Ga0307515_1000487612 429
395 3300028794 Ga0307515_10005604 Ga0307515_100056042 429
396 3300029957 Ga0265324_10004430 Ga0265324_100044306 429
397 3300031251 Ga0265327_10004992 Ga0265327_1000499213 429
398 3300031456 Ga0307513_10012208 Ga0307513_100122088 429
399 3300031456 Ga0307513_10014115 Ga0307513_100141154 429
400 3300031649 Ga0307514_10000864 Ga0307514_1000086423 429
401 3300032005 Ga0307411_10056464 Ga0307411_100564642 429
402 3300033179 Ga0307507_10057228 Ga0307507_100572281 429
403 3300037471 Ga0395905_0007643 Ga0395905_0007643_7554_8846 429
404 3300037471 Ga0395905_0209480 Ga0395905_0209480_265_1569 429
405 3300037471 Ga0395905_0287238 Ga0395905_0287238_67_1377 429
406 3300042004 Ga0439445_0001699 Ga0439445_0001699_3487_4782 429
407 3300042007 Ga0439449_0000699 Ga0439449_0000699_1467_2762 429
408 3300042010 Ga0439452_005680 Ga0439452_005680_1532_2827 429
409 3300042014 Ga0439457_006531 Ga0439457_006531_308_1603 429
410 3300042015 Ga0439462_0003230 Ga0439462_0003230_1610_2905 429
411 3300042128 Ga0450897_000191 Ga0450897_000191_1712_3007 429
412 3300042435 Ga0439434_0003276 Ga0439434_0003276_2507_3802 429
413 3300046475 Ga0495639_0006660 Ga0495639_0006660_2324_3619 429
414 3300046506 Ga0495583_0002724 Ga0495583_0002724_353_1663 429
415 3300046507 Ga0495606_0003052 Ga0495606_0003052_10667_11977 429
416 3300046520 Ga0495637_0006481 Ga0495637_0006481_4391_5686 429
417 3300046526 Ga0495666_0065639 Ga0495666_0065639_286_1608 429
418 3300046615 Ga0495656_0000042 Ga0495656_0000042_49667_50962 429
419 3300046615 Ga0495656_0025279 Ga0495656_0025279_594_1883 429
420 3300046663 Ga0495635_0161516 Ga0495635_0161516_174_1469 429
421 3300046674 Ga0495588_0014266 Ga0495588_0014266_196_1491 429
422 3300046683 Ga0495658_0006741 Ga0495658_0006741_1813_3108 429
423 3300046683 Ga0495658_0036561 Ga0495658_0036561_377_1690 429
424 3300046694 Ga0495649_0004838 Ga0495649_0004838_5149_6459 429
425 3300046794 Ga0495589_0014386 Ga0495589_0014386_456_1766 429
426 3300046809 Ga0495600_0049804 Ga0495600_0049804_1360_2655 429
427 3300047321 Ga0495676_0033248 Ga0495676_0033248_798_2093 429
428 3300047673 Ga0495593_0016559 Ga0495593_0016559_617_1912 429
429 3300047673 Ga0495593_0051717 Ga0495593_0051717_170_1492 429
430 3300048903 Ga0496100_0008667 Ga0496100_0008667_1907_3202 429
431 3300048904 Ga0496101_0014829 Ga0496101_0014829_3676_4971 429
432 3300048904 Ga0496101_0018801 Ga0496101_0018801_1576_2871 429
433 3300048905 Ga0496102_0008548 Ga0496102_0008548_2783_4078 429
434 3300048906 Ga0496103_0048814 Ga0496103_0048814_900_2195 429
435 3300048907 Ga0496104_0012951 Ga0496104_0012951_3290_4585 429
436 3300048908 Ga0496105_0026935 Ga0496105_0026935_2437_3732 429
437 3300048909 Ga0496106_0006571 Ga0496106_0006571_6009_7304 429
438 3300048920 Ga0496117_0070880 Ga0496117_0070880_557_1852 429
439 3300048921 Ga0496118_0029380 Ga0496118_0029380_1755_3050 429
440 3300048921 Ga0496118_0147820 Ga0496118_0147820_128_1423 429
441 3300048924 Ga0496121_0024041 Ga0496121_0024041_1573_2868 429
442 3300048927 Ga0496124_0050534 Ga0496124_0050534_595_1890 429
443 3300048927 Ga0496124_0101627 Ga0496124_0101627_486_1781 429
444 3300049579 Ga0501043_0000108 Ga0501043_0000108_16274_17590 429
445 3300049580 Ga0501046_0000050 Ga0501046_0000050_59778_61094 429
446 3300049581 Ga0501047_0000012 Ga0501047_0000012_307738_309054 429
447 3300049582 Ga0501048_0001920 Ga0501048_0001920_4044_5360 429
448 3300049705 Ga0501225_0005517 Ga0501225_0005517_1681_2976 429
449 3300049759 Ga0501262_000089 Ga0501262_000089_3088_4383 429
450 3300050489 nmdc:mga03683_6077_c1 nmdc:mga03683_6077_c1_2539_3834 429
451 3300050492 nmdc:mga0yw44_47317_c1 nmdc:mga0yw44_47317_c1_176_1465 429
452 3300050492 nmdc:mga0yw44_87248_c1 nmdc:mga0yw44_87248_c1_501_1796 429
453 3300050493 nmdc:mga0k408_12821_c1 nmdc:mga0k408_12821_c1_1776_3092 429
454 3300050493 nmdc:mga0k408_31195_c1 nmdc:mga0k408_31195_c1_308_1618 429
455 3300050493 nmdc:mga0k408_83979_c1 nmdc:mga0k408_83979_c1_216_1511 429
456 3300050496 nmdc:mga07m45_18698_c1 nmdc:mga07m45_18698_c1_429_1724 429
457 3300050496 nmdc:mga07m45_2629_c1 nmdc:mga07m45_2629_c1_5738_7048 429
458 3300050496 nmdc:mga07m45_96992_c1 nmdc:mga07m45_96992_c1_124_1419 429
459 3300050508 nmdc:mga09592_38208_c1 nmdc:mga09592_38208_c1_2180_3493 429
460 3300053086 Ga0500578_0001187 Ga0500578_0001187_18100_19410 429
461 3300053087 Ga0500643_005807 Ga0500643_005807_2685_3980 429
462 3300053093 Ga0500651_0000060 Ga0500651_0000060_53593_54888 429
463 3300053110 Ga0500571_000072 Ga0500571_000072_8342_9637 429
464 3300053117 Ga0500593_000719 Ga0500593_000719_6110_7405 429
465 3300053121 Ga0500607_000307 Ga0500607_000307_1925_3220 429
466 3300053131 Ga0500652_005313 Ga0500652_005313_355_1671 429
467 3300053133 Ga0500655_000073 Ga0500655_000073_22925_24220 429
468 3300053134 Ga0500658_0005354 Ga0500658_0005354_2156_3451 429
469 3300053158 Ga0500627_0000611 Ga0500627_0000611_5710_7005 429
470 3300053161 Ga0500634_0056048 Ga0500634_0056048_43_1338 429
471 3300053177 Ga0500636_0015791 Ga0500636_0015791_1672_2967 429
472 3300053177 Ga0500636_0021077 Ga0500636_0021077_1901_3211 429
473 iso_pu_bacteria 2513020051 2513230185 429
474 iso_pu_bacteria 2599185214 2599625404 429
475 iso_pu_bacteria 2599185226 2599673144 429
476 iso_pu_bacteria 2599185227 2599682814 429
477 iso_pu_bacteria 2599185229 2599694752 429
478 iso_pu_bacteria 2643221628 2644162086 429
479 iso_pu_bacteria 2643221658 2644328283 429
480 iso_pu_bacteria 2643221672 2644397594 429
481 iso_pu_bacteria 2643221683 2644464379 429
482 iso_pu_bacteria 2738541277 2738718458 429
483 iso_pu_bacteria 2738541307 2738882917 429
484 iso_pu_bacteria 2738543019 2739281645 429
485 iso_pu_bacteria 2818991446 2819602734 429
486 iso_pu_bacteria 2928115317 2928119427 429
487 iso_pu_bacteria 2945909444 2945910577 429
488 iso_pu_bacteria 2945945610 2945946467 429
489 iso_pu_bacteria 2945972063 2945976086 429
490 iso_pu_bacteria 2945984333 2945987348 429
491 iso_pu_bacteria 2954767861 2954771265 429
492 3300033180 Ga0307510_10001745 Ga0307510_100017454 430
493 3300048924 Ga0496121_0002132 Ga0496121_0002132_9934_11280 430
494 3300048928 Ga0496125_0004737 Ga0496125_0004737_4647_5993 430
495 iso_pu_bacteria 2939631187 2939632308 430
496 3300044842 Ga0466957_0057058 Ga0466957_0057058_871_2244 431
497 3300050489 nmdc:mga03683_30727_c1 nmdc:mga03683_30727_c1_124_1422 431
498 iso_pu_bacteria 2932422444 2932426229 431
499 3300002773 JGI25152J39213_1004936 JGI25152J39213_10049365 432
500 3300002773 JGI25152J39213_1005343 JGI25152J39213_10053435 432
501 3300002774 JGI25150J39212_1001393 JGI25150J39212_10013935 432
502 3300002774 JGI25150J39212_1002644 JGI25150J39212_10026445 432
503 3300002987 JGI25159J45721_1003763 JGI25159J45721_10037633 432
504 3300002987 JGI25159J45721_1004844 JGI25159J45721_10048443 432
505 3300003187 JGI25151J46595_10001831 JGI25151J46595_100018315 432
506 3300003187 JGI25151J46595_10005441 JGI25151J46595_100054412 432
507 3300003187 JGI25151J46595_10018787 JGI25151J46595_100187874 432
508 3300003215 JGI25153J46596_10011446 JGI25153J46596_100114465 432
509 3300003215 JGI25153J46596_10014727 JGI25153J46596_100147274 432
510 3300003354 JGI25160J50197_1010564 JGI25160J50197_10105645 432
511 3300003354 JGI25160J50197_1011159 JGI25160J50197_10111594 432
512 3300003374 JGI25161J50226_1004628 JGI25161J50226_10046284 432
513 3300003374 JGI25161J50226_1006980 JGI25161J50226_10069802 432
514 3300003578 Ga0006562J51391_1006645 Ga0006562J51391_10066455 432
515 3300003771 Ga0055526_1014054 Ga0055526_10140545 432
516 3300003771 Ga0055526_1014663 Ga0055526_10146634 432
517 3300003773 Ga0055537_1000280 Ga0055537_10002805 432
518 3300003773 Ga0055537_1005896 Ga0055537_10058964 432
519 3300003773 Ga0055537_1011949 Ga0055537_10119492 432
520 3300003775 Ga0055524_1012124 Ga0055524_10121242 432
521 3300003775 Ga0055524_1012783 Ga0055524_10127834 432
522 3300003781 Ga0055536_1004671 Ga0055536_10046712 432
523 3300003781 Ga0055536_1007647 Ga0055536_10076473 432
524 3300003784 Ga0055534_1000064 Ga0055534_10000643 432
525 3300003784 Ga0055534_1006789 Ga0055534_10067894 432
526 3300003784 Ga0055534_1007865 Ga0055534_10078653 432
527 3300003790 Ga0055528_1002261 Ga0055528_100226112 432
528 3300003790 Ga0055528_1012925 Ga0055528_10129254 432
529 3300003791 Ga0055530_10001020 Ga0055530_100010202 432
530 3300003791 Ga0055530_10004609 Ga0055530_100046098 432
531 3300003792 Ga0055540_1002881 Ga0055540_10028818 432
532 3300004625 Ga0055543_1003413 Ga0055543_10034135 432
533 3300005262 Ga0065165_1008660 Ga0065165_10086605 432
534 3300005288 Ga0065714_10005593 Ga0065714_100055935 432
535 3300005353 Ga0070669_100024209 Ga0070669_1000242095 432
536 3300005539 Ga0068853_100031348 Ga0068853_1000313485 432
537 3300006038 Ga0075365_10040741 Ga0075365_100407412 432
538 3300006048 Ga0075363_100023932 Ga0075363_1000239322 432
539 3300006048 Ga0075363_100054333 Ga0075363_1000543332 432
540 3300006178 Ga0075367_10024473 Ga0075367_100244732 432
541 3300006178 Ga0075367_10102503 Ga0075367_101025031 432
542 3300006195 Ga0075366_10029726 Ga0075366_100297262 432
543 3300006195 Ga0075366_10033555 Ga0075366_100335554 432
544 3300006195 Ga0075366_10042171 Ga0075366_100421714 432
545 3300006353 Ga0075370_10010078 Ga0075370_100100785 432
546 3300006353 Ga0075370_10036382 Ga0075370_100363824 432
547 3300006353 Ga0075370_10105845 Ga0075370_101058451 432
548 3300006948 Ga0099826_10010348 Ga0099826_100103487 432
549 3300009036 Ga0105244_10005429 Ga0105244_100054295 432
550 3300009148 Ga0105243_10024244 Ga0105243_100242443 432
551 3300015261 Ga0182006_1009229 Ga0182006_10092295 432
552 3300015262 Ga0182007_10005239 Ga0182007_100052393 432
553 3300017792 Ga0163161_10041194 Ga0163161_100411942 432
554 3300025229 Ga0209147_101975 Ga0209147_1019755 432
555 3300025242 Ga0209258_100133 Ga0209258_10013324 432
556 3300025245 Ga0207425_1000144 Ga0207425_100014436 432
557 3300025245 Ga0207425_1005421 Ga0207425_10054215 432
558 3300025254 Ga0209148_1000361 Ga0209148_100036124 432
559 3300025258 Ga0209129_1000033 Ga0209129_100003338 432
560 3300025258 Ga0209129_1001468 Ga0209129_100146818 432
561 3300025258 Ga0209129_1005418 Ga0209129_10054185 432
562 3300025263 Ga0209565_1000088 Ga0209565_100008835 432
563 3300025263 Ga0209565_1001197 Ga0209565_100119714 432
564 3300025273 Ga0209673_1000064 Ga0209673_1000064122 432
565 3300025273 Ga0209673_1003717 Ga0209673_10037175 432
566 3300025273 Ga0209673_1014147 Ga0209673_10141472 432
567 3300025284 Ga0209130_1000885 Ga0209130_100088525 432
568 3300025284 Ga0209130_1004900 Ga0209130_10049005 432
569 3300025291 Ga0209675_1000036 Ga0209675_1000036122 432
570 3300025291 Ga0209675_1001680 Ga0209675_10016808 432
571 3300025291 Ga0209675_1004727 Ga0209675_10047275 432
572 3300025292 Ga0209676_1000111 Ga0209676_100011146 432
573 3300025292 Ga0209676_1001319 Ga0209676_100131925 432
574 3300025292 Ga0209676_1001878 Ga0209676_100187821 432
575 3300025292 Ga0209676_1029281 Ga0209676_10292811 432
576 3300025294 Ga0209025_1000424 Ga0209025_100042445 432
577 3300025294 Ga0209025_1001578 Ga0209025_100157830 432
578 3300025294 Ga0209025_1015764 Ga0209025_10157645 432
579 3300025294 Ga0209025_1028524 Ga0209025_10285243 432
580 3300025295 Ga0209564_1000070 Ga0209564_1000070276 432
581 3300025295 Ga0209564_1000964 Ga0209564_100096438 432
582 3300025297 Ga0209758_1000027 Ga0209758_100002738 432
583 3300025297 Ga0209758_1010287 Ga0209758_10102874 432
584 3300025298 Ga0209050_1000111 Ga0209050_1000111146 432
585 3300025299 Ga0209256_1000047 Ga0209256_1000047288 432
586 3300025299 Ga0209256_1000903 Ga0209256_100090338 432
587 3300025302 Ga0207426_1000115 Ga0207426_1000115186 432
588 3300025302 Ga0207426_1000742 Ga0207426_100074238 432
589 3300025303 Ga0209051_1000046 Ga0209051_1000046195 432
590 3300025303 Ga0209051_1000344 Ga0209051_10003446 432
591 3300025303 Ga0209051_1000609 Ga0209051_10006095 432
592 3300025304 Ga0209257_1000344 Ga0209257_10003446 432
593 3300025304 Ga0209257_1010960 Ga0209257_10109603 432
594 3300025321 Ga0207656_10028124 Ga0207656_100281242 432
595 3300025933 Ga0207706_10027020 Ga0207706_100270205 432
596 3300025935 Ga0207709_10000963 Ga0207709_1000096315 432
597 3300027614 Ga0209970_1001500 Ga0209970_10015002 432
598 3300027666 Ga0209282_1015920 Ga0209282_10159203 432
599 3300030731 Ga0316177_1172157 Ga0316177_11721572 432
600 3300030736 Ga0316180_1073943 Ga0316180_10739432 432
601 3300031456 Ga0307513_10000004 Ga0307513_10000004156 432
602 3300031456 Ga0307513_10086262 Ga0307513_100862624 432
603 3300031548 Ga0307408_100019661 Ga0307408_1000196614 432
604 3300031649 Ga0307514_10058457 Ga0307514_100584572 432
605 3300031901 Ga0307406_10012613 Ga0307406_100126133 432
606 3300031911 Ga0307412_10079086 Ga0307412_100790863 432
607 3300038443 Ga0395901_0082509 Ga0395901_0082509_1829_3166 432
608 3300041413 Ga0439465_0006250 Ga0439465_0006250_1135_2442 432
609 3300042115 Ga0450911_000854 Ga0450911_000854_2153_3454 432
610 3300042135 Ga0450899_003007 Ga0450899_003007_289_1596 432
611 3300042145 Ga0450906_003885 Ga0450906_003885_1727_3034 432
612 3300042147 Ga0450910_000924 Ga0450910_000924_749_2056 432
613 3300042435 Ga0439434_0002935 Ga0439434_0002935_1848_3155 432
614 3300046512 Ga0495610_0078948 Ga0495610_0078948_21_1328 432
615 3300046513 Ga0495616_0011837 Ga0495616_0011837_1776_3083 432
616 3300046518 Ga0495631_0010173 Ga0495631_0010173_1790_3097 432
617 3300046539 Ga0495621_0003480 Ga0495621_0003480_1790_3097 432
618 3300046660 Ga0495625_0000292 Ga0495625_0000292_60292_61599 432
619 3300048919 Ga0496116_0141726 Ga0496116_0141726_25_1332 432
620 3300048920 Ga0496117_0003590 Ga0496117_0003590_6452_7759 432
621 3300048921 Ga0496118_0040534 Ga0496118_0040534_486_1793 432
622 3300048927 Ga0496124_0040134 Ga0496124_0040134_2519_3826 432
623 3300048927 Ga0496124_0063507 Ga0496124_0063507_1568_2869 432
624 3300048928 Ga0496125_0033201 Ga0496125_0033201_37_1338 432
625 3300050490 nmdc:mga03n38_11395_c1 nmdc:mga03n38_11395_c1_612_1934 432
626 3300050494 nmdc:mga06z11_15487_c1 nmdc:mga06z11_15487_c1_1370_2692 432
627 3300050496 nmdc:mga07m45_43_c1 nmdc:mga07m45_43_c1_2998_4305 432
628 3300050496 nmdc:mga07m45_6037_c1 nmdc:mga07m45_6037_c1_477_1784 432
629 3300053116 Ga0500592_005993 Ga0500592_005993_390_1697 432
630 3300053122 Ga0500608_016465 Ga0500608_016465_202_1509 432
631 3300053134 Ga0500658_0000402 Ga0500658_0000402_15638_16945 432
632 3300053139 Ga0500568_0000566 Ga0500568_0000566_8878_10185 432
633 3300053153 Ga0500616_0011263 Ga0500616_0011263_2356_3663 432
634 iso_pu_bacteria 2511231002 2511243999 432
635 iso_pu_bacteria 2721755523 2722882741 432
636 3300021361 Ga0213872_10010301 Ga0213872_100103015 433
637 3300025919 Ga0207657_10102433 Ga0207657_101024332 433
638 3300039447 Ga0436361_0348943 Ga0436361_0348943_37428_38741 433
639 3300049568 Ga0501031_0016788 Ga0501031_0016788_1743_3203 433
640 iso_pu_bacteria 2547132374 2548501109 433
641 iso_pu_bacteria 2643221570 2643866816 433
642 iso_pu_bacteria 2643221596 2643993536 433
643 iso_pu_bacteria 2643221609 2644061121 433
644 iso_pu_bacteria 2643221652 2644294670 433
645 iso_pu_bacteria 2643221717 2644645793 433
646 iso_pu_bacteria 2738543012 2739243462 433
647 iso_pu_bacteria 2816332133 2816475746 433
648 iso_pu_bacteria 2842718218 2842719786 433
649 iso_pu_bacteria 2919704043 2919704247 433
650 iso_pu_bacteria 2974320154 2974323862 433
651 iso_pu_bacteria 2990710928 2990712772 433
652 3300042876 Ga0451577_0000825 Ga0451577_0000825_22850_24220 434
653 3300044712 Ga0453684_0002253 Ga0453684_0002253_23336_24706 434
654 3300045051 Ga0451576_0015926 Ga0451576_0015926_4383_5753 434
655 3300046558 Ga0495633_0006679 Ga0495633_0006679_610_1929 434
656 3300006946 Ga0079104_1000025 Ga0079104_1000025191 435
657 3300009148 Ga0105243_10002660 Ga0105243_1000266010 435
658 3300025934 Ga0207686_10007360 Ga0207686_100073602 435
659 3300025935 Ga0207709_10000459 Ga0207709_1000045937 435
660 3300027111 Ga0209281_1000007 Ga0209281_100000731 435
661 3300031238 Ga0265332_10000020 Ga0265332_10000020186 435
662 3300048925 Ga0496122_0026483 Ga0496122_0026483_2554_3876 435
663 3300048928 Ga0496125_0011749 Ga0496125_0011749_4883_6205 435
664 3300048929 Ga0496126_0041394 Ga0496126_0041394_1186_2508 435
665 3300053088 Ga0500644_0008921 Ga0500644_0008921_746_2053 435
666 iso_pu_bacteria 2894023352 2894026050 435
667 3300002987 JGI25159J45721_1002711 JGI25159J45721_10027118 436
668 3300003354 JGI25160J50197_1000689 JGI25160J50197_10006898 436
669 3300003374 JGI25161J50226_1000008 JGI25161J50226_1000008226 436
670 3300003771 Ga0055526_1006373 Ga0055526_10063731 436
671 3300003771 Ga0055526_1007426 Ga0055526_10074261 436
672 3300003773 Ga0055537_1000383 Ga0055537_100038325 436
673 3300003775 Ga0055524_1000107 Ga0055524_100010783 436
674 3300003784 Ga0055534_1004009 Ga0055534_10040094 436
675 3300003790 Ga0055528_1001653 Ga0055528_100165314 436
676 3300003791 Ga0055530_10000121 Ga0055530_1000012141 436
677 3300003792 Ga0055540_1000021 Ga0055540_1000021185 436
678 3300003794 Ga0055531_10000774 Ga0055531_100007746 436
679 3300004625 Ga0055543_1000259 Ga0055543_100025916 436
680 3300025284 Ga0209130_1000186 Ga0209130_100018679 436
681 3300025284 Ga0209130_1000401 Ga0209130_100040126 436
682 3300025291 Ga0209675_1000503 Ga0209675_10005035 436
683 3300025292 Ga0209676_1000069 Ga0209676_1000069113 436
684 3300025295 Ga0209564_1001104 Ga0209564_10011047 436
685 3300025295 Ga0209564_1001141 Ga0209564_10011417 436
686 3300025298 Ga0209050_1000023 Ga0209050_1000023288 436
687 3300025302 Ga0207426_1000153 Ga0207426_1000153177 436
688 3300025303 Ga0209051_1000017 Ga0209051_1000017288 436
689 3300025304 Ga0209257_1000041 Ga0209257_1000041288 436
690 3300027252 Ga0209973_1002196 Ga0209973_10021962 436
691 3300027876 Ga0209974_10005911 Ga0209974_100059114 436
692 3300031730 Ga0307516_10173207 Ga0307516_101732072 436
693 3300031901 Ga0307406_10004684 Ga0307406_100046847 436
694 3300031901 Ga0307406_10024354 Ga0307406_100243543 436
695 3300042876 Ga0451577_0010087 Ga0451577_0010087_4800_6116 436
696 3300044712 Ga0453684_0019186 Ga0453684_0019186_5749_7065 436
697 3300045051 Ga0451576_0009978 Ga0451576_0009978_6960_8276 436
698 3300048928 Ga0496125_0031631 Ga0496125_0031631_2475_3821 436
699 3300002704 JGI25155J39150_1000005 JGI25155J39150_1000005121 440
700 3300002705 JGI25156J39149_1000006 JGI25156J39149_1000006121 440
701 3300002738 JGI25154J39366_1000015 JGI25154J39366_1000015125 440
702 3300002741 JGI25157J39369_1000016 JGI25157J39369_100001659 440
703 3300025206 Ga0209435_100010 Ga0209435_100010132 440
704 3300025246 Ga0209646_1000001 Ga0209646_10000012010 440
705 3300025250 Ga0209026_1000001 Ga0209026_1000001665 440
706 3300025256 Ga0209759_1000001 Ga0209759_10000011641 440
707 3300025263 Ga0209565_1000102 Ga0209565_10001029 440
708 3300025273 Ga0209673_1000189 Ga0209673_1000189106 440
709 3300025299 Ga0209256_1000003 Ga0209256_10000031005 440
710 3300028573 Ga0265334_10034907 Ga0265334_100349072 440
711 3300031235 Ga0265330_10000108 Ga0265330_1000010835 440
712 3300031238 Ga0265332_10000072 Ga0265332_1000007235 440
713 3300031456 Ga0307513_10000015 Ga0307513_10000015163 440
714 3300031711 Ga0265314_10000874 Ga0265314_100008747 440
715 3300046542 Ga0495597_0003090 Ga0495597_0003090_2312_3700 440
716 3300053730 Ga0500645_000551 Ga0500645_000551_22440_23762 440

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

291

410

0.84

PF08245

Mur_ligase_M

Mur ligase middle domain

48

266

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w78-assembly1.cif.gz_A e.coli folc in complex with dhpp and adp 0.9574 10 428
3nrs-assembly1.cif.gz_A crystal structure of ligand-free bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis c092 0.9526 10 428
1w7k-assembly1.cif.gz_A e.coli folc in complex with adp, without folate substrate 0.9516 10 428
3qcz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound 0.9494 10 428
3n2a-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis co92 0.9445 10 428
ID Description Score Start End Superfamily
af_P08192_1_287_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9651 10 294 3.40.1190.10
af_M0R401_2_171_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.939 147 223 3.40.1190.10
af_P08192_1_287_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9256 10 294 3.40.1190.10
3n2aA02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9185 295 428 3.90.190.20
af_Q2FXR9_1_294_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9178 10 293 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A1G0CQI6-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9762 10 426 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046654
GO:0046656
GO:0046872
AF-A0A6M1HWT5-F1-model_v4 deleted 0.975 65 293
AF-A0A6L9KYK3-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9741 9 286 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046654
AF-A0A537CWG3-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9698 10 426 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046654
GO:0046656
GO:0046872
AF-K2BNR1-F1-model_v4 tetrahydrofolate synthase (EC 6.3.2.17) (Tetrahydrofolylpolyglutamate synthase) 0.9681 10 428 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map