F477076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 716 | 411 | 649 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0016788|Ga0501031_0016788_1743_3203 |
| Length | 486 |
| Sequence | MKNLPDTLDGWLHYCEHLHPHTIEMGLDRVALVKERLGLHLDCPVITVAGTNGKGSTCAMIEAVALQAGYRPGVYTSPHLVHFEERCRIHGETVKPEELLPHFEAVERARTEGGEVQLTYFEFTTLAILRLISQARVDVAVLEVGMGGRLDAVNVIDADCAVITMIDVDHAEFLGPDRESIGREKAGIMRPGRPVVVCDPVPPESVIEHAKAIGARLWRFGTDFNYSGDKLQWSWAGRGRRYAGMSYPALRGANQLFNASGALAALEAIREKLPISAQAVRAGLALVELPGRFEVAPGQPVVVLDVAHNPHAVATLAASMSTMGHFRLTHAVFGAMADKDITGIFEKIGPLIDRWYFTDLPTARAETAAHLQERWERFHAQQEALQTPPAVVQDDAPRMDLAEAVKQQDDKPHLSVTRSRRGSSGEGXXXRRIVKSEVFADPQTALDAAIAASRLTDRIVVFGSFYTVGGILKNGMPQMHGKHFDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 12 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 13 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 14 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 15 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 16 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 17 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 18 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 19 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 20 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 21 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 22 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 23 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 24 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 25 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 26 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 27 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 28 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 29 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 30 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 31 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 32 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 33 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 34 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 35 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 36 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 37 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 38 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 39 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 40 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 41 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 42 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 43 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 44 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 45 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 46 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 47 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 48 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 49 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 50 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 51 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 52 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 53 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 54 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 55 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 56 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 57 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 58 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 59 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 60 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 61 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 62 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 63 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 64 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 65 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 66 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 67 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 68 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 69 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 70 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 71 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 72 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 73 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 74 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 75 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 76 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 77 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 78 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 79 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 80 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 81 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 82 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 83 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 84 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 86 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 89 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 93 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 94 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 96 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 99 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 107 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 122 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 125 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 129 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 131 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 132 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 133 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 135 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 136 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 137 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 143 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 144 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 145 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 146 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 147 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 148 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 150 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 151 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 152 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 154 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 155 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 173 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 179 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 181 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 252 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 259 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 261 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 262 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 263 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 269 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 270 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 273 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 274 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 280 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 281 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 282 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 292 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 293 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 294 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 295 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 296 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 297 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 298 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 299 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 300 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 301 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 302 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 303 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 304 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 305 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 306 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 307 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 308 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 309 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 310 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 314 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 315 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 374 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 375 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 389 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 393 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 396 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 397 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 398 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 399 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 400 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 401 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.5 |
| Metatranscriptomes | 0.14 |
| Isolates | 9.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.05 |
| Nodule | 0.84 |
| Rhizoplane | 3.21 |
| Rhizosphere | 53.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000005 | 3300002704 | Bacteria | 261712 |
| 2 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 3 | JGI25156J39149_1000580 | 3300002705 | Bacteria | 20874 |
| 4 | JGI25154J39366_1000015 | 3300002738 | Bacteria | 261778 |
| 5 | JGI25154J39366_1002077 | 3300002738 | Bacteria | 5690 |
| 6 | JGI25157J39369_1000016 | 3300002741 | Bacteria | 192349 |
| 7 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 8 | JGI25152J39213_1004936 | 3300002773 | Bacteria | 4044 |
| 9 | JGI25152J39213_1005343 | 3300002773 | Bacteria | 3774 |
| 10 | JGI25152J39213_1012061 | 3300002773 | Bacteria | 1875 |
| 11 | JGI25150J39212_1001393 | 3300002774 | Bacteria | 6845 |
| 12 | JGI25150J39212_1002644 | 3300002774 | Bacteria | 4389 |
| 13 | JGI25159J45721_1002711 | 3300002987 | Bacteria | 6575 |
| 14 | JGI25159J45721_1003763 | 3300002987 | Bacteria | 5246 |
| 15 | JGI25159J45721_1004844 | 3300002987 | Bacteria | 4346 |
| 16 | JGI25151J46595_10001831 | 3300003187 | Bacteria | 13709 |
| 17 | JGI25151J46595_10005441 | 3300003187 | Bacteria | 6579 |
| 18 | JGI25151J46595_10009197 | 3300003187 | Bacteria | 4699 |
| 19 | JGI25151J46595_10018787 | 3300003187 | Bacteria | 2955 |
| 20 | JGI25153J46596_10005823 | 3300003215 | Bacteria | 6405 |
| 21 | JGI25153J46596_10011446 | 3300003215 | Bacteria | 3919 |
| 22 | JGI25153J46596_10014727 | 3300003215 | Bacteria | 3232 |
| 23 | rootH1_10012602 | 3300003316 | Bacteria | 4934 |
| 24 | rootH2_10053692 | 3300003320 | Bacteria | 3877 |
| 25 | rootL2_10006461 | 3300003322 | Bacteria | 12808 |
| 26 | JGI26128J50194_1000266 | 3300003347 | Bacteria | 2615 |
| 27 | JGI25160J50197_1000689 | 3300003354 | Bacteria | 18663 |
| 28 | JGI25160J50197_1010564 | 3300003354 | Bacteria | 3327 |
| 29 | JGI25160J50197_1011159 | 3300003354 | Bacteria | 3203 |
| 30 | JGI25161J50226_1000008 | 3300003374 | Bacteria | 239245 |
| 31 | JGI25161J50226_1004628 | 3300003374 | Bacteria | 2834 |
| 32 | JGI25161J50226_1006980 | 3300003374 | Bacteria | 1966 |
| 33 | Ga0006562J51391_1006645 | 3300003578 | Bacteria | 9473 |
| 34 | Ga0055539_1001838 | 3300003752 | Bacteria | 3587 |
| 35 | Ga0055535_1000087 | 3300003761 | Bacteria | 102655 |
| 36 | Ga0055535_1000341 | 3300003761 | Bacteria | 46538 |
| 37 | Ga0055542_1000369 | 3300003762 | Bacteria | 46540 |
| 38 | Ga0055529_1000139 | 3300003763 | Bacteria | 102943 |
| 39 | Ga0055526_1002276 | 3300003771 | Bacteria | 13116 |
| 40 | Ga0055526_1006373 | 3300003771 | Bacteria | 6416 |
| 41 | Ga0055526_1007426 | 3300003771 | Bacteria | 5697 |
| 42 | Ga0055526_1014054 | 3300003771 | Bacteria | 3327 |
| 43 | Ga0055526_1014663 | 3300003771 | Bacteria | 3204 |
| 44 | Ga0055537_1000280 | 3300003773 | Bacteria | 36696 |
| 45 | Ga0055537_1000383 | 3300003773 | Bacteria | 29757 |
| 46 | Ga0055537_1005896 | 3300003773 | Bacteria | 3203 |
| 47 | Ga0055537_1011949 | 3300003773 | Bacteria | 1724 |
| 48 | Ga0055524_1000079 | 3300003775 | Bacteria | 120203 |
| 49 | Ga0055524_1000107 | 3300003775 | Bacteria | 100962 |
| 50 | Ga0055524_1012124 | 3300003775 | Bacteria | 3327 |
| 51 | Ga0055524_1012783 | 3300003775 | Bacteria | 3204 |
| 52 | Ga0055536_1004671 | 3300003781 | Bacteria | 6907 |
| 53 | Ga0055536_1007647 | 3300003781 | Bacteria | 4794 |
| 54 | Ga0055536_1009113 | 3300003781 | Bacteria | 4161 |
| 55 | Ga0055534_1000064 | 3300003784 | Bacteria | 81486 |
| 56 | Ga0055534_1000791 | 3300003784 | Bacteria | 14727 |
| 57 | Ga0055534_1004009 | 3300003784 | Bacteria | 4416 |
| 58 | Ga0055534_1006789 | 3300003784 | Bacteria | 2827 |
| 59 | Ga0055534_1007865 | 3300003784 | Bacteria | 2482 |
| 60 | Ga0055528_1001653 | 3300003790 | Bacteria | 13080 |
| 61 | Ga0055528_1002261 | 3300003790 | Bacteria | 10462 |
| 62 | Ga0055528_1012925 | 3300003790 | Bacteria | 3203 |
| 63 | Ga0055530_10000121 | 3300003791 | Bacteria | 67516 |
| 64 | Ga0055530_10001020 | 3300003791 | Bacteria | 22404 |
| 65 | Ga0055530_10004609 | 3300003791 | Bacteria | 7017 |
| 66 | Ga0055530_10016452 | 3300003791 | Bacteria | 2362 |
| 67 | Ga0055540_1000021 | 3300003792 | Bacteria | 208733 |
| 68 | Ga0055540_1001724 | 3300003792 | Bacteria | 12582 |
| 69 | Ga0055540_1002881 | 3300003792 | Bacteria | 8726 |
| 70 | Ga0055531_10000774 | 3300003794 | Bacteria | 26616 |
| 71 | Ga0055531_10001576 | 3300003794 | Bacteria | 16671 |
| 72 | Ga0055531_10001925 | 3300003794 | Bacteria | 14520 |
| 73 | Ga0055543_1000259 | 3300004625 | Bacteria | 39835 |
| 74 | Ga0055543_1003413 | 3300004625 | Bacteria | 4711 |
| 75 | Ga0065165_1006821 | 3300005262 | Bacteria | 5825 |
| 76 | Ga0065165_1008660 | 3300005262 | Bacteria | 4713 |
| 77 | Ga0065714_10005593 | 3300005288 | Bacteria | 4577 |
| 78 | Ga0070658_10024241 | 3300005327 | Bacteria | 4868 |
| 79 | Ga0070658_10031609 | 3300005327 | Bacteria | 4251 |
| 80 | Ga0070658_10243920 | 3300005327 | Bacteria | 1523 |
| 81 | Ga0070676_10022583 | 3300005328 | Bacteria | 3529 |
| 82 | Ga0070683_100109166 | 3300005329 | Bacteria | 2610 |
| 83 | Ga0070690_100032656 | 3300005330 | Bacteria | 3253 |
| 84 | Ga0070670_100005784 | 3300005331 | Bacteria | 10450 |
| 85 | Ga0070670_100154711 | 3300005331 | Bacteria | 1985 |
| 86 | Ga0070670_100165460 | 3300005331 | Bacteria | 1917 |
| 87 | Ga0070677_10000217 | 3300005333 | Bacteria | 19892 |
| 88 | Ga0068869_100000287 | 3300005334 | Bacteria | 26922 |
| 89 | Ga0070666_10156426 | 3300005335 | Bacteria | 1592 |
| 90 | Ga0070680_100038104 | 3300005336 | Bacteria | 3887 |
| 91 | Ga0070660_100041992 | 3300005339 | Bacteria | 3489 |
| 92 | Ga0070660_100058455 | 3300005339 | Bacteria | 2989 |
| 93 | Ga0070660_100120676 | 3300005339 | Bacteria | 2092 |
| 94 | Ga0070661_100001326 | 3300005344 | Bacteria | 17338 |
| 95 | Ga0070661_100046547 | 3300005344 | Bacteria | 3173 |
| 96 | Ga0070669_100008450 | 3300005353 | Bacteria | 7349 |
| 97 | Ga0070669_100024209 | 3300005353 | Bacteria | 4352 |
| 98 | Ga0070669_100056027 | 3300005353 | Bacteria | 2890 |
| 99 | Ga0070675_100003222 | 3300005354 | Bacteria | 12362 |
| 100 | Ga0070675_100034185 | 3300005354 | Bacteria | 4124 |
| 101 | Ga0070675_100173509 | 3300005354 | Bacteria | 1860 |
| 102 | Ga0070671_100001257 | 3300005355 | Bacteria | 19002 |
| 103 | Ga0070671_100004463 | 3300005355 | Bacteria | 11080 |
| 104 | Ga0070671_100006195 | 3300005355 | Bacteria | 9531 |
| 105 | Ga0070671_100063638 | 3300005355 | Bacteria | 3072 |
| 106 | Ga0070671_100199313 | 3300005355 | Bacteria | 1697 |
| 107 | Ga0070674_100004729 | 3300005356 | Bacteria | 7797 |
| 108 | Ga0070674_100034524 | 3300005356 | Bacteria | 3379 |
| 109 | Ga0070673_100007267 | 3300005364 | Bacteria | 7292 |
| 110 | Ga0070673_100143009 | 3300005364 | Bacteria | 2020 |
| 111 | Ga0070659_100000336 | 3300005366 | Bacteria | 36297 |
| 112 | Ga0070659_100020087 | 3300005366 | Bacteria | 5072 |
| 113 | Ga0070659_100025222 | 3300005366 | Bacteria | 4563 |
| 114 | Ga0070667_100012223 | 3300005367 | Bacteria | 7101 |
| 115 | Ga0070663_100000305 | 3300005455 | Bacteria | 25223 |
| 116 | Ga0070663_100008422 | 3300005455 | Bacteria | 6343 |
| 117 | Ga0070678_100002650 | 3300005456 | Bacteria | 9852 |
| 118 | Ga0070662_100044278 | 3300005457 | Bacteria | 3187 |
| 119 | Ga0070662_100098211 | 3300005457 | Bacteria | 2211 |
| 120 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 121 | Ga0068867_100063045 | 3300005459 | Bacteria | 2755 |
| 122 | Ga0070679_100012199 | 3300005530 | Bacteria | 8209 |
| 123 | Ga0070684_100055868 | 3300005535 | Bacteria | 3444 |
| 124 | Ga0068853_100012659 | 3300005539 | Bacteria | 6868 |
| 125 | Ga0068853_100031348 | 3300005539 | Bacteria | 4496 |
| 126 | Ga0068853_100041702 | 3300005539 | Bacteria | 3922 |
| 127 | Ga0070672_100000137 | 3300005543 | Bacteria | 38969 |
| 128 | Ga0070672_100226214 | 3300005543 | Bacteria | 1570 |
| 129 | Ga0070693_100058619 | 3300005547 | Bacteria | 2229 |
| 130 | Ga0070665_100005645 | 3300005548 | Bacteria | 12862 |
| 131 | Ga0070665_100093378 | 3300005548 | Bacteria | 3014 |
| 132 | Ga0068855_100028957 | 3300005563 | Bacteria | 6625 |
| 133 | Ga0068855_100046677 | 3300005563 | Bacteria | 5120 |
| 134 | Ga0070664_100033391 | 3300005564 | Bacteria | 4310 |
| 135 | Ga0070664_100060889 | 3300005564 | Bacteria | 3216 |
| 136 | Ga0070664_100062437 | 3300005564 | Bacteria | 3176 |
| 137 | Ga0070664_100228165 | 3300005564 | Bacteria | 1668 |
| 138 | Ga0068857_100023278 | 3300005577 | Bacteria | 5452 |
| 139 | Ga0068857_100157107 | 3300005577 | Bacteria | 2062 |
| 140 | Ga0068854_100115156 | 3300005578 | Bacteria | 2033 |
| 141 | Ga0068856_100003216 | 3300005614 | Bacteria | 16632 |
| 142 | Ga0068856_100044244 | 3300005614 | Bacteria | 4381 |
| 143 | Ga0070702_100016784 | 3300005615 | Bacteria | 3764 |
| 144 | Ga0068852_100036080 | 3300005616 | Bacteria | 4133 |
| 145 | Ga0068852_100038370 | 3300005616 | Bacteria | 4025 |
| 146 | Ga0068852_100091838 | 3300005616 | Bacteria | 2718 |
| 147 | Ga0068852_100123030 | 3300005616 | Bacteria | 2378 |
| 148 | Ga0068852_100161112 | 3300005616 | Bacteria | 2095 |
| 149 | Ga0068852_100191672 | 3300005616 | Bacteria | 1929 |
| 150 | Ga0068859_100190764 | 3300005617 | Bacteria | 2134 |
| 151 | Ga0068864_100025113 | 3300005618 | Bacteria | 5016 |
| 152 | Ga0068861_100003637 | 3300005719 | Bacteria | 10276 |
| 153 | Ga0068863_100073540 | 3300005841 | Bacteria | 3234 |
| 154 | Ga0068863_100076670 | 3300005841 | Bacteria | 3162 |
| 155 | Ga0068863_100146913 | 3300005841 | Bacteria | 2255 |
| 156 | Ga0068863_100150167 | 3300005841 | Bacteria | 2229 |
| 157 | Ga0068858_100021085 | 3300005842 | Bacteria | 6086 |
| 158 | Ga0068860_100014733 | 3300005843 | Bacteria | 7647 |
| 159 | Ga0068860_100065460 | 3300005843 | Bacteria | 3452 |
| 160 | Ga0068860_100274664 | 3300005843 | Bacteria | 1645 |
| 161 | Ga0068862_100033948 | 3300005844 | Bacteria | 4316 |
| 162 | Ga0075365_10040741 | 3300006038 | Bacteria | 3030 |
| 163 | Ga0075365_10075041 | 3300006038 | Bacteria | 2281 |
| 164 | Ga0075368_10040295 | 3300006042 | Bacteria | 1834 |
| 165 | Ga0075363_100023932 | 3300006048 | Bacteria | 3101 |
| 166 | Ga0075363_100054333 | 3300006048 | Bacteria | 2142 |
| 167 | Ga0075363_100058828 | 3300006048 | Bacteria | 2065 |
| 168 | Ga0075362_10009242 | 3300006177 | Bacteria | 3803 |
| 169 | Ga0075362_10009848 | 3300006177 | Bacteria | 3712 |
| 170 | Ga0075362_10032338 | 3300006177 | Bacteria | 2269 |
| 171 | Ga0075367_10024473 | 3300006178 | Bacteria | 3406 |
| 172 | Ga0075367_10102503 | 3300006178 | Bacteria | 1751 |
| 173 | Ga0075366_10001021 | 3300006195 | Bacteria | 13727 |
| 174 | Ga0075366_10003258 | 3300006195 | Bacteria | 8533 |
| 175 | Ga0075366_10029726 | 3300006195 | Bacteria | 3211 |
| 176 | Ga0075366_10030314 | 3300006195 | Bacteria | 3180 |
| 177 | Ga0075366_10033555 | 3300006195 | Bacteria | 3024 |
| 178 | Ga0075366_10042171 | 3300006195 | Bacteria | 2701 |
| 179 | Ga0097621_100090546 | 3300006237 | Bacteria | 2560 |
| 180 | Ga0075370_10000147 | 3300006353 | Bacteria | 24004 |
| 181 | Ga0075370_10003113 | 3300006353 | Bacteria | 7830 |
| 182 | Ga0075370_10010078 | 3300006353 | Bacteria | 4928 |
| 183 | Ga0075370_10036382 | 3300006353 | Bacteria | 2765 |
| 184 | Ga0075370_10105845 | 3300006353 | Bacteria | 1631 |
| 185 | Ga0068871_100094982 | 3300006358 | Bacteria | 2489 |
| 186 | Ga0068871_100161165 | 3300006358 | Bacteria | 1919 |
| 187 | Ga0068871_100173105 | 3300006358 | Bacteria | 1852 |
| 188 | Ga0075429_100001204 | 3300006880 | Bacteria | 20973 |
| 189 | Ga0097620_100190765 | 3300006931 | Bacteria | 2134 |
| 190 | Ga0079104_1000025 | 3300006946 | Bacteria | 218785 |
| 191 | Ga0099826_10010348 | 3300006948 | Bacteria | 6985 |
| 192 | Ga0105244_10005429 | 3300009036 | Bacteria | 8477 |
| 193 | Ga0105240_10012099 | 3300009093 | Bacteria | 11953 |
| 194 | Ga0105245_10012538 | 3300009098 | Bacteria | 7376 |
| 195 | Ga0105245_10124303 | 3300009098 | Bacteria | 2413 |
| 196 | Ga0105243_10002660 | 3300009148 | Bacteria | 14842 |
| 197 | Ga0105243_10024244 | 3300009148 | Bacteria | 4627 |
| 198 | Ga0105243_10043399 | 3300009148 | Bacteria | 3524 |
| 199 | Ga0105241_10044114 | 3300009174 | Bacteria | 3378 |
| 200 | Ga0105248_10021275 | 3300009177 | Bacteria | 7188 |
| 201 | Ga0105248_10286801 | 3300009177 | Bacteria | 1854 |
| 202 | Ga0105238_10164108 | 3300009551 | Bacteria | 2197 |
| 203 | Ga0105249_10030259 | 3300009553 | Bacteria | 4894 |
| 204 | Ga0105239_10015144 | 3300010375 | Bacteria | 8546 |
| 205 | Ga0157373_10004841 | 3300013100 | Bacteria | 10129 |
| 206 | Ga0157371_10059889 | 3300013102 | Bacteria | 2699 |
| 207 | Ga0157369_10027568 | 3300013105 | Bacteria | 6294 |
| 208 | Ga0157369_10058774 | 3300013105 | Bacteria | 4147 |
| 209 | Ga0157369_10081780 | 3300013105 | Bacteria | 3456 |
| 210 | Ga0157369_10125342 | 3300013105 | Bacteria | 2724 |
| 211 | Ga0163162_10015372 | 3300013306 | Bacteria | 7477 |
| 212 | Ga0163162_10291449 | 3300013306 | Bacteria | 1764 |
| 213 | Ga0163162_10307654 | 3300013306 | Bacteria | 1717 |
| 214 | Ga0157372_10027798 | 3300013307 | Bacteria | 6165 |
| 215 | Ga0157372_10035793 | 3300013307 | Bacteria | 5467 |
| 216 | Ga0157375_10003841 | 3300013308 | Bacteria | 13033 |
| 217 | Ga0157375_10030763 | 3300013308 | Bacteria | 5067 |
| 218 | Ga0157375_10115965 | 3300013308 | Bacteria | 2782 |
| 219 | Ga0157375_10249124 | 3300013308 | Bacteria | 1937 |
| 220 | Ga0163163_10338984 | 3300014325 | Bacteria | 1558 |
| 221 | Ga0157380_10030446 | 3300014326 | Bacteria | 4133 |
| 222 | Ga0157380_10268146 | 3300014326 | Bacteria | 1555 |
| 223 | Ga0182008_10007715 | 3300014497 | Bacteria | 5923 |
| 224 | Ga0182008_10012582 | 3300014497 | Bacteria | 4466 |
| 225 | Ga0157377_10000244 | 3300014745 | Bacteria | 27334 |
| 226 | Ga0157379_10155785 | 3300014968 | Bacteria | 2061 |
| 227 | Ga0157379_10233151 | 3300014968 | Bacteria | 1669 |
| 228 | Ga0157376_10022619 | 3300014969 | Bacteria | 4904 |
| 229 | Ga0182006_1009229 | 3300015261 | Bacteria | 4431 |
| 230 | Ga0182007_10004000 | 3300015262 | Bacteria | 6801 |
| 231 | Ga0182007_10005239 | 3300015262 | Bacteria | 5725 |
| 232 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 233 | Ga0163161_10000732 | 3300017792 | Bacteria | 25846 |
| 234 | Ga0163161_10008119 | 3300017792 | Bacteria | 7260 |
| 235 | Ga0163161_10033240 | 3300017792 | Bacteria | 3686 |
| 236 | Ga0163161_10040498 | 3300017792 | Bacteria | 3347 |
| 237 | Ga0163161_10041194 | 3300017792 | Bacteria | 3319 |
| 238 | Ga0163161_10063515 | 3300017792 | Bacteria | 2692 |
| 239 | Ga0213872_10010301 | 3300021361 | Bacteria | 4453 |
| 240 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 241 | Ga0209147_101975 | 3300025229 | Bacteria | 6001 |
| 242 | Ga0207427_100446 | 3300025231 | Bacteria | 22821 |
| 243 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 244 | Ga0209258_100133 | 3300025242 | Bacteria | 174846 |
| 245 | Ga0207425_1000144 | 3300025245 | Bacteria | 61877 |
| 246 | Ga0207425_1005421 | 3300025245 | Bacteria | 3638 |
| 247 | Ga0207425_1010655 | 3300025245 | Bacteria | 2228 |
| 248 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 249 | Ga0209646_1000188 | 3300025246 | Bacteria | 76972 |
| 250 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 251 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 252 | Ga0209677_100481 | 3300025253 | Bacteria | 22719 |
| 253 | Ga0209677_101298 | 3300025253 | Bacteria | 11118 |
| 254 | Ga0209148_1000361 | 3300025254 | Bacteria | 57663 |
| 255 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 256 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 257 | Ga0209759_1015090 | 3300025256 | Bacteria | 2008 |
| 258 | Ga0209129_1000033 | 3300025258 | Bacteria | 336894 |
| 259 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 260 | Ga0209129_1001468 | 3300025258 | Bacteria | 13112 |
| 261 | Ga0209129_1005418 | 3300025258 | Bacteria | 4526 |
| 262 | Ga0209565_1000088 | 3300025263 | Bacteria | 151644 |
| 263 | Ga0209565_1000102 | 3300025263 | Bacteria | 127545 |
| 264 | Ga0209565_1001197 | 3300025263 | Bacteria | 12378 |
| 265 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 266 | Ga0209673_1000064 | 3300025273 | Bacteria | 254712 |
| 267 | Ga0209673_1000189 | 3300025273 | Bacteria | 123470 |
| 268 | Ga0209673_1003717 | 3300025273 | Bacteria | 8739 |
| 269 | Ga0209673_1014147 | 3300025273 | Bacteria | 3103 |
| 270 | Ga0209130_1000186 | 3300025284 | Bacteria | 87096 |
| 271 | Ga0209130_1000401 | 3300025284 | Bacteria | 47425 |
| 272 | Ga0209130_1000885 | 3300025284 | Bacteria | 24420 |
| 273 | Ga0209130_1004900 | 3300025284 | Bacteria | 4862 |
| 274 | Ga0209675_1000036 | 3300025291 | Bacteria | 254712 |
| 275 | Ga0209675_1000503 | 3300025291 | Bacteria | 29292 |
| 276 | Ga0209675_1000714 | 3300025291 | Bacteria | 22673 |
| 277 | Ga0209675_1001680 | 3300025291 | Bacteria | 12299 |
| 278 | Ga0209675_1004727 | 3300025291 | Bacteria | 5938 |
| 279 | Ga0209676_1000069 | 3300025292 | Bacteria | 312462 |
| 280 | Ga0209676_1000111 | 3300025292 | Bacteria | 213411 |
| 281 | Ga0209676_1001319 | 3300025292 | Bacteria | 25125 |
| 282 | Ga0209676_1001516 | 3300025292 | Bacteria | 21147 |
| 283 | Ga0209676_1001878 | 3300025292 | Bacteria | 17183 |
| 284 | Ga0209676_1015056 | 3300025292 | Bacteria | 2869 |
| 285 | Ga0209676_1029281 | 3300025292 | Bacteria | 1702 |
| 286 | Ga0209025_1000424 | 3300025294 | Bacteria | 83948 |
| 287 | Ga0209025_1000641 | 3300025294 | Bacteria | 61686 |
| 288 | Ga0209025_1001578 | 3300025294 | Bacteria | 28809 |
| 289 | Ga0209025_1015764 | 3300025294 | Bacteria | 4524 |
| 290 | Ga0209025_1016017 | 3300025294 | Bacteria | 4463 |
| 291 | Ga0209025_1028524 | 3300025294 | Bacteria | 2731 |
| 292 | Ga0209025_1051435 | 3300025294 | Bacteria | 1637 |
| 293 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 294 | Ga0209564_1000070 | 3300025295 | Bacteria | 303126 |
| 295 | Ga0209564_1000964 | 3300025295 | Bacteria | 36352 |
| 296 | Ga0209564_1001104 | 3300025295 | Bacteria | 31907 |
| 297 | Ga0209564_1001141 | 3300025295 | Bacteria | 31135 |
| 298 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 299 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 300 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 301 | Ga0209758_1010287 | 3300025297 | Bacteria | 5626 |
| 302 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 303 | Ga0209050_1000111 | 3300025298 | Bacteria | 213411 |
| 304 | Ga0209050_1000529 | 3300025298 | Bacteria | 63410 |
| 305 | Ga0209050_1000571 | 3300025298 | Bacteria | 59772 |
| 306 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 307 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 308 | Ga0209256_1000047 | 3300025299 | Bacteria | 314709 |
| 309 | Ga0209256_1000903 | 3300025299 | Bacteria | 36352 |
| 310 | Ga0207426_1000115 | 3300025302 | Bacteria | 227423 |
| 311 | Ga0207426_1000153 | 3300025302 | Bacteria | 182839 |
| 312 | Ga0207426_1000742 | 3300025302 | Bacteria | 36678 |
| 313 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 314 | Ga0209051_1000046 | 3300025303 | Bacteria | 296424 |
| 315 | Ga0209051_1000344 | 3300025303 | Bacteria | 69935 |
| 316 | Ga0209051_1000609 | 3300025303 | Bacteria | 41505 |
| 317 | Ga0209051_1001576 | 3300025303 | Bacteria | 18805 |
| 318 | Ga0209051_1004457 | 3300025303 | Bacteria | 8619 |
| 319 | Ga0209051_1004714 | 3300025303 | Bacteria | 8286 |
| 320 | Ga0209051_1009297 | 3300025303 | Bacteria | 5078 |
| 321 | Ga0209051_1018349 | 3300025303 | Bacteria | 3097 |
| 322 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 323 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 324 | Ga0209257_1000344 | 3300025304 | Bacteria | 96578 |
| 325 | Ga0209257_1002876 | 3300025304 | Bacteria | 16025 |
| 326 | Ga0209257_1010960 | 3300025304 | Bacteria | 4464 |
| 327 | Ga0207656_10028124 | 3300025321 | Bacteria | 2305 |
| 328 | Ga0207655_1001858 | 3300025728 | Bacteria | 18229 |
| 329 | Ga0207682_10001876 | 3300025893 | Bacteria | 9581 |
| 330 | Ga0207682_10064533 | 3300025893 | Bacteria | 1539 |
| 331 | Ga0207680_10173246 | 3300025903 | Bacteria | 1455 |
| 332 | Ga0207645_10006998 | 3300025907 | Bacteria | 8030 |
| 333 | Ga0207645_10045497 | 3300025907 | Bacteria | 2805 |
| 334 | Ga0207705_10015877 | 3300025909 | Bacteria | 5407 |
| 335 | Ga0207705_10154284 | 3300025909 | Bacteria | 1722 |
| 336 | Ga0207695_10212642 | 3300025913 | Bacteria | 1844 |
| 337 | Ga0207671_10066282 | 3300025914 | Bacteria | 2687 |
| 338 | Ga0207660_10065531 | 3300025917 | Bacteria | 2625 |
| 339 | Ga0207662_10028972 | 3300025918 | Bacteria | 3205 |
| 340 | Ga0207657_10042354 | 3300025919 | Bacteria | 4018 |
| 341 | Ga0207657_10065328 | 3300025919 | Bacteria | 3102 |
| 342 | Ga0207657_10102433 | 3300025919 | Bacteria | 2374 |
| 343 | Ga0207649_10005941 | 3300025920 | Bacteria | 6618 |
| 344 | Ga0207649_10123145 | 3300025920 | Bacteria | 1751 |
| 345 | Ga0207652_10028749 | 3300025921 | Bacteria | 4640 |
| 346 | Ga0207681_10012637 | 3300025923 | Bacteria | 5213 |
| 347 | Ga0207681_10035178 | 3300025923 | Bacteria | 3299 |
| 348 | Ga0207694_10053316 | 3300025924 | Bacteria | 3136 |
| 349 | Ga0207694_10114119 | 3300025924 | Bacteria | 2151 |
| 350 | Ga0207650_10000909 | 3300025925 | Bacteria | 22299 |
| 351 | Ga0207650_10002632 | 3300025925 | Bacteria | 12423 |
| 352 | Ga0207650_10081398 | 3300025925 | Bacteria | 2456 |
| 353 | Ga0207659_10001432 | 3300025926 | Bacteria | 14215 |
| 354 | Ga0207659_10052298 | 3300025926 | Bacteria | 2909 |
| 355 | Ga0207644_10002037 | 3300025931 | Bacteria | 13083 |
| 356 | Ga0207644_10011269 | 3300025931 | Bacteria | 5910 |
| 357 | Ga0207644_10079599 | 3300025931 | Bacteria | 2418 |
| 358 | Ga0207706_10018240 | 3300025933 | Bacteria | 6315 |
| 359 | Ga0207706_10024971 | 3300025933 | Bacteria | 5357 |
| 360 | Ga0207706_10027020 | 3300025933 | Bacteria | 5134 |
| 361 | Ga0207686_10007360 | 3300025934 | Bacteria | 5925 |
| 362 | Ga0207686_10093634 | 3300025934 | Bacteria | 1990 |
| 363 | Ga0207709_10000459 | 3300025935 | Bacteria | 37691 |
| 364 | Ga0207709_10000963 | 3300025935 | Bacteria | 21558 |
| 365 | Ga0207709_10006267 | 3300025935 | Bacteria | 6682 |
| 366 | Ga0207669_10001718 | 3300025937 | Bacteria | 9295 |
| 367 | Ga0207691_10001983 | 3300025940 | Bacteria | 20016 |
| 368 | Ga0207691_10049434 | 3300025940 | Bacteria | 3853 |
| 369 | Ga0207691_10267235 | 3300025940 | Bacteria | 1473 |
| 370 | Ga0207711_10003076 | 3300025941 | Bacteria | 14559 |
| 371 | Ga0207711_10028938 | 3300025941 | Bacteria | 4668 |
| 372 | Ga0207689_10000612 | 3300025942 | Bacteria | 34213 |
| 373 | Ga0207679_10014320 | 3300025945 | Bacteria | 5211 |
| 374 | Ga0207679_10039026 | 3300025945 | Bacteria | 3389 |
| 375 | Ga0207667_10025652 | 3300025949 | Bacteria | 6449 |
| 376 | Ga0207667_10241059 | 3300025949 | Bacteria | 1850 |
| 377 | Ga0207651_10003939 | 3300025960 | Bacteria | 7368 |
| 378 | Ga0207651_10013818 | 3300025960 | Bacteria | 4637 |
| 379 | Ga0207651_10086738 | 3300025960 | Bacteria | 2276 |
| 380 | Ga0207668_10050027 | 3300025972 | Bacteria | 2877 |
| 381 | Ga0207668_10082079 | 3300025972 | Bacteria | 2341 |
| 382 | Ga0207658_10013798 | 3300025986 | Bacteria | 5526 |
| 383 | Ga0207658_10035048 | 3300025986 | Bacteria | 3592 |
| 384 | Ga0207703_10028371 | 3300026035 | Bacteria | 4412 |
| 385 | Ga0207639_10045284 | 3300026041 | Bacteria | 3312 |
| 386 | Ga0207678_10001071 | 3300026067 | Bacteria | 25052 |
| 387 | Ga0207678_10022647 | 3300026067 | Bacteria | 5501 |
| 388 | Ga0207678_10194045 | 3300026067 | Bacteria | 1736 |
| 389 | Ga0207702_10003082 | 3300026078 | Bacteria | 15468 |
| 390 | Ga0207702_10030039 | 3300026078 | Bacteria | 4527 |
| 391 | Ga0207702_10034860 | 3300026078 | Bacteria | 4209 |
| 392 | Ga0207641_10088860 | 3300026088 | Bacteria | 2699 |
| 393 | Ga0207641_10107015 | 3300026088 | Bacteria | 2473 |
| 394 | Ga0207641_10112844 | 3300026088 | Bacteria | 2412 |
| 395 | Ga0207641_10141180 | 3300026088 | Bacteria | 2173 |
| 396 | Ga0207648_10000541 | 3300026089 | Bacteria | 42157 |
| 397 | Ga0207648_10015115 | 3300026089 | Bacteria | 7105 |
| 398 | Ga0207648_10085317 | 3300026089 | Bacteria | 2755 |
| 399 | Ga0207676_10096598 | 3300026095 | Bacteria | 2439 |
| 400 | Ga0207674_10005245 | 3300026116 | Bacteria | 15429 |
| 401 | Ga0207674_10047633 | 3300026116 | Bacteria | 4392 |
| 402 | Ga0207675_100026328 | 3300026118 | Bacteria | 5414 |
| 403 | Ga0207683_10067726 | 3300026121 | Bacteria | 3150 |
| 404 | Ga0207698_10051771 | 3300026142 | Bacteria | 3141 |
| 405 | Ga0207698_10107427 | 3300026142 | Bacteria | 2330 |
| 406 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 407 | Ga0209973_1002196 | 3300027252 | Bacteria | 1797 |
| 408 | Ga0209968_1000181 | 3300027526 | Bacteria | 10958 |
| 409 | Ga0209970_1001500 | 3300027614 | Bacteria | 4064 |
| 410 | Ga0209282_1015920 | 3300027666 | Bacteria | 4783 |
| 411 | Ga0209966_1000013 | 3300027695 | Bacteria | 83121 |
| 412 | Ga0209974_10005911 | 3300027876 | Bacteria | 4290 |
| 413 | Ga0268266_10113816 | 3300028379 | Bacteria | 2400 |
| 414 | Ga0268264_10004874 | 3300028381 | Bacteria | 11372 |
| 415 | Ga0268264_10048502 | 3300028381 | Bacteria | 3533 |
| 416 | Ga0265334_10034907 | 3300028573 | Bacteria | 1994 |
| 417 | Ga0265336_10000293 | 3300028666 | Bacteria | 34148 |
| 418 | Ga0307515_10001017 | 3300028794 | Bacteria | 64033 |
| 419 | Ga0307515_10001540 | 3300028794 | Bacteria | 51551 |
| 420 | Ga0307515_10002116 | 3300028794 | Bacteria | 43530 |
| 421 | Ga0307515_10004876 | 3300028794 | Bacteria | 27436 |
| 422 | Ga0307515_10005604 | 3300028794 | Bacteria | 25377 |
| 423 | Ga0307515_10007089 | 3300028794 | Bacteria | 22262 |
| 424 | Ga0265324_10004430 | 3300029957 | Bacteria | 6354 |
| 425 | Ga0307512_10029293 | 3300030522 | Bacteria | 4814 |
| 426 | Ga0316177_1172157 | 3300030731 | Bacteria | 2558 |
| 427 | Ga0316180_1073943 | 3300030736 | Bacteria | 1761 |
| 428 | Ga0316182_1299437 | 3300030745 | Bacteria | 3484 |
| 429 | Ga0265330_10000108 | 3300031235 | Bacteria | 69468 |
| 430 | Ga0265332_10000020 | 3300031238 | Bacteria | 219119 |
| 431 | Ga0265332_10000072 | 3300031238 | Bacteria | 86029 |
| 432 | Ga0265327_10004992 | 3300031251 | Bacteria | 11381 |
| 433 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 434 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 435 | Ga0307513_10012208 | 3300031456 | Bacteria | 10620 |
| 436 | Ga0307513_10014115 | 3300031456 | Bacteria | 9776 |
| 437 | Ga0307513_10086262 | 3300031456 | Bacteria | 3219 |
| 438 | Ga0307408_100019661 | 3300031548 | Bacteria | 4549 |
| 439 | Ga0307508_10000140 | 3300031616 | Bacteria | 85941 |
| 440 | Ga0307514_10000864 | 3300031649 | Bacteria | 48175 |
| 441 | Ga0307514_10000906 | 3300031649 | Bacteria | 45659 |
| 442 | Ga0307514_10058457 | 3300031649 | Bacteria | 2949 |
| 443 | Ga0265314_10000874 | 3300031711 | Bacteria | 35850 |
| 444 | Ga0307516_10002516 | 3300031730 | Bacteria | 24408 |
| 445 | Ga0307516_10002985 | 3300031730 | Bacteria | 22095 |
| 446 | Ga0307516_10173207 | 3300031730 | Bacteria | 1897 |
| 447 | Ga0307405_10010625 | 3300031731 | Bacteria | 4783 |
| 448 | Ga0307410_10008468 | 3300031852 | Bacteria | 5704 |
| 449 | Ga0307406_10004684 | 3300031901 | Bacteria | 7454 |
| 450 | Ga0307406_10012613 | 3300031901 | Bacteria | 4820 |
| 451 | Ga0307406_10024354 | 3300031901 | Bacteria | 3615 |
| 452 | Ga0307412_10079086 | 3300031911 | Bacteria | 2267 |
| 453 | Ga0307409_100220645 | 3300031995 | Bacteria | 1711 |
| 454 | Ga0307416_100089342 | 3300032002 | Bacteria | 2637 |
| 455 | Ga0307411_10009715 | 3300032005 | Bacteria | 5080 |
| 456 | Ga0307411_10056464 | 3300032005 | Bacteria | 2588 |
| 457 | Ga0307507_10057228 | 3300033179 | Bacteria | 3674 |
| 458 | Ga0307510_10001745 | 3300033180 | Bacteria | 24235 |
| 459 | Ga0373934_0023631 | 3300035086 | Bacteria | 2375 |
| 460 | Ga0373937_0065202 | 3300036401 | Bacteria | 3352 |
| 461 | Ga0395899_0009628 | 3300037312 | Bacteria | 7415 |
| 462 | Ga0395900_0048025 | 3300037418 | Bacteria | 4396 |
| 463 | Ga0395898_0006475 | 3300037466 | Bacteria | 12504 |
| 464 | Ga0395898_0090952 | 3300037466 | Bacteria | 2936 |
| 465 | Ga0395905_0000290 | 3300037471 | Bacteria | 73649 |
| 466 | Ga0395905_0005564 | 3300037471 | Bacteria | 12847 |
| 467 | Ga0395905_0007643 | 3300037471 | Bacteria | 10728 |
| 468 | Ga0395905_0018855 | 3300037471 | Bacteria | 6544 |
| 469 | Ga0395905_0022523 | 3300037471 | Bacteria | 5958 |
| 470 | Ga0395905_0043408 | 3300037471 | Bacteria | 4218 |
| 471 | Ga0395905_0209480 | 3300037471 | Bacteria | 1826 |
| 472 | Ga0395905_0287238 | 3300037471 | Bacteria | 1532 |
| 473 | Ga0395901_0002361 | 3300038443 | Bacteria | 19197 |
| 474 | Ga0395901_0082509 | 3300038443 | Bacteria | 3359 |
| 475 | Ga0436361_0348943 | 3300039447 | Bacteria | 40158 |
| 476 | Ga0436363_0017561 | 3300039450 | Bacteria | 2248 |
| 477 | Ga0439465_0006250 | 3300041413 | Bacteria | 3784 |
| 478 | Ga0439445_0001699 | 3300042004 | Bacteria | 4834 |
| 479 | Ga0439449_0000699 | 3300042007 | Bacteria | 12822 |
| 480 | Ga0439449_0006001 | 3300042007 | Bacteria | 4639 |
| 481 | Ga0439452_005680 | 3300042010 | Bacteria | 3991 |
| 482 | Ga0439457_006531 | 3300042014 | Bacteria | 2854 |
| 483 | Ga0439462_0002448 | 3300042015 | Bacteria | 4314 |
| 484 | Ga0439462_0003230 | 3300042015 | Bacteria | 3889 |
| 485 | Ga0450911_000854 | 3300042115 | Bacteria | 8313 |
| 486 | Ga0450919_000116 | 3300042121 | Bacteria | 7995 |
| 487 | Ga0450897_000191 | 3300042128 | Bacteria | 3058 |
| 488 | Ga0450899_003007 | 3300042135 | Bacteria | 1817 |
| 489 | Ga0450900_005977 | 3300042136 | Bacteria | 1457 |
| 490 | Ga0450906_003885 | 3300042145 | Bacteria | 3170 |
| 491 | Ga0450910_000924 | 3300042147 | Bacteria | 3553 |
| 492 | Ga0439434_0002935 | 3300042435 | Bacteria | 4982 |
| 493 | Ga0439434_0003276 | 3300042435 | Bacteria | 4754 |
| 494 | Ga0450918_000016 | 3300042531 | Bacteria | 34446 |
| 495 | Ga0451577_0000825 | 3300042876 | Bacteria | 46324 |
| 496 | Ga0451577_0005521 | 3300042876 | Bacteria | 12911 |
| 497 | Ga0451577_0010087 | 3300042876 | Bacteria | 9051 |
| 498 | Ga0451577_0015023 | 3300042876 | Bacteria | 7204 |
| 499 | Ga0451577_0023550 | 3300042876 | Bacteria | 5614 |
| 500 | Ga0466969_0040205 | 3300044656 | Bacteria | 2343 |
| 501 | Ga0466972_0052631 | 3300044658 | Bacteria | 1961 |
| 502 | Ga0453683_0001803 | 3300044673 | Bacteria | 17691 |
| 503 | Ga0466965_0030575 | 3300044683 | Bacteria | 2624 |
| 504 | Ga0466965_0042945 | 3300044683 | Bacteria | 2231 |
| 505 | Ga0466966_0004262 | 3300044684 | Bacteria | 9434 |
| 506 | Ga0466966_0031299 | 3300044684 | Bacteria | 3451 |
| 507 | Ga0466963_0074533 | 3300044694 | Bacteria | 2289 |
| 508 | Ga0453684_0002253 | 3300044712 | Bacteria | 47789 |
| 509 | Ga0453684_0019186 | 3300044712 | Bacteria | 10426 |
| 510 | Ga0453684_0330143 | 3300044712 | Bacteria | 1725 |
| 511 | Ga0466971_0014151 | 3300044719 | Bacteria | 3507 |
| 512 | Ga0466970_0018325 | 3300044765 | Bacteria | 3623 |
| 513 | Ga0466957_0057058 | 3300044842 | Bacteria | 2389 |
| 514 | Ga0466959_0131630 | 3300045049 | Bacteria | 1772 |
| 515 | Ga0451576_0009978 | 3300045051 | Bacteria | 10949 |
| 516 | Ga0451576_0015926 | 3300045051 | Bacteria | 8312 |
| 517 | Ga0451576_0261999 | 3300045051 | Bacteria | 1807 |
| 518 | Ga0495638_0036450 | 3300046460 | Bacteria | 3134 |
| 519 | Ga0495639_0006660 | 3300046475 | Bacteria | 4970 |
| 520 | Ga0495583_0002724 | 3300046506 | Bacteria | 14632 |
| 521 | Ga0495606_0003052 | 3300046507 | Bacteria | 18248 |
| 522 | Ga0495610_0078948 | 3300046512 | Bacteria | 1516 |
| 523 | Ga0495616_0011837 | 3300046513 | Bacteria | 4976 |
| 524 | Ga0495631_0010173 | 3300046518 | Bacteria | 4666 |
| 525 | Ga0495632_0057832 | 3300046519 | Bacteria | 1892 |
| 526 | Ga0495637_0006481 | 3300046520 | Bacteria | 5872 |
| 527 | Ga0495666_0065639 | 3300046526 | Bacteria | 1731 |
| 528 | Ga0495642_0003027 | 3300046528 | Bacteria | 6696 |
| 529 | Ga0495621_0003480 | 3300046539 | Bacteria | 4347 |
| 530 | Ga0495621_0013490 | 3300046539 | Bacteria | 2569 |
| 531 | Ga0495597_0003090 | 3300046542 | Bacteria | 10018 |
| 532 | Ga0495633_0006679 | 3300046558 | Bacteria | 6794 |
| 533 | Ga0495656_0000042 | 3300046615 | Bacteria | 62167 |
| 534 | Ga0495656_0025279 | 3300046615 | Bacteria | 2353 |
| 535 | Ga0495625_0000292 | 3300046660 | Bacteria | 77369 |
| 536 | Ga0495635_0161516 | 3300046663 | Bacteria | 1525 |
| 537 | Ga0495635_0169570 | 3300046663 | Bacteria | 1485 |
| 538 | Ga0495588_0014266 | 3300046674 | Bacteria | 3800 |
| 539 | Ga0495647_0035008 | 3300046681 | Bacteria | 1884 |
| 540 | Ga0495647_0053416 | 3300046681 | Bacteria | 1576 |
| 541 | Ga0495658_0006741 | 3300046683 | Bacteria | 5649 |
| 542 | Ga0495658_0036561 | 3300046683 | Bacteria | 2710 |
| 543 | Ga0495649_0004838 | 3300046694 | Bacteria | 8711 |
| 544 | Ga0495589_0014386 | 3300046794 | Bacteria | 4076 |
| 545 | Ga0495600_0049804 | 3300046809 | Bacteria | 2733 |
| 546 | Ga0495676_0033248 | 3300047321 | Bacteria | 4346 |
| 547 | Ga0495593_0016559 | 3300047673 | Bacteria | 4156 |
| 548 | Ga0495593_0051717 | 3300047673 | Bacteria | 2173 |
| 549 | Ga0496100_0008667 | 3300048903 | Bacteria | 5678 |
| 550 | Ga0496101_0014829 | 3300048904 | Bacteria | 5243 |
| 551 | Ga0496101_0018801 | 3300048904 | Bacteria | 4705 |
| 552 | Ga0496102_0007033 | 3300048905 | Bacteria | 9607 |
| 553 | Ga0496102_0008548 | 3300048905 | Bacteria | 8779 |
| 554 | Ga0496103_0048814 | 3300048906 | Bacteria | 2616 |
| 555 | Ga0496104_0012951 | 3300048907 | Bacteria | 7509 |
| 556 | Ga0496104_0055347 | 3300048907 | Bacteria | 3751 |
| 557 | Ga0496105_0026935 | 3300048908 | Bacteria | 4691 |
| 558 | Ga0496105_0148611 | 3300048908 | Bacteria | 1927 |
| 559 | Ga0496105_0237734 | 3300048908 | Bacteria | 1479 |
| 560 | Ga0496106_0006571 | 3300048909 | Bacteria | 8609 |
| 561 | Ga0496106_0114856 | 3300048909 | Bacteria | 2099 |
| 562 | Ga0496107_0112337 | 3300048910 | Bacteria | 2003 |
| 563 | Ga0496108_0045772 | 3300048911 | Bacteria | 3654 |
| 564 | Ga0496110_0047354 | 3300048913 | Bacteria | 3764 |
| 565 | Ga0496111_0062504 | 3300048914 | Bacteria | 2700 |
| 566 | Ga0496112_0172800 | 3300048915 | Bacteria | 2126 |
| 567 | Ga0496114_0018269 | 3300048917 | Bacteria | 5668 |
| 568 | Ga0496114_0069210 | 3300048917 | Bacteria | 2964 |
| 569 | Ga0496116_0141726 | 3300048919 | Bacteria | 1351 |
| 570 | Ga0496117_0003590 | 3300048920 | Bacteria | 17899 |
| 571 | Ga0496117_0070880 | 3300048920 | Bacteria | 2338 |
| 572 | Ga0496118_0029380 | 3300048921 | Bacteria | 4610 |
| 573 | Ga0496118_0040534 | 3300048921 | Bacteria | 3701 |
| 574 | Ga0496118_0147820 | 3300048921 | Bacteria | 1476 |
| 575 | Ga0496121_0002132 | 3300048924 | Bacteria | 31087 |
| 576 | Ga0496121_0024041 | 3300048924 | Bacteria | 5840 |
| 577 | Ga0496122_0026483 | 3300048925 | Bacteria | 4996 |
| 578 | Ga0496123_0065375 | 3300048926 | Bacteria | 2312 |
| 579 | Ga0496124_0040134 | 3300048927 | Bacteria | 4051 |
| 580 | Ga0496124_0050534 | 3300048927 | Bacteria | 3542 |
| 581 | Ga0496124_0063507 | 3300048927 | Bacteria | 3085 |
| 582 | Ga0496124_0101627 | 3300048927 | Bacteria | 2329 |
| 583 | Ga0496125_0004737 | 3300048928 | Bacteria | 15506 |
| 584 | Ga0496125_0011749 | 3300048928 | Bacteria | 8728 |
| 585 | Ga0496125_0031631 | 3300048928 | Bacteria | 4713 |
| 586 | Ga0496125_0033201 | 3300048928 | Bacteria | 4572 |
| 587 | Ga0496126_0041394 | 3300048929 | Bacteria | 4264 |
| 588 | Ga0496126_0251997 | 3300048929 | Bacteria | 1471 |
| 589 | Ga0501031_0016788 | 3300049568 | Bacteria | 4755 |
| 590 | Ga0501034_0003465 | 3300049571 | Bacteria | 17957 |
| 591 | Ga0501036_0054150 | 3300049572 | Bacteria | 3398 |
| 592 | Ga0501043_0000108 | 3300049579 | Bacteria | 77329 |
| 593 | Ga0501043_0158691 | 3300049579 | Bacteria | 1768 |
| 594 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 595 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 596 | Ga0501047_0034461 | 3300049581 | Bacteria | 4888 |
| 597 | Ga0501048_0001920 | 3300049582 | Bacteria | 15783 |
| 598 | Ga0501198_000004 | 3300049649 | Bacteria | 175146 |
| 599 | Ga0501222_000038 | 3300049662 | Bacteria | 51424 |
| 600 | Ga0501225_0005517 | 3300049705 | Bacteria | 3709 |
| 601 | Ga0501080_0029262 | 3300049742 | Bacteria | 5127 |
| 602 | Ga0501262_000089 | 3300049759 | Bacteria | 11464 |
| 603 | Ga0501035_0027582 | 3300049822 | Bacteria | 5190 |
| 604 | Ga0501044_0125424 | 3300049823 | Bacteria | 2565 |
| 605 | nmdc:mga03683_30727_c1 | 3300050489 | Bacteria | 2150 |
| 606 | nmdc:mga03683_6077_c1 | 3300050489 | Bacteria | 4117 |
| 607 | nmdc:mga03n38_11395_c1 | 3300050490 | Bacteria | 3311 |
| 608 | nmdc:mga0yw44_47317_c1 | 3300050492 | Bacteria | 2588 |
| 609 | nmdc:mga0yw44_87248_c1 | 3300050492 | Bacteria | 1967 |
| 610 | nmdc:mga0k408_12821_c1 | 3300050493 | Bacteria | 4587 |
| 611 | nmdc:mga0k408_19542_c1 | 3300050493 | Bacteria | 1648 |
| 612 | nmdc:mga0k408_31195_c1 | 3300050493 | Bacteria | 3042 |
| 613 | nmdc:mga0k408_66695_c1 | 3300050493 | Bacteria | 2097 |
| 614 | nmdc:mga0k408_83979_c1 | 3300050493 | Bacteria | 1868 |
| 615 | nmdc:mga06z11_15487_c1 | 3300050494 | Bacteria | 3405 |
| 616 | nmdc:mga07m45_18698_c1 | 3300050496 | Bacteria | 3747 |
| 617 | nmdc:mga07m45_2629_c1 | 3300050496 | Bacteria | 8453 |
| 618 | nmdc:mga07m45_43_c1 | 3300050496 | Bacteria | 58364 |
| 619 | nmdc:mga07m45_6037_c1 | 3300050496 | Bacteria | 6097 |
| 620 | nmdc:mga07m45_8516_c1 | 3300050496 | Bacteria | 5276 |
| 621 | nmdc:mga07m45_96992_c1 | 3300050496 | Bacteria | 1692 |
| 622 | nmdc:mga09592_38208_c1 | 3300050508 | Bacteria | 4029 |
| 623 | Ga0495601_0005518 | 3300053077 | Bacteria | 7380 |
| 624 | Ga0500635_0000083 | 3300053080 | Bacteria | 61980 |
| 625 | Ga0500578_0001187 | 3300053086 | Bacteria | 27526 |
| 626 | Ga0500643_005807 | 3300053087 | Bacteria | 5260 |
| 627 | Ga0500644_0008921 | 3300053088 | Bacteria | 2663 |
| 628 | Ga0500651_0000060 | 3300053093 | Bacteria | 71500 |
| 629 | Ga0500571_000072 | 3300053110 | Bacteria | 31639 |
| 630 | Ga0500592_005993 | 3300053116 | Bacteria | 1934 |
| 631 | Ga0500593_000719 | 3300053117 | Bacteria | 12590 |
| 632 | Ga0500607_000307 | 3300053121 | Bacteria | 46367 |
| 633 | Ga0500608_016465 | 3300053122 | Bacteria | 3340 |
| 634 | Ga0500628_006231 | 3300053129 | Bacteria | 2010 |
| 635 | Ga0500652_005313 | 3300053131 | Bacteria | 4045 |
| 636 | Ga0500655_000073 | 3300053133 | Bacteria | 26840 |
| 637 | Ga0500658_0000402 | 3300053134 | Bacteria | 18742 |
| 638 | Ga0500658_0005354 | 3300053134 | Bacteria | 4774 |
| 639 | Ga0500568_0000566 | 3300053139 | Bacteria | 27162 |
| 640 | Ga0500574_022373 | 3300053141 | Bacteria | 1613 |
| 641 | Ga0500590_043658 | 3300053148 | Bacteria | 2298 |
| 642 | Ga0500616_0011263 | 3300053153 | Bacteria | 5296 |
| 643 | Ga0500622_0005574 | 3300053156 | Bacteria | 7513 |
| 644 | Ga0500627_0000611 | 3300053158 | Bacteria | 9530 |
| 645 | Ga0500634_0056048 | 3300053161 | Bacteria | 2106 |
| 646 | Ga0500636_0015791 | 3300053177 | Bacteria | 4450 |
| 647 | Ga0500636_0021077 | 3300053177 | Bacteria | 3860 |
| 648 | Ga0500645_000551 | 3300053730 | Bacteria | 24776 |
| 649 | Ga0466962_0042682 | 3300061719 | Bacteria | 2170 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100173509 | Ga0070675_1001735092 | 360 |
| 2 | 3300014325 | Ga0163163_10338984 | Ga0163163_103389842 | 360 |
| 3 | 3300025960 | Ga0207651_10013818 | Ga0207651_100138185 | 360 |
| 4 | 3300046519 | Ga0495632_0057832 | Ga0495632_0057832_739_1881 | 372 |
| 5 | 3300046663 | Ga0495635_0169570 | Ga0495635_0169570_22_1152 | 374 |
| 6 | 3300053141 | Ga0500574_022373 | Ga0500574_022373_469_1599 | 374 |
| 7 | 3300005564 | Ga0070664_100062437 | Ga0070664_1000624372 | 376 |
| 8 | 3300025945 | Ga0207679_10039026 | Ga0207679_100390263 | 376 |
| 9 | 3300050493 | nmdc:mga0k408_19542_c1 | nmdc:mga0k408_19542_c1_115_1365 | 390 |
| 10 | 3300005334 | Ga0068869_100000287 | Ga0068869_1000002874 | 394 |
| 11 | 3300005339 | Ga0070660_100120676 | Ga0070660_1001206762 | 394 |
| 12 | 3300005353 | Ga0070669_100056027 | Ga0070669_1000560273 | 394 |
| 13 | 3300005354 | Ga0070675_100034185 | Ga0070675_1000341853 | 394 |
| 14 | 3300005455 | Ga0070663_100008422 | Ga0070663_1000084223 | 394 |
| 15 | 3300005457 | Ga0070662_100044278 | Ga0070662_1000442783 | 394 |
| 16 | 3300005539 | Ga0068853_100012659 | Ga0068853_1000126596 | 394 |
| 17 | 3300005614 | Ga0068856_100044244 | Ga0068856_1000442444 | 394 |
| 18 | 3300005615 | Ga0070702_100016784 | Ga0070702_1000167844 | 394 |
| 19 | 3300005616 | Ga0068852_100036080 | Ga0068852_1000360804 | 394 |
| 20 | 3300005719 | Ga0068861_100003637 | Ga0068861_10000363711 | 394 |
| 21 | 3300005844 | Ga0068862_100033948 | Ga0068862_1000339483 | 394 |
| 22 | 3300006358 | Ga0068871_100161165 | Ga0068871_1001611652 | 394 |
| 23 | 3300009098 | Ga0105245_10012538 | Ga0105245_100125386 | 394 |
| 24 | 3300013105 | Ga0157369_10081780 | Ga0157369_100817804 | 394 |
| 25 | 3300013308 | Ga0157375_10115965 | Ga0157375_101159653 | 394 |
| 26 | 3300014969 | Ga0157376_10022619 | Ga0157376_100226194 | 394 |
| 27 | 3300017792 | Ga0163161_10040498 | Ga0163161_100404984 | 394 |
| 28 | 3300025923 | Ga0207681_10012637 | Ga0207681_100126373 | 394 |
| 29 | 3300025926 | Ga0207659_10052298 | Ga0207659_100522983 | 394 |
| 30 | 3300025933 | Ga0207706_10018240 | Ga0207706_100182404 | 394 |
| 31 | 3300025941 | Ga0207711_10003076 | Ga0207711_1000307611 | 394 |
| 32 | 3300025942 | Ga0207689_10000612 | Ga0207689_1000061216 | 394 |
| 33 | 3300025972 | Ga0207668_10050027 | Ga0207668_100500273 | 394 |
| 34 | 3300026067 | Ga0207678_10022647 | Ga0207678_100226474 | 394 |
| 35 | 3300026118 | Ga0207675_100026328 | Ga0207675_1000263284 | 394 |
| 36 | 3300039450 | Ga0436363_0017561 | Ga0436363_0017561_607_1887 | 394 |
| 37 | 3300048908 | Ga0496105_0148611 | Ga0496105_0148611_194_1477 | 394 |
| 38 | 3300048909 | Ga0496106_0114856 | Ga0496106_0114856_559_1842 | 394 |
| 39 | 3300009174 | Ga0105241_10044114 | Ga0105241_100441142 | 395 |
| 40 | 3300013102 | Ga0157371_10059889 | Ga0157371_100598892 | 395 |
| 41 | 3300025940 | Ga0207691_10049434 | Ga0207691_100494344 | 395 |
| 42 | 3300026088 | Ga0207641_10088860 | Ga0207641_100888602 | 395 |
| 43 | 3300045051 | Ga0451576_0261999 | Ga0451576_0261999_162_1490 | 395 |
| 44 | 3300048915 | Ga0496112_0172800 | Ga0496112_0172800_810_2096 | 395 |
| 45 | 3300005547 | Ga0070693_100058619 | Ga0070693_1000586192 | 396 |
| 46 | 3300005578 | Ga0068854_100115156 | Ga0068854_1001151562 | 396 |
| 47 | 3300013105 | Ga0157369_10125342 | Ga0157369_101253422 | 396 |
| 48 | 3300013105 | Ga0157369_10058774 | Ga0157369_100587742 | 397 |
| 49 | 3300048926 | Ga0496123_0065375 | Ga0496123_0065375_1064_2278 | 400 |
| 50 | 3300005841 | Ga0068863_100076670 | Ga0068863_1000766702 | 401 |
| 51 | 3300009177 | Ga0105248_10286801 | Ga0105248_102868012 | 401 |
| 52 | 3300013308 | Ga0157375_10003841 | Ga0157375_100038418 | 401 |
| 53 | 3300025918 | Ga0207662_10028972 | Ga0207662_100289722 | 401 |
| 54 | 3300026088 | Ga0207641_10141180 | Ga0207641_101411802 | 401 |
| 55 | 3300042136 | Ga0450900_005977 | Ga0450900_005977_35_1252 | 401 |
| 56 | 3300002705 | JGI25156J39149_1000580 | JGI25156J39149_10005806 | 402 |
| 57 | 3300002738 | JGI25154J39366_1002077 | JGI25154J39366_10020772 | 402 |
| 58 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_100001852 | 402 |
| 59 | 3300003752 | Ga0055539_1001838 | Ga0055539_10018384 | 402 |
| 60 | 3300005327 | Ga0070658_10031609 | Ga0070658_100316092 | 402 |
| 61 | 3300005329 | Ga0070683_100109166 | Ga0070683_1001091663 | 402 |
| 62 | 3300005339 | Ga0070660_100058455 | Ga0070660_1000584554 | 402 |
| 63 | 3300005344 | Ga0070661_100046547 | Ga0070661_1000465473 | 402 |
| 64 | 3300005366 | Ga0070659_100020087 | Ga0070659_1000200874 | 402 |
| 65 | 3300005535 | Ga0070684_100055868 | Ga0070684_1000558681 | 402 |
| 66 | 3300005539 | Ga0068853_100041702 | Ga0068853_1000417022 | 402 |
| 67 | 3300005564 | Ga0070664_100060889 | Ga0070664_1000608893 | 402 |
| 68 | 3300005577 | Ga0068857_100023278 | Ga0068857_1000232783 | 402 |
| 69 | 3300005577 | Ga0068857_100157107 | Ga0068857_1001571072 | 402 |
| 70 | 3300005614 | Ga0068856_100003216 | Ga0068856_1000032163 | 402 |
| 71 | 3300005616 | Ga0068852_100038370 | Ga0068852_1000383701 | 402 |
| 72 | 3300010375 | Ga0105239_10015144 | Ga0105239_100151446 | 402 |
| 73 | 3300013100 | Ga0157373_10004841 | Ga0157373_100048417 | 402 |
| 74 | 3300013307 | Ga0157372_10027798 | Ga0157372_100277984 | 402 |
| 75 | 3300013307 | Ga0157372_10035793 | Ga0157372_100357934 | 402 |
| 76 | 3300025246 | Ga0209646_1000188 | Ga0209646_100018851 | 402 |
| 77 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033243 | 402 |
| 78 | 3300025253 | Ga0209677_100481 | Ga0209677_10048114 | 402 |
| 79 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024243 | 402 |
| 80 | 3300025909 | Ga0207705_10154284 | Ga0207705_101542842 | 402 |
| 81 | 3300025919 | Ga0207657_10065328 | Ga0207657_100653282 | 402 |
| 82 | 3300025920 | Ga0207649_10005941 | Ga0207649_100059414 | 402 |
| 83 | 3300025924 | Ga0207694_10114119 | Ga0207694_101141192 | 402 |
| 84 | 3300025945 | Ga0207679_10014320 | Ga0207679_100143204 | 402 |
| 85 | 3300025949 | Ga0207667_10241059 | Ga0207667_102410591 | 402 |
| 86 | 3300026041 | Ga0207639_10045284 | Ga0207639_100452842 | 402 |
| 87 | 3300026078 | Ga0207702_10003082 | Ga0207702_1000308214 | 402 |
| 88 | 3300026078 | Ga0207702_10030039 | Ga0207702_100300393 | 402 |
| 89 | 3300026116 | Ga0207674_10005245 | Ga0207674_1000524516 | 402 |
| 90 | 3300026116 | Ga0207674_10047633 | Ga0207674_100476333 | 402 |
| 91 | 3300005367 | Ga0070667_100012223 | Ga0070667_1000122233 | 403 |
| 92 | 3300005617 | Ga0068859_100190764 | Ga0068859_1001907642 | 403 |
| 93 | 3300005842 | Ga0068858_100021085 | Ga0068858_1000210857 | 403 |
| 94 | 3300005843 | Ga0068860_100014733 | Ga0068860_1000147336 | 403 |
| 95 | 3300006931 | Ga0097620_100190765 | Ga0097620_1001907652 | 403 |
| 96 | 3300013308 | Ga0157375_10030763 | Ga0157375_100307634 | 403 |
| 97 | 3300014326 | Ga0157380_10030446 | Ga0157380_100304462 | 403 |
| 98 | 3300014968 | Ga0157379_10155785 | Ga0157379_101557852 | 403 |
| 99 | 3300025909 | Ga0207705_10015877 | Ga0207705_100158771 | 403 |
| 100 | 3300025986 | Ga0207658_10013798 | Ga0207658_100137985 | 403 |
| 101 | 3300026035 | Ga0207703_10028371 | Ga0207703_100283712 | 403 |
| 102 | 3300028381 | Ga0268264_10004874 | Ga0268264_1000487410 | 403 |
| 103 | 3300031649 | Ga0307514_10000906 | Ga0307514_1000090623 | 406 |
| 104 | 3300042876 | Ga0451577_0005521 | Ga0451577_0005521_9274_10554 | 407 |
| 105 | 3300005364 | Ga0070673_100143009 | Ga0070673_1001430092 | 410 |
| 106 | 3300025925 | Ga0207650_10081398 | Ga0207650_100813982 | 410 |
| 107 | 3300035086 | Ga0373934_0023631 | Ga0373934_0023631_618_2051 | 410 |
| 108 | 3300028794 | Ga0307515_10007089 | Ga0307515_100070895 | 411 |
| 109 | 3300025294 | Ga0209025_1016017 | Ga0209025_10160173 | 413 |
| 110 | 3300048929 | Ga0496126_0251997 | Ga0496126_0251997_39_1292 | 413 |
| 111 | 3300046460 | Ga0495638_0036450 | Ga0495638_0036450_1083_2345 | 415 |
| 112 | 3300005336 | Ga0070680_100038104 | Ga0070680_1000381044 | 417 |
| 113 | 3300005530 | Ga0070679_100012199 | Ga0070679_1000121992 | 417 |
| 114 | 3300025917 | Ga0207660_10065531 | Ga0207660_100655313 | 417 |
| 115 | 3300025921 | Ga0207652_10028749 | Ga0207652_100287493 | 417 |
| 116 | 3300044656 | Ga0466969_0040205 | Ga0466969_0040205_893_2203 | 418 |
| 117 | 3300044683 | Ga0466965_0030575 | Ga0466965_0030575_160_1470 | 418 |
| 118 | 3300044684 | Ga0466966_0004262 | Ga0466966_0004262_7499_8809 | 418 |
| 119 | 3300044694 | Ga0466963_0074533 | Ga0466963_0074533_912_2222 | 418 |
| 120 | 3300044765 | Ga0466970_0018325 | Ga0466970_0018325_2155_3465 | 418 |
| 121 | 3300045049 | Ga0466959_0131630 | Ga0466959_0131630_74_1384 | 418 |
| 122 | 3300003316 | rootH1_10012602 | rootH1_100126023 | 419 |
| 123 | 3300003320 | rootH2_10053692 | rootH2_100536922 | 419 |
| 124 | 3300003322 | rootL2_10006461 | rootL2_100064614 | 419 |
| 125 | 3300044719 | Ga0466971_0014151 | Ga0466971_0014151_1871_3322 | 419 |
| 126 | 3300061719 | Ga0466962_0042682 | Ga0466962_0042682_551_2002 | 419 |
| 127 | 3300003347 | JGI26128J50194_1000266 | JGI26128J50194_10002663 | 420 |
| 128 | 3300003794 | Ga0055531_10001576 | Ga0055531_1000157610 | 420 |
| 129 | 3300025303 | Ga0209051_1004714 | Ga0209051_10047145 | 420 |
| 130 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039185 | 420 |
| 131 | 3300027526 | Ga0209968_1000181 | Ga0209968_10001815 | 420 |
| 132 | 3300027695 | Ga0209966_1000013 | Ga0209966_100001332 | 420 |
| 133 | 3300053080 | Ga0500635_0000083 | Ga0500635_0000083_25396_26706 | 420 |
| 134 | 3300017792 | Ga0163161_10000732 | Ga0163161_100007329 | 423 |
| 135 | 3300042876 | Ga0451577_0023550 | Ga0451577_0023550_2789_4066 | 423 |
| 136 | 3300005327 | Ga0070658_10243920 | Ga0070658_102439201 | 424 |
| 137 | 3300005330 | Ga0070690_100032656 | Ga0070690_1000326561 | 424 |
| 138 | 3300005331 | Ga0070670_100154711 | Ga0070670_1001547112 | 424 |
| 139 | 3300005331 | Ga0070670_100165460 | Ga0070670_1001654601 | 424 |
| 140 | 3300005355 | Ga0070671_100001257 | Ga0070671_1000012574 | 424 |
| 141 | 3300005355 | Ga0070671_100063638 | Ga0070671_1000636383 | 424 |
| 142 | 3300005355 | Ga0070671_100199313 | Ga0070671_1001993131 | 424 |
| 143 | 3300005457 | Ga0070662_100098211 | Ga0070662_1000982112 | 424 |
| 144 | 3300005543 | Ga0070672_100226214 | Ga0070672_1002262142 | 424 |
| 145 | 3300005616 | Ga0068852_100123030 | Ga0068852_1001230302 | 424 |
| 146 | 3300005616 | Ga0068852_100191672 | Ga0068852_1001916722 | 424 |
| 147 | 3300005841 | Ga0068863_100146913 | Ga0068863_1001469132 | 424 |
| 148 | 3300005843 | Ga0068860_100065460 | Ga0068860_1000654602 | 424 |
| 149 | 3300005843 | Ga0068860_100274664 | Ga0068860_1002746642 | 424 |
| 150 | 3300006353 | Ga0075370_10003113 | Ga0075370_100031132 | 424 |
| 151 | 3300006358 | Ga0068871_100094982 | Ga0068871_1000949822 | 424 |
| 152 | 3300009177 | Ga0105248_10021275 | Ga0105248_100212756 | 424 |
| 153 | 3300009553 | Ga0105249_10030259 | Ga0105249_100302595 | 424 |
| 154 | 3300014326 | Ga0157380_10268146 | Ga0157380_102681462 | 424 |
| 155 | 3300025907 | Ga0207645_10045497 | Ga0207645_100454973 | 424 |
| 156 | 3300025925 | Ga0207650_10002632 | Ga0207650_100026327 | 424 |
| 157 | 3300025931 | Ga0207644_10011269 | Ga0207644_100112694 | 424 |
| 158 | 3300025933 | Ga0207706_10024971 | Ga0207706_100249714 | 424 |
| 159 | 3300025940 | Ga0207691_10267235 | Ga0207691_102672352 | 424 |
| 160 | 3300025941 | Ga0207711_10028938 | Ga0207711_100289383 | 424 |
| 161 | 3300026088 | Ga0207641_10112844 | Ga0207641_101128442 | 424 |
| 162 | 3300026121 | Ga0207683_10067726 | Ga0207683_100677262 | 424 |
| 163 | 3300026142 | Ga0207698_10051771 | Ga0207698_100517712 | 424 |
| 164 | 3300028381 | Ga0268264_10048502 | Ga0268264_100485024 | 424 |
| 165 | 3300028794 | Ga0307515_10002116 | Ga0307515_1000211623 | 424 |
| 166 | 3300030745 | Ga0316182_1299437 | Ga0316182_12994375 | 424 |
| 167 | 3300031730 | Ga0307516_10002516 | Ga0307516_100025167 | 424 |
| 168 | 3300036401 | Ga0373937_0065202 | Ga0373937_0065202_493_1779 | 424 |
| 169 | 3300037471 | Ga0395905_0022523 | Ga0395905_0022523_563_1849 | 424 |
| 170 | 3300042876 | Ga0451577_0015023 | Ga0451577_0015023_182_1504 | 424 |
| 171 | 3300046681 | Ga0495647_0035008 | Ga0495647_0035008_102_1388 | 424 |
| 172 | 3300046681 | Ga0495647_0053416 | Ga0495647_0053416_185_1477 | 424 |
| 173 | 3300048907 | Ga0496104_0055347 | Ga0496104_0055347_436_1728 | 424 |
| 174 | 3300050496 | nmdc:mga07m45_8516_c1 | nmdc:mga07m45_8516_c1_471_1757 | 424 |
| 175 | 3300053077 | Ga0495601_0005518 | Ga0495601_0005518_5988_7274 | 424 |
| 176 | 3300006237 | Ga0097621_100090546 | Ga0097621_1000905462 | 425 |
| 177 | 3300025893 | Ga0207682_10064533 | Ga0207682_100645331 | 425 |
| 178 | 3300031730 | Ga0307516_10002985 | Ga0307516_100029857 | 425 |
| 179 | 3300044658 | Ga0466972_0052631 | Ga0466972_0052631_303_1601 | 425 |
| 180 | iso_pu_bacteria | 2585428057 | 2587726337 | 425 |
| 181 | iso_pu_bacteria | 2585428058 | 2587731767 | 425 |
| 182 | iso_pu_bacteria | 2588253510 | 2588292273 | 425 |
| 183 | iso_pu_bacteria | 2643221592 | 2643970874 | 425 |
| 184 | iso_pu_bacteria | 2643221625 | 2644138876 | 425 |
| 185 | iso_pu_bacteria | 2643221644 | 2644245421 | 425 |
| 186 | iso_pu_bacteria | 2643221648 | 2644273893 | 425 |
| 187 | iso_pu_bacteria | 2738543013 | 2739248489 | 425 |
| 188 | iso_pu_bacteria | 2831265667 | 2831268345 | 425 |
| 189 | iso_pu_bacteria | 2838054893 | 2838060526 | 425 |
| 190 | iso_pu_bacteria | 2839138175 | 2839138324 | 425 |
| 191 | iso_pu_bacteria | 2842677519 | 2842679202 | 425 |
| 192 | iso_pu_bacteria | 2842733646 | 2842735415 | 425 |
| 193 | iso_pu_bacteria | 2881101125 | 2881103768 | 425 |
| 194 | iso_pu_bacteria | 2885192300 | 2885193471 | 425 |
| 195 | iso_pu_bacteria | 2885198086 | 2885198108 | 425 |
| 196 | iso_pu_bacteria | 2885211737 | 2885212512 | 425 |
| 197 | iso_pu_bacteria | 2899924645 | 2899928859 | 425 |
| 198 | iso_pu_bacteria | 2904449895 | 2904452185 | 425 |
| 199 | iso_pu_bacteria | 2904456579 | 2904458671 | 425 |
| 200 | iso_pu_bacteria | 2904541872 | 2904549443 | 425 |
| 201 | iso_pu_bacteria | 2919462493 | 2919466236 | 425 |
| 202 | iso_pu_bacteria | 2928037797 | 2928043205 | 425 |
| 203 | iso_pu_bacteria | 2928044640 | 2928051082 | 425 |
| 204 | iso_pu_bacteria | 2928051484 | 2928058698 | 425 |
| 205 | iso_pu_bacteria | 2928064002 | 2928066070 | 425 |
| 206 | iso_pu_bacteria | 2928070936 | 2928078094 | 425 |
| 207 | iso_pu_bacteria | 2928084124 | 2928087997 | 425 |
| 208 | iso_pu_bacteria | 2929160207 | 2929164812 | 425 |
| 209 | iso_pu_bacteria | 2929520902 | 2929523274 | 425 |
| 210 | 3300003187 | JGI25151J46595_10009197 | JGI25151J46595_100091973 | 426 |
| 211 | 3300006177 | Ga0075362_10032338 | Ga0075362_100323382 | 426 |
| 212 | 3300025292 | Ga0209676_1015056 | Ga0209676_10150562 | 426 |
| 213 | 3300028794 | Ga0307515_10001540 | Ga0307515_100015405 | 426 |
| 214 | 3300038443 | Ga0395901_0002361 | Ga0395901_0002361_15410_16717 | 426 |
| 215 | 3300046539 | Ga0495621_0013490 | Ga0495621_0013490_941_2242 | 426 |
| 216 | 3300048910 | Ga0496107_0112337 | Ga0496107_0112337_653_1954 | 426 |
| 217 | 3300048911 | Ga0496108_0045772 | Ga0496108_0045772_488_1789 | 426 |
| 218 | 3300048913 | Ga0496110_0047354 | Ga0496110_0047354_2042_3343 | 426 |
| 219 | 3300048914 | Ga0496111_0062504 | Ga0496111_0062504_454_1755 | 426 |
| 220 | 3300048917 | Ga0496114_0069210 | Ga0496114_0069210_227_1528 | 426 |
| 221 | iso_pu_bacteria | 2904479285 | 2904479669 | 426 |
| 222 | 3300005339 | Ga0070660_100041992 | Ga0070660_1000419921 | 427 |
| 223 | 3300005563 | Ga0068855_100046677 | Ga0068855_1000466772 | 427 |
| 224 | 3300009093 | Ga0105240_10012099 | Ga0105240_1001209910 | 427 |
| 225 | 3300009551 | Ga0105238_10164108 | Ga0105238_101641082 | 427 |
| 226 | 3300025303 | Ga0209051_1009297 | Ga0209051_10092975 | 427 |
| 227 | 3300025913 | Ga0207695_10212642 | Ga0207695_102126421 | 427 |
| 228 | 3300037312 | Ga0395899_0009628 | Ga0395899_0009628_3313_4596 | 427 |
| 229 | 3300037418 | Ga0395900_0048025 | Ga0395900_0048025_1572_2855 | 427 |
| 230 | 3300037466 | Ga0395898_0006475 | Ga0395898_0006475_2676_3959 | 427 |
| 231 | 3300037466 | Ga0395898_0090952 | Ga0395898_0090952_899_2182 | 427 |
| 232 | 3300037471 | Ga0395905_0000290 | Ga0395905_0000290_71103_72386 | 427 |
| 233 | 3300037471 | Ga0395905_0005564 | Ga0395905_0005564_3396_4679 | 427 |
| 234 | 3300037471 | Ga0395905_0018855 | Ga0395905_0018855_1759_3042 | 427 |
| 235 | 3300044683 | Ga0466965_0042945 | Ga0466965_0042945_461_1759 | 427 |
| 236 | 3300044712 | Ga0453684_0330143 | Ga0453684_0330143_280_1581 | 427 |
| 237 | 3300046528 | Ga0495642_0003027 | Ga0495642_0003027_2171_3484 | 427 |
| 238 | 3300049571 | Ga0501034_0003465 | Ga0501034_0003465_1369_2652 | 427 |
| 239 | 3300049572 | Ga0501036_0054150 | Ga0501036_0054150_1194_2477 | 427 |
| 240 | 3300049579 | Ga0501043_0158691 | Ga0501043_0158691_348_1631 | 427 |
| 241 | 3300049581 | Ga0501047_0034461 | Ga0501047_0034461_2937_4220 | 427 |
| 242 | 3300049742 | Ga0501080_0029262 | Ga0501080_0029262_1523_2806 | 427 |
| 243 | 3300049822 | Ga0501035_0027582 | Ga0501035_0027582_2101_3384 | 427 |
| 244 | 3300049823 | Ga0501044_0125424 | Ga0501044_0125424_534_1817 | 427 |
| 245 | 3300002773 | JGI25152J39213_1012061 | JGI25152J39213_10120612 | 428 |
| 246 | 3300003215 | JGI25153J46596_10005823 | JGI25153J46596_100058236 | 428 |
| 247 | 3300003771 | Ga0055526_1002276 | Ga0055526_100227618 | 428 |
| 248 | 3300003775 | Ga0055524_1000079 | Ga0055524_100007996 | 428 |
| 249 | 3300005262 | Ga0065165_1006821 | Ga0065165_10068215 | 428 |
| 250 | 3300005328 | Ga0070676_10022583 | Ga0070676_100225831 | 428 |
| 251 | 3300005331 | Ga0070670_100005784 | Ga0070670_1000057845 | 428 |
| 252 | 3300005333 | Ga0070677_10000217 | Ga0070677_100002179 | 428 |
| 253 | 3300005335 | Ga0070666_10156426 | Ga0070666_101564262 | 428 |
| 254 | 3300005344 | Ga0070661_100001326 | Ga0070661_1000013265 | 428 |
| 255 | 3300005353 | Ga0070669_100008450 | Ga0070669_1000084502 | 428 |
| 256 | 3300005354 | Ga0070675_100003222 | Ga0070675_1000032229 | 428 |
| 257 | 3300005355 | Ga0070671_100004463 | Ga0070671_10000446313 | 428 |
| 258 | 3300005356 | Ga0070674_100004729 | Ga0070674_1000047292 | 428 |
| 259 | 3300005356 | Ga0070674_100034524 | Ga0070674_1000345241 | 428 |
| 260 | 3300005364 | Ga0070673_100007267 | Ga0070673_1000072674 | 428 |
| 261 | 3300005366 | Ga0070659_100000336 | Ga0070659_10000033634 | 428 |
| 262 | 3300005456 | Ga0070678_100002650 | Ga0070678_1000026504 | 428 |
| 263 | 3300005459 | Ga0068867_100063045 | Ga0068867_1000630451 | 428 |
| 264 | 3300005543 | Ga0070672_100000137 | Ga0070672_10000013715 | 428 |
| 265 | 3300005564 | Ga0070664_100033391 | Ga0070664_1000333914 | 428 |
| 266 | 3300005564 | Ga0070664_100228165 | Ga0070664_1002281652 | 428 |
| 267 | 3300005616 | Ga0068852_100091838 | Ga0068852_1000918382 | 428 |
| 268 | 3300005616 | Ga0068852_100161112 | Ga0068852_1001611122 | 428 |
| 269 | 3300005618 | Ga0068864_100025113 | Ga0068864_1000251134 | 428 |
| 270 | 3300005841 | Ga0068863_100150167 | Ga0068863_1001501671 | 428 |
| 271 | 3300006048 | Ga0075363_100058828 | Ga0075363_1000588282 | 428 |
| 272 | 3300017792 | Ga0163161_10063515 | Ga0163161_100635152 | 428 |
| 273 | 3300025245 | Ga0207425_1010655 | Ga0207425_10106552 | 428 |
| 274 | 3300025258 | Ga0209129_1000041 | Ga0209129_100004127 | 428 |
| 275 | 3300025295 | Ga0209564_1000029 | Ga0209564_1000029173 | 428 |
| 276 | 3300025297 | Ga0209758_1000043 | Ga0209758_1000043267 | 428 |
| 277 | 3300025297 | Ga0209758_1000057 | Ga0209758_10000577 | 428 |
| 278 | 3300025299 | Ga0209256_1000011 | Ga0209256_100001197 | 428 |
| 279 | 3300025893 | Ga0207682_10001876 | Ga0207682_100018761 | 428 |
| 280 | 3300025903 | Ga0207680_10173246 | Ga0207680_101732462 | 428 |
| 281 | 3300025907 | Ga0207645_10006998 | Ga0207645_100069985 | 428 |
| 282 | 3300025920 | Ga0207649_10123145 | Ga0207649_101231452 | 428 |
| 283 | 3300025923 | Ga0207681_10035178 | Ga0207681_100351782 | 428 |
| 284 | 3300025925 | Ga0207650_10000909 | Ga0207650_100009099 | 428 |
| 285 | 3300025926 | Ga0207659_10001432 | Ga0207659_1000143211 | 428 |
| 286 | 3300025931 | Ga0207644_10002037 | Ga0207644_100020378 | 428 |
| 287 | 3300025931 | Ga0207644_10079599 | Ga0207644_100795993 | 428 |
| 288 | 3300025937 | Ga0207669_10001718 | Ga0207669_100017189 | 428 |
| 289 | 3300025940 | Ga0207691_10001983 | Ga0207691_100019836 | 428 |
| 290 | 3300025960 | Ga0207651_10003939 | Ga0207651_100039394 | 428 |
| 291 | 3300026067 | Ga0207678_10194045 | Ga0207678_101940452 | 428 |
| 292 | 3300026088 | Ga0207641_10107015 | Ga0207641_101070154 | 428 |
| 293 | 3300026089 | Ga0207648_10015115 | Ga0207648_100151155 | 428 |
| 294 | 3300026089 | Ga0207648_10085317 | Ga0207648_100853173 | 428 |
| 295 | 3300026095 | Ga0207676_10096598 | Ga0207676_100965982 | 428 |
| 296 | 3300026142 | Ga0207698_10107427 | Ga0207698_101074272 | 428 |
| 297 | 3300030522 | Ga0307512_10029293 | Ga0307512_100292934 | 428 |
| 298 | 3300031616 | Ga0307508_10000140 | Ga0307508_1000014032 | 428 |
| 299 | 3300031731 | Ga0307405_10010625 | Ga0307405_100106255 | 428 |
| 300 | 3300031852 | Ga0307410_10008468 | Ga0307410_100084685 | 428 |
| 301 | 3300031995 | Ga0307409_100220645 | Ga0307409_1002206451 | 428 |
| 302 | 3300032002 | Ga0307416_100089342 | Ga0307416_1000893423 | 428 |
| 303 | 3300032005 | Ga0307411_10009715 | Ga0307411_100097152 | 428 |
| 304 | 3300037471 | Ga0395905_0043408 | Ga0395905_0043408_859_2175 | 428 |
| 305 | 3300042007 | Ga0439449_0006001 | Ga0439449_0006001_1174_2460 | 428 |
| 306 | 3300042015 | Ga0439462_0002448 | Ga0439462_0002448_1233_2519 | 428 |
| 307 | 3300042121 | Ga0450919_000116 | Ga0450919_000116_6444_7745 | 428 |
| 308 | 3300042531 | Ga0450918_000016 | Ga0450918_000016_4412_5713 | 428 |
| 309 | 3300044673 | Ga0453683_0001803 | Ga0453683_0001803_10395_11681 | 428 |
| 310 | 3300044684 | Ga0466966_0031299 | Ga0466966_0031299_214_1554 | 428 |
| 311 | 3300048905 | Ga0496102_0007033 | Ga0496102_0007033_5833_7134 | 428 |
| 312 | 3300048908 | Ga0496105_0237734 | Ga0496105_0237734_90_1397 | 428 |
| 313 | 3300048917 | Ga0496114_0018269 | Ga0496114_0018269_1962_3263 | 428 |
| 314 | 3300049649 | Ga0501198_000004 | Ga0501198_000004_67091_68416 | 428 |
| 315 | 3300049662 | Ga0501222_000038 | Ga0501222_000038_6582_7907 | 428 |
| 316 | 3300050493 | nmdc:mga0k408_66695_c1 | nmdc:mga0k408_66695_c1_268_1569 | 428 |
| 317 | 3300053129 | Ga0500628_006231 | Ga0500628_006231_376_1677 | 428 |
| 318 | 3300053148 | Ga0500590_043658 | Ga0500590_043658_618_1925 | 428 |
| 319 | 3300053156 | Ga0500622_0005574 | Ga0500622_0005574_5808_7109 | 428 |
| 320 | 3300003761 | Ga0055535_1000087 | Ga0055535_10000878 | 429 |
| 321 | 3300003761 | Ga0055535_1000341 | Ga0055535_100034117 | 429 |
| 322 | 3300003762 | Ga0055542_1000369 | Ga0055542_100036925 | 429 |
| 323 | 3300003763 | Ga0055529_1000139 | Ga0055529_100013915 | 429 |
| 324 | 3300003781 | Ga0055536_1009113 | Ga0055536_10091132 | 429 |
| 325 | 3300003784 | Ga0055534_1000791 | Ga0055534_100079116 | 429 |
| 326 | 3300003791 | Ga0055530_10016452 | Ga0055530_100164522 | 429 |
| 327 | 3300003792 | Ga0055540_1001724 | Ga0055540_10017243 | 429 |
| 328 | 3300003794 | Ga0055531_10001925 | Ga0055531_1000192514 | 429 |
| 329 | 3300005327 | Ga0070658_10024241 | Ga0070658_100242414 | 429 |
| 330 | 3300005355 | Ga0070671_100006195 | Ga0070671_1000061953 | 429 |
| 331 | 3300005366 | Ga0070659_100025222 | Ga0070659_1000252223 | 429 |
| 332 | 3300005455 | Ga0070663_100000305 | Ga0070663_10000030516 | 429 |
| 333 | 3300005459 | Ga0068867_100000005 | Ga0068867_10000000518 | 429 |
| 334 | 3300005548 | Ga0070665_100005645 | Ga0070665_1000056452 | 429 |
| 335 | 3300005548 | Ga0070665_100093378 | Ga0070665_1000933784 | 429 |
| 336 | 3300005563 | Ga0068855_100028957 | Ga0068855_1000289576 | 429 |
| 337 | 3300005841 | Ga0068863_100073540 | Ga0068863_1000735403 | 429 |
| 338 | 3300006038 | Ga0075365_10075041 | Ga0075365_100750413 | 429 |
| 339 | 3300006042 | Ga0075368_10040295 | Ga0075368_100402952 | 429 |
| 340 | 3300006177 | Ga0075362_10009242 | Ga0075362_100092422 | 429 |
| 341 | 3300006177 | Ga0075362_10009848 | Ga0075362_100098482 | 429 |
| 342 | 3300006195 | Ga0075366_10001021 | Ga0075366_1000102111 | 429 |
| 343 | 3300006195 | Ga0075366_10003258 | Ga0075366_100032583 | 429 |
| 344 | 3300006195 | Ga0075366_10030314 | Ga0075366_100303142 | 429 |
| 345 | 3300006353 | Ga0075370_10000147 | Ga0075370_1000014712 | 429 |
| 346 | 3300006358 | Ga0068871_100173105 | Ga0068871_1001731052 | 429 |
| 347 | 3300006880 | Ga0075429_100001204 | Ga0075429_1000012042 | 429 |
| 348 | 3300009098 | Ga0105245_10124303 | Ga0105245_101243032 | 429 |
| 349 | 3300009148 | Ga0105243_10043399 | Ga0105243_100433992 | 429 |
| 350 | 3300013105 | Ga0157369_10027568 | Ga0157369_100275685 | 429 |
| 351 | 3300013306 | Ga0163162_10015372 | Ga0163162_100153724 | 429 |
| 352 | 3300013306 | Ga0163162_10291449 | Ga0163162_102914492 | 429 |
| 353 | 3300013306 | Ga0163162_10307654 | Ga0163162_103076542 | 429 |
| 354 | 3300013308 | Ga0157375_10249124 | Ga0157375_102491242 | 429 |
| 355 | 3300014497 | Ga0182008_10007715 | Ga0182008_100077154 | 429 |
| 356 | 3300014497 | Ga0182008_10012582 | Ga0182008_100125825 | 429 |
| 357 | 3300014745 | Ga0157377_10000244 | Ga0157377_1000024419 | 429 |
| 358 | 3300014968 | Ga0157379_10233151 | Ga0157379_102331512 | 429 |
| 359 | 3300015262 | Ga0182007_10004000 | Ga0182007_100040005 | 429 |
| 360 | 3300015683 | Ga0183362_10001 | Ga0183362_10001415 | 429 |
| 361 | 3300017792 | Ga0163161_10008119 | Ga0163161_100081194 | 429 |
| 362 | 3300017792 | Ga0163161_10033240 | Ga0163161_100332402 | 429 |
| 363 | 3300025231 | Ga0207427_100446 | Ga0207427_10044616 | 429 |
| 364 | 3300025242 | Ga0209258_100044 | Ga0209258_10004415 | 429 |
| 365 | 3300025253 | Ga0209677_101298 | Ga0209677_10129814 | 429 |
| 366 | 3300025256 | Ga0209759_1015090 | Ga0209759_10150902 | 429 |
| 367 | 3300025272 | Ga0209455_1000048 | Ga0209455_100004815 | 429 |
| 368 | 3300025291 | Ga0209675_1000714 | Ga0209675_100071410 | 429 |
| 369 | 3300025292 | Ga0209676_1001516 | Ga0209676_10015165 | 429 |
| 370 | 3300025294 | Ga0209025_1000641 | Ga0209025_100064126 | 429 |
| 371 | 3300025294 | Ga0209025_1051435 | Ga0209025_10514351 | 429 |
| 372 | 3300025298 | Ga0209050_1000529 | Ga0209050_100052925 | 429 |
| 373 | 3300025298 | Ga0209050_1000571 | Ga0209050_100057118 | 429 |
| 374 | 3300025303 | Ga0209051_1001576 | Ga0209051_10015766 | 429 |
| 375 | 3300025303 | Ga0209051_1004457 | Ga0209051_100445711 | 429 |
| 376 | 3300025303 | Ga0209051_1018349 | Ga0209051_10183493 | 429 |
| 377 | 3300025304 | Ga0209257_1002876 | Ga0209257_10028765 | 429 |
| 378 | 3300025728 | Ga0207655_1001858 | Ga0207655_10018586 | 429 |
| 379 | 3300025914 | Ga0207671_10066282 | Ga0207671_100662822 | 429 |
| 380 | 3300025919 | Ga0207657_10042354 | Ga0207657_100423543 | 429 |
| 381 | 3300025924 | Ga0207694_10053316 | Ga0207694_100533162 | 429 |
| 382 | 3300025934 | Ga0207686_10093634 | Ga0207686_100936342 | 429 |
| 383 | 3300025935 | Ga0207709_10006267 | Ga0207709_100062674 | 429 |
| 384 | 3300025949 | Ga0207667_10025652 | Ga0207667_100256526 | 429 |
| 385 | 3300025960 | Ga0207651_10086738 | Ga0207651_100867383 | 429 |
| 386 | 3300025972 | Ga0207668_10082079 | Ga0207668_100820792 | 429 |
| 387 | 3300025986 | Ga0207658_10035048 | Ga0207658_100350483 | 429 |
| 388 | 3300026067 | Ga0207678_10001071 | Ga0207678_1000107111 | 429 |
| 389 | 3300026078 | Ga0207702_10034860 | Ga0207702_100348603 | 429 |
| 390 | 3300026089 | Ga0207648_10000541 | Ga0207648_1000054120 | 429 |
| 391 | 3300028379 | Ga0268266_10113816 | Ga0268266_101138163 | 429 |
| 392 | 3300028666 | Ga0265336_10000293 | Ga0265336_1000029319 | 429 |
| 393 | 3300028794 | Ga0307515_10001017 | Ga0307515_1000101725 | 429 |
| 394 | 3300028794 | Ga0307515_10004876 | Ga0307515_1000487612 | 429 |
| 395 | 3300028794 | Ga0307515_10005604 | Ga0307515_100056042 | 429 |
| 396 | 3300029957 | Ga0265324_10004430 | Ga0265324_100044306 | 429 |
| 397 | 3300031251 | Ga0265327_10004992 | Ga0265327_1000499213 | 429 |
| 398 | 3300031456 | Ga0307513_10012208 | Ga0307513_100122088 | 429 |
| 399 | 3300031456 | Ga0307513_10014115 | Ga0307513_100141154 | 429 |
| 400 | 3300031649 | Ga0307514_10000864 | Ga0307514_1000086423 | 429 |
| 401 | 3300032005 | Ga0307411_10056464 | Ga0307411_100564642 | 429 |
| 402 | 3300033179 | Ga0307507_10057228 | Ga0307507_100572281 | 429 |
| 403 | 3300037471 | Ga0395905_0007643 | Ga0395905_0007643_7554_8846 | 429 |
| 404 | 3300037471 | Ga0395905_0209480 | Ga0395905_0209480_265_1569 | 429 |
| 405 | 3300037471 | Ga0395905_0287238 | Ga0395905_0287238_67_1377 | 429 |
| 406 | 3300042004 | Ga0439445_0001699 | Ga0439445_0001699_3487_4782 | 429 |
| 407 | 3300042007 | Ga0439449_0000699 | Ga0439449_0000699_1467_2762 | 429 |
| 408 | 3300042010 | Ga0439452_005680 | Ga0439452_005680_1532_2827 | 429 |
| 409 | 3300042014 | Ga0439457_006531 | Ga0439457_006531_308_1603 | 429 |
| 410 | 3300042015 | Ga0439462_0003230 | Ga0439462_0003230_1610_2905 | 429 |
| 411 | 3300042128 | Ga0450897_000191 | Ga0450897_000191_1712_3007 | 429 |
| 412 | 3300042435 | Ga0439434_0003276 | Ga0439434_0003276_2507_3802 | 429 |
| 413 | 3300046475 | Ga0495639_0006660 | Ga0495639_0006660_2324_3619 | 429 |
| 414 | 3300046506 | Ga0495583_0002724 | Ga0495583_0002724_353_1663 | 429 |
| 415 | 3300046507 | Ga0495606_0003052 | Ga0495606_0003052_10667_11977 | 429 |
| 416 | 3300046520 | Ga0495637_0006481 | Ga0495637_0006481_4391_5686 | 429 |
| 417 | 3300046526 | Ga0495666_0065639 | Ga0495666_0065639_286_1608 | 429 |
| 418 | 3300046615 | Ga0495656_0000042 | Ga0495656_0000042_49667_50962 | 429 |
| 419 | 3300046615 | Ga0495656_0025279 | Ga0495656_0025279_594_1883 | 429 |
| 420 | 3300046663 | Ga0495635_0161516 | Ga0495635_0161516_174_1469 | 429 |
| 421 | 3300046674 | Ga0495588_0014266 | Ga0495588_0014266_196_1491 | 429 |
| 422 | 3300046683 | Ga0495658_0006741 | Ga0495658_0006741_1813_3108 | 429 |
| 423 | 3300046683 | Ga0495658_0036561 | Ga0495658_0036561_377_1690 | 429 |
| 424 | 3300046694 | Ga0495649_0004838 | Ga0495649_0004838_5149_6459 | 429 |
| 425 | 3300046794 | Ga0495589_0014386 | Ga0495589_0014386_456_1766 | 429 |
| 426 | 3300046809 | Ga0495600_0049804 | Ga0495600_0049804_1360_2655 | 429 |
| 427 | 3300047321 | Ga0495676_0033248 | Ga0495676_0033248_798_2093 | 429 |
| 428 | 3300047673 | Ga0495593_0016559 | Ga0495593_0016559_617_1912 | 429 |
| 429 | 3300047673 | Ga0495593_0051717 | Ga0495593_0051717_170_1492 | 429 |
| 430 | 3300048903 | Ga0496100_0008667 | Ga0496100_0008667_1907_3202 | 429 |
| 431 | 3300048904 | Ga0496101_0014829 | Ga0496101_0014829_3676_4971 | 429 |
| 432 | 3300048904 | Ga0496101_0018801 | Ga0496101_0018801_1576_2871 | 429 |
| 433 | 3300048905 | Ga0496102_0008548 | Ga0496102_0008548_2783_4078 | 429 |
| 434 | 3300048906 | Ga0496103_0048814 | Ga0496103_0048814_900_2195 | 429 |
| 435 | 3300048907 | Ga0496104_0012951 | Ga0496104_0012951_3290_4585 | 429 |
| 436 | 3300048908 | Ga0496105_0026935 | Ga0496105_0026935_2437_3732 | 429 |
| 437 | 3300048909 | Ga0496106_0006571 | Ga0496106_0006571_6009_7304 | 429 |
| 438 | 3300048920 | Ga0496117_0070880 | Ga0496117_0070880_557_1852 | 429 |
| 439 | 3300048921 | Ga0496118_0029380 | Ga0496118_0029380_1755_3050 | 429 |
| 440 | 3300048921 | Ga0496118_0147820 | Ga0496118_0147820_128_1423 | 429 |
| 441 | 3300048924 | Ga0496121_0024041 | Ga0496121_0024041_1573_2868 | 429 |
| 442 | 3300048927 | Ga0496124_0050534 | Ga0496124_0050534_595_1890 | 429 |
| 443 | 3300048927 | Ga0496124_0101627 | Ga0496124_0101627_486_1781 | 429 |
| 444 | 3300049579 | Ga0501043_0000108 | Ga0501043_0000108_16274_17590 | 429 |
| 445 | 3300049580 | Ga0501046_0000050 | Ga0501046_0000050_59778_61094 | 429 |
| 446 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_307738_309054 | 429 |
| 447 | 3300049582 | Ga0501048_0001920 | Ga0501048_0001920_4044_5360 | 429 |
| 448 | 3300049705 | Ga0501225_0005517 | Ga0501225_0005517_1681_2976 | 429 |
| 449 | 3300049759 | Ga0501262_000089 | Ga0501262_000089_3088_4383 | 429 |
| 450 | 3300050489 | nmdc:mga03683_6077_c1 | nmdc:mga03683_6077_c1_2539_3834 | 429 |
| 451 | 3300050492 | nmdc:mga0yw44_47317_c1 | nmdc:mga0yw44_47317_c1_176_1465 | 429 |
| 452 | 3300050492 | nmdc:mga0yw44_87248_c1 | nmdc:mga0yw44_87248_c1_501_1796 | 429 |
| 453 | 3300050493 | nmdc:mga0k408_12821_c1 | nmdc:mga0k408_12821_c1_1776_3092 | 429 |
| 454 | 3300050493 | nmdc:mga0k408_31195_c1 | nmdc:mga0k408_31195_c1_308_1618 | 429 |
| 455 | 3300050493 | nmdc:mga0k408_83979_c1 | nmdc:mga0k408_83979_c1_216_1511 | 429 |
| 456 | 3300050496 | nmdc:mga07m45_18698_c1 | nmdc:mga07m45_18698_c1_429_1724 | 429 |
| 457 | 3300050496 | nmdc:mga07m45_2629_c1 | nmdc:mga07m45_2629_c1_5738_7048 | 429 |
| 458 | 3300050496 | nmdc:mga07m45_96992_c1 | nmdc:mga07m45_96992_c1_124_1419 | 429 |
| 459 | 3300050508 | nmdc:mga09592_38208_c1 | nmdc:mga09592_38208_c1_2180_3493 | 429 |
| 460 | 3300053086 | Ga0500578_0001187 | Ga0500578_0001187_18100_19410 | 429 |
| 461 | 3300053087 | Ga0500643_005807 | Ga0500643_005807_2685_3980 | 429 |
| 462 | 3300053093 | Ga0500651_0000060 | Ga0500651_0000060_53593_54888 | 429 |
| 463 | 3300053110 | Ga0500571_000072 | Ga0500571_000072_8342_9637 | 429 |
| 464 | 3300053117 | Ga0500593_000719 | Ga0500593_000719_6110_7405 | 429 |
| 465 | 3300053121 | Ga0500607_000307 | Ga0500607_000307_1925_3220 | 429 |
| 466 | 3300053131 | Ga0500652_005313 | Ga0500652_005313_355_1671 | 429 |
| 467 | 3300053133 | Ga0500655_000073 | Ga0500655_000073_22925_24220 | 429 |
| 468 | 3300053134 | Ga0500658_0005354 | Ga0500658_0005354_2156_3451 | 429 |
| 469 | 3300053158 | Ga0500627_0000611 | Ga0500627_0000611_5710_7005 | 429 |
| 470 | 3300053161 | Ga0500634_0056048 | Ga0500634_0056048_43_1338 | 429 |
| 471 | 3300053177 | Ga0500636_0015791 | Ga0500636_0015791_1672_2967 | 429 |
| 472 | 3300053177 | Ga0500636_0021077 | Ga0500636_0021077_1901_3211 | 429 |
| 473 | iso_pu_bacteria | 2513020051 | 2513230185 | 429 |
| 474 | iso_pu_bacteria | 2599185214 | 2599625404 | 429 |
| 475 | iso_pu_bacteria | 2599185226 | 2599673144 | 429 |
| 476 | iso_pu_bacteria | 2599185227 | 2599682814 | 429 |
| 477 | iso_pu_bacteria | 2599185229 | 2599694752 | 429 |
| 478 | iso_pu_bacteria | 2643221628 | 2644162086 | 429 |
| 479 | iso_pu_bacteria | 2643221658 | 2644328283 | 429 |
| 480 | iso_pu_bacteria | 2643221672 | 2644397594 | 429 |
| 481 | iso_pu_bacteria | 2643221683 | 2644464379 | 429 |
| 482 | iso_pu_bacteria | 2738541277 | 2738718458 | 429 |
| 483 | iso_pu_bacteria | 2738541307 | 2738882917 | 429 |
| 484 | iso_pu_bacteria | 2738543019 | 2739281645 | 429 |
| 485 | iso_pu_bacteria | 2818991446 | 2819602734 | 429 |
| 486 | iso_pu_bacteria | 2928115317 | 2928119427 | 429 |
| 487 | iso_pu_bacteria | 2945909444 | 2945910577 | 429 |
| 488 | iso_pu_bacteria | 2945945610 | 2945946467 | 429 |
| 489 | iso_pu_bacteria | 2945972063 | 2945976086 | 429 |
| 490 | iso_pu_bacteria | 2945984333 | 2945987348 | 429 |
| 491 | iso_pu_bacteria | 2954767861 | 2954771265 | 429 |
| 492 | 3300033180 | Ga0307510_10001745 | Ga0307510_100017454 | 430 |
| 493 | 3300048924 | Ga0496121_0002132 | Ga0496121_0002132_9934_11280 | 430 |
| 494 | 3300048928 | Ga0496125_0004737 | Ga0496125_0004737_4647_5993 | 430 |
| 495 | iso_pu_bacteria | 2939631187 | 2939632308 | 430 |
| 496 | 3300044842 | Ga0466957_0057058 | Ga0466957_0057058_871_2244 | 431 |
| 497 | 3300050489 | nmdc:mga03683_30727_c1 | nmdc:mga03683_30727_c1_124_1422 | 431 |
| 498 | iso_pu_bacteria | 2932422444 | 2932426229 | 431 |
| 499 | 3300002773 | JGI25152J39213_1004936 | JGI25152J39213_10049365 | 432 |
| 500 | 3300002773 | JGI25152J39213_1005343 | JGI25152J39213_10053435 | 432 |
| 501 | 3300002774 | JGI25150J39212_1001393 | JGI25150J39212_10013935 | 432 |
| 502 | 3300002774 | JGI25150J39212_1002644 | JGI25150J39212_10026445 | 432 |
| 503 | 3300002987 | JGI25159J45721_1003763 | JGI25159J45721_10037633 | 432 |
| 504 | 3300002987 | JGI25159J45721_1004844 | JGI25159J45721_10048443 | 432 |
| 505 | 3300003187 | JGI25151J46595_10001831 | JGI25151J46595_100018315 | 432 |
| 506 | 3300003187 | JGI25151J46595_10005441 | JGI25151J46595_100054412 | 432 |
| 507 | 3300003187 | JGI25151J46595_10018787 | JGI25151J46595_100187874 | 432 |
| 508 | 3300003215 | JGI25153J46596_10011446 | JGI25153J46596_100114465 | 432 |
| 509 | 3300003215 | JGI25153J46596_10014727 | JGI25153J46596_100147274 | 432 |
| 510 | 3300003354 | JGI25160J50197_1010564 | JGI25160J50197_10105645 | 432 |
| 511 | 3300003354 | JGI25160J50197_1011159 | JGI25160J50197_10111594 | 432 |
| 512 | 3300003374 | JGI25161J50226_1004628 | JGI25161J50226_10046284 | 432 |
| 513 | 3300003374 | JGI25161J50226_1006980 | JGI25161J50226_10069802 | 432 |
| 514 | 3300003578 | Ga0006562J51391_1006645 | Ga0006562J51391_10066455 | 432 |
| 515 | 3300003771 | Ga0055526_1014054 | Ga0055526_10140545 | 432 |
| 516 | 3300003771 | Ga0055526_1014663 | Ga0055526_10146634 | 432 |
| 517 | 3300003773 | Ga0055537_1000280 | Ga0055537_10002805 | 432 |
| 518 | 3300003773 | Ga0055537_1005896 | Ga0055537_10058964 | 432 |
| 519 | 3300003773 | Ga0055537_1011949 | Ga0055537_10119492 | 432 |
| 520 | 3300003775 | Ga0055524_1012124 | Ga0055524_10121242 | 432 |
| 521 | 3300003775 | Ga0055524_1012783 | Ga0055524_10127834 | 432 |
| 522 | 3300003781 | Ga0055536_1004671 | Ga0055536_10046712 | 432 |
| 523 | 3300003781 | Ga0055536_1007647 | Ga0055536_10076473 | 432 |
| 524 | 3300003784 | Ga0055534_1000064 | Ga0055534_10000643 | 432 |
| 525 | 3300003784 | Ga0055534_1006789 | Ga0055534_10067894 | 432 |
| 526 | 3300003784 | Ga0055534_1007865 | Ga0055534_10078653 | 432 |
| 527 | 3300003790 | Ga0055528_1002261 | Ga0055528_100226112 | 432 |
| 528 | 3300003790 | Ga0055528_1012925 | Ga0055528_10129254 | 432 |
| 529 | 3300003791 | Ga0055530_10001020 | Ga0055530_100010202 | 432 |
| 530 | 3300003791 | Ga0055530_10004609 | Ga0055530_100046098 | 432 |
| 531 | 3300003792 | Ga0055540_1002881 | Ga0055540_10028818 | 432 |
| 532 | 3300004625 | Ga0055543_1003413 | Ga0055543_10034135 | 432 |
| 533 | 3300005262 | Ga0065165_1008660 | Ga0065165_10086605 | 432 |
| 534 | 3300005288 | Ga0065714_10005593 | Ga0065714_100055935 | 432 |
| 535 | 3300005353 | Ga0070669_100024209 | Ga0070669_1000242095 | 432 |
| 536 | 3300005539 | Ga0068853_100031348 | Ga0068853_1000313485 | 432 |
| 537 | 3300006038 | Ga0075365_10040741 | Ga0075365_100407412 | 432 |
| 538 | 3300006048 | Ga0075363_100023932 | Ga0075363_1000239322 | 432 |
| 539 | 3300006048 | Ga0075363_100054333 | Ga0075363_1000543332 | 432 |
| 540 | 3300006178 | Ga0075367_10024473 | Ga0075367_100244732 | 432 |
| 541 | 3300006178 | Ga0075367_10102503 | Ga0075367_101025031 | 432 |
| 542 | 3300006195 | Ga0075366_10029726 | Ga0075366_100297262 | 432 |
| 543 | 3300006195 | Ga0075366_10033555 | Ga0075366_100335554 | 432 |
| 544 | 3300006195 | Ga0075366_10042171 | Ga0075366_100421714 | 432 |
| 545 | 3300006353 | Ga0075370_10010078 | Ga0075370_100100785 | 432 |
| 546 | 3300006353 | Ga0075370_10036382 | Ga0075370_100363824 | 432 |
| 547 | 3300006353 | Ga0075370_10105845 | Ga0075370_101058451 | 432 |
| 548 | 3300006948 | Ga0099826_10010348 | Ga0099826_100103487 | 432 |
| 549 | 3300009036 | Ga0105244_10005429 | Ga0105244_100054295 | 432 |
| 550 | 3300009148 | Ga0105243_10024244 | Ga0105243_100242443 | 432 |
| 551 | 3300015261 | Ga0182006_1009229 | Ga0182006_10092295 | 432 |
| 552 | 3300015262 | Ga0182007_10005239 | Ga0182007_100052393 | 432 |
| 553 | 3300017792 | Ga0163161_10041194 | Ga0163161_100411942 | 432 |
| 554 | 3300025229 | Ga0209147_101975 | Ga0209147_1019755 | 432 |
| 555 | 3300025242 | Ga0209258_100133 | Ga0209258_10013324 | 432 |
| 556 | 3300025245 | Ga0207425_1000144 | Ga0207425_100014436 | 432 |
| 557 | 3300025245 | Ga0207425_1005421 | Ga0207425_10054215 | 432 |
| 558 | 3300025254 | Ga0209148_1000361 | Ga0209148_100036124 | 432 |
| 559 | 3300025258 | Ga0209129_1000033 | Ga0209129_100003338 | 432 |
| 560 | 3300025258 | Ga0209129_1001468 | Ga0209129_100146818 | 432 |
| 561 | 3300025258 | Ga0209129_1005418 | Ga0209129_10054185 | 432 |
| 562 | 3300025263 | Ga0209565_1000088 | Ga0209565_100008835 | 432 |
| 563 | 3300025263 | Ga0209565_1001197 | Ga0209565_100119714 | 432 |
| 564 | 3300025273 | Ga0209673_1000064 | Ga0209673_1000064122 | 432 |
| 565 | 3300025273 | Ga0209673_1003717 | Ga0209673_10037175 | 432 |
| 566 | 3300025273 | Ga0209673_1014147 | Ga0209673_10141472 | 432 |
| 567 | 3300025284 | Ga0209130_1000885 | Ga0209130_100088525 | 432 |
| 568 | 3300025284 | Ga0209130_1004900 | Ga0209130_10049005 | 432 |
| 569 | 3300025291 | Ga0209675_1000036 | Ga0209675_1000036122 | 432 |
| 570 | 3300025291 | Ga0209675_1001680 | Ga0209675_10016808 | 432 |
| 571 | 3300025291 | Ga0209675_1004727 | Ga0209675_10047275 | 432 |
| 572 | 3300025292 | Ga0209676_1000111 | Ga0209676_100011146 | 432 |
| 573 | 3300025292 | Ga0209676_1001319 | Ga0209676_100131925 | 432 |
| 574 | 3300025292 | Ga0209676_1001878 | Ga0209676_100187821 | 432 |
| 575 | 3300025292 | Ga0209676_1029281 | Ga0209676_10292811 | 432 |
| 576 | 3300025294 | Ga0209025_1000424 | Ga0209025_100042445 | 432 |
| 577 | 3300025294 | Ga0209025_1001578 | Ga0209025_100157830 | 432 |
| 578 | 3300025294 | Ga0209025_1015764 | Ga0209025_10157645 | 432 |
| 579 | 3300025294 | Ga0209025_1028524 | Ga0209025_10285243 | 432 |
| 580 | 3300025295 | Ga0209564_1000070 | Ga0209564_1000070276 | 432 |
| 581 | 3300025295 | Ga0209564_1000964 | Ga0209564_100096438 | 432 |
| 582 | 3300025297 | Ga0209758_1000027 | Ga0209758_100002738 | 432 |
| 583 | 3300025297 | Ga0209758_1010287 | Ga0209758_10102874 | 432 |
| 584 | 3300025298 | Ga0209050_1000111 | Ga0209050_1000111146 | 432 |
| 585 | 3300025299 | Ga0209256_1000047 | Ga0209256_1000047288 | 432 |
| 586 | 3300025299 | Ga0209256_1000903 | Ga0209256_100090338 | 432 |
| 587 | 3300025302 | Ga0207426_1000115 | Ga0207426_1000115186 | 432 |
| 588 | 3300025302 | Ga0207426_1000742 | Ga0207426_100074238 | 432 |
| 589 | 3300025303 | Ga0209051_1000046 | Ga0209051_1000046195 | 432 |
| 590 | 3300025303 | Ga0209051_1000344 | Ga0209051_10003446 | 432 |
| 591 | 3300025303 | Ga0209051_1000609 | Ga0209051_10006095 | 432 |
| 592 | 3300025304 | Ga0209257_1000344 | Ga0209257_10003446 | 432 |
| 593 | 3300025304 | Ga0209257_1010960 | Ga0209257_10109603 | 432 |
| 594 | 3300025321 | Ga0207656_10028124 | Ga0207656_100281242 | 432 |
| 595 | 3300025933 | Ga0207706_10027020 | Ga0207706_100270205 | 432 |
| 596 | 3300025935 | Ga0207709_10000963 | Ga0207709_1000096315 | 432 |
| 597 | 3300027614 | Ga0209970_1001500 | Ga0209970_10015002 | 432 |
| 598 | 3300027666 | Ga0209282_1015920 | Ga0209282_10159203 | 432 |
| 599 | 3300030731 | Ga0316177_1172157 | Ga0316177_11721572 | 432 |
| 600 | 3300030736 | Ga0316180_1073943 | Ga0316180_10739432 | 432 |
| 601 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004156 | 432 |
| 602 | 3300031456 | Ga0307513_10086262 | Ga0307513_100862624 | 432 |
| 603 | 3300031548 | Ga0307408_100019661 | Ga0307408_1000196614 | 432 |
| 604 | 3300031649 | Ga0307514_10058457 | Ga0307514_100584572 | 432 |
| 605 | 3300031901 | Ga0307406_10012613 | Ga0307406_100126133 | 432 |
| 606 | 3300031911 | Ga0307412_10079086 | Ga0307412_100790863 | 432 |
| 607 | 3300038443 | Ga0395901_0082509 | Ga0395901_0082509_1829_3166 | 432 |
| 608 | 3300041413 | Ga0439465_0006250 | Ga0439465_0006250_1135_2442 | 432 |
| 609 | 3300042115 | Ga0450911_000854 | Ga0450911_000854_2153_3454 | 432 |
| 610 | 3300042135 | Ga0450899_003007 | Ga0450899_003007_289_1596 | 432 |
| 611 | 3300042145 | Ga0450906_003885 | Ga0450906_003885_1727_3034 | 432 |
| 612 | 3300042147 | Ga0450910_000924 | Ga0450910_000924_749_2056 | 432 |
| 613 | 3300042435 | Ga0439434_0002935 | Ga0439434_0002935_1848_3155 | 432 |
| 614 | 3300046512 | Ga0495610_0078948 | Ga0495610_0078948_21_1328 | 432 |
| 615 | 3300046513 | Ga0495616_0011837 | Ga0495616_0011837_1776_3083 | 432 |
| 616 | 3300046518 | Ga0495631_0010173 | Ga0495631_0010173_1790_3097 | 432 |
| 617 | 3300046539 | Ga0495621_0003480 | Ga0495621_0003480_1790_3097 | 432 |
| 618 | 3300046660 | Ga0495625_0000292 | Ga0495625_0000292_60292_61599 | 432 |
| 619 | 3300048919 | Ga0496116_0141726 | Ga0496116_0141726_25_1332 | 432 |
| 620 | 3300048920 | Ga0496117_0003590 | Ga0496117_0003590_6452_7759 | 432 |
| 621 | 3300048921 | Ga0496118_0040534 | Ga0496118_0040534_486_1793 | 432 |
| 622 | 3300048927 | Ga0496124_0040134 | Ga0496124_0040134_2519_3826 | 432 |
| 623 | 3300048927 | Ga0496124_0063507 | Ga0496124_0063507_1568_2869 | 432 |
| 624 | 3300048928 | Ga0496125_0033201 | Ga0496125_0033201_37_1338 | 432 |
| 625 | 3300050490 | nmdc:mga03n38_11395_c1 | nmdc:mga03n38_11395_c1_612_1934 | 432 |
| 626 | 3300050494 | nmdc:mga06z11_15487_c1 | nmdc:mga06z11_15487_c1_1370_2692 | 432 |
| 627 | 3300050496 | nmdc:mga07m45_43_c1 | nmdc:mga07m45_43_c1_2998_4305 | 432 |
| 628 | 3300050496 | nmdc:mga07m45_6037_c1 | nmdc:mga07m45_6037_c1_477_1784 | 432 |
| 629 | 3300053116 | Ga0500592_005993 | Ga0500592_005993_390_1697 | 432 |
| 630 | 3300053122 | Ga0500608_016465 | Ga0500608_016465_202_1509 | 432 |
| 631 | 3300053134 | Ga0500658_0000402 | Ga0500658_0000402_15638_16945 | 432 |
| 632 | 3300053139 | Ga0500568_0000566 | Ga0500568_0000566_8878_10185 | 432 |
| 633 | 3300053153 | Ga0500616_0011263 | Ga0500616_0011263_2356_3663 | 432 |
| 634 | iso_pu_bacteria | 2511231002 | 2511243999 | 432 |
| 635 | iso_pu_bacteria | 2721755523 | 2722882741 | 432 |
| 636 | 3300021361 | Ga0213872_10010301 | Ga0213872_100103015 | 433 |
| 637 | 3300025919 | Ga0207657_10102433 | Ga0207657_101024332 | 433 |
| 638 | 3300039447 | Ga0436361_0348943 | Ga0436361_0348943_37428_38741 | 433 |
| 639 | 3300049568 | Ga0501031_0016788 | Ga0501031_0016788_1743_3203 | 433 |
| 640 | iso_pu_bacteria | 2547132374 | 2548501109 | 433 |
| 641 | iso_pu_bacteria | 2643221570 | 2643866816 | 433 |
| 642 | iso_pu_bacteria | 2643221596 | 2643993536 | 433 |
| 643 | iso_pu_bacteria | 2643221609 | 2644061121 | 433 |
| 644 | iso_pu_bacteria | 2643221652 | 2644294670 | 433 |
| 645 | iso_pu_bacteria | 2643221717 | 2644645793 | 433 |
| 646 | iso_pu_bacteria | 2738543012 | 2739243462 | 433 |
| 647 | iso_pu_bacteria | 2816332133 | 2816475746 | 433 |
| 648 | iso_pu_bacteria | 2842718218 | 2842719786 | 433 |
| 649 | iso_pu_bacteria | 2919704043 | 2919704247 | 433 |
| 650 | iso_pu_bacteria | 2974320154 | 2974323862 | 433 |
| 651 | iso_pu_bacteria | 2990710928 | 2990712772 | 433 |
| 652 | 3300042876 | Ga0451577_0000825 | Ga0451577_0000825_22850_24220 | 434 |
| 653 | 3300044712 | Ga0453684_0002253 | Ga0453684_0002253_23336_24706 | 434 |
| 654 | 3300045051 | Ga0451576_0015926 | Ga0451576_0015926_4383_5753 | 434 |
| 655 | 3300046558 | Ga0495633_0006679 | Ga0495633_0006679_610_1929 | 434 |
| 656 | 3300006946 | Ga0079104_1000025 | Ga0079104_1000025191 | 435 |
| 657 | 3300009148 | Ga0105243_10002660 | Ga0105243_1000266010 | 435 |
| 658 | 3300025934 | Ga0207686_10007360 | Ga0207686_100073602 | 435 |
| 659 | 3300025935 | Ga0207709_10000459 | Ga0207709_1000045937 | 435 |
| 660 | 3300027111 | Ga0209281_1000007 | Ga0209281_100000731 | 435 |
| 661 | 3300031238 | Ga0265332_10000020 | Ga0265332_10000020186 | 435 |
| 662 | 3300048925 | Ga0496122_0026483 | Ga0496122_0026483_2554_3876 | 435 |
| 663 | 3300048928 | Ga0496125_0011749 | Ga0496125_0011749_4883_6205 | 435 |
| 664 | 3300048929 | Ga0496126_0041394 | Ga0496126_0041394_1186_2508 | 435 |
| 665 | 3300053088 | Ga0500644_0008921 | Ga0500644_0008921_746_2053 | 435 |
| 666 | iso_pu_bacteria | 2894023352 | 2894026050 | 435 |
| 667 | 3300002987 | JGI25159J45721_1002711 | JGI25159J45721_10027118 | 436 |
| 668 | 3300003354 | JGI25160J50197_1000689 | JGI25160J50197_10006898 | 436 |
| 669 | 3300003374 | JGI25161J50226_1000008 | JGI25161J50226_1000008226 | 436 |
| 670 | 3300003771 | Ga0055526_1006373 | Ga0055526_10063731 | 436 |
| 671 | 3300003771 | Ga0055526_1007426 | Ga0055526_10074261 | 436 |
| 672 | 3300003773 | Ga0055537_1000383 | Ga0055537_100038325 | 436 |
| 673 | 3300003775 | Ga0055524_1000107 | Ga0055524_100010783 | 436 |
| 674 | 3300003784 | Ga0055534_1004009 | Ga0055534_10040094 | 436 |
| 675 | 3300003790 | Ga0055528_1001653 | Ga0055528_100165314 | 436 |
| 676 | 3300003791 | Ga0055530_10000121 | Ga0055530_1000012141 | 436 |
| 677 | 3300003792 | Ga0055540_1000021 | Ga0055540_1000021185 | 436 |
| 678 | 3300003794 | Ga0055531_10000774 | Ga0055531_100007746 | 436 |
| 679 | 3300004625 | Ga0055543_1000259 | Ga0055543_100025916 | 436 |
| 680 | 3300025284 | Ga0209130_1000186 | Ga0209130_100018679 | 436 |
| 681 | 3300025284 | Ga0209130_1000401 | Ga0209130_100040126 | 436 |
| 682 | 3300025291 | Ga0209675_1000503 | Ga0209675_10005035 | 436 |
| 683 | 3300025292 | Ga0209676_1000069 | Ga0209676_1000069113 | 436 |
| 684 | 3300025295 | Ga0209564_1001104 | Ga0209564_10011047 | 436 |
| 685 | 3300025295 | Ga0209564_1001141 | Ga0209564_10011417 | 436 |
| 686 | 3300025298 | Ga0209050_1000023 | Ga0209050_1000023288 | 436 |
| 687 | 3300025302 | Ga0207426_1000153 | Ga0207426_1000153177 | 436 |
| 688 | 3300025303 | Ga0209051_1000017 | Ga0209051_1000017288 | 436 |
| 689 | 3300025304 | Ga0209257_1000041 | Ga0209257_1000041288 | 436 |
| 690 | 3300027252 | Ga0209973_1002196 | Ga0209973_10021962 | 436 |
| 691 | 3300027876 | Ga0209974_10005911 | Ga0209974_100059114 | 436 |
| 692 | 3300031730 | Ga0307516_10173207 | Ga0307516_101732072 | 436 |
| 693 | 3300031901 | Ga0307406_10004684 | Ga0307406_100046847 | 436 |
| 694 | 3300031901 | Ga0307406_10024354 | Ga0307406_100243543 | 436 |
| 695 | 3300042876 | Ga0451577_0010087 | Ga0451577_0010087_4800_6116 | 436 |
| 696 | 3300044712 | Ga0453684_0019186 | Ga0453684_0019186_5749_7065 | 436 |
| 697 | 3300045051 | Ga0451576_0009978 | Ga0451576_0009978_6960_8276 | 436 |
| 698 | 3300048928 | Ga0496125_0031631 | Ga0496125_0031631_2475_3821 | 436 |
| 699 | 3300002704 | JGI25155J39150_1000005 | JGI25155J39150_1000005121 | 440 |
| 700 | 3300002705 | JGI25156J39149_1000006 | JGI25156J39149_1000006121 | 440 |
| 701 | 3300002738 | JGI25154J39366_1000015 | JGI25154J39366_1000015125 | 440 |
| 702 | 3300002741 | JGI25157J39369_1000016 | JGI25157J39369_100001659 | 440 |
| 703 | 3300025206 | Ga0209435_100010 | Ga0209435_100010132 | 440 |
| 704 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012010 | 440 |
| 705 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001665 | 440 |
| 706 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011641 | 440 |
| 707 | 3300025263 | Ga0209565_1000102 | Ga0209565_10001029 | 440 |
| 708 | 3300025273 | Ga0209673_1000189 | Ga0209673_1000189106 | 440 |
| 709 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031005 | 440 |
| 710 | 3300028573 | Ga0265334_10034907 | Ga0265334_100349072 | 440 |
| 711 | 3300031235 | Ga0265330_10000108 | Ga0265330_1000010835 | 440 |
| 712 | 3300031238 | Ga0265332_10000072 | Ga0265332_1000007235 | 440 |
| 713 | 3300031456 | Ga0307513_10000015 | Ga0307513_10000015163 | 440 |
| 714 | 3300031711 | Ga0265314_10000874 | Ga0265314_100008747 | 440 |
| 715 | 3300046542 | Ga0495597_0003090 | Ga0495597_0003090_2312_3700 | 440 |
| 716 | 3300053730 | Ga0500645_000551 | Ga0500645_000551_22440_23762 | 440 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w78-assembly1.cif.gz_A | e.coli folc in complex with dhpp and adp | 0.9574 | 10 | 428 |
| 3nrs-assembly1.cif.gz_A | crystal structure of ligand-free bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis c092 | 0.9526 | 10 | 428 |
| 1w7k-assembly1.cif.gz_A | e.coli folc in complex with adp, without folate substrate | 0.9516 | 10 | 428 |
| 3qcz-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound | 0.9494 | 10 | 428 |
| 3n2a-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis co92 | 0.9445 | 10 | 428 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P08192_1_287_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9651 | 10 | 294 | 3.40.1190.10 |
| af_M0R401_2_171_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.939 | 147 | 223 | 3.40.1190.10 |
| af_P08192_1_287_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9256 | 10 | 294 | 3.40.1190.10 |
| 3n2aA02 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain | 0.9185 | 295 | 428 | 3.90.190.20 |
| af_Q2FXR9_1_294_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9178 | 10 | 293 | 3.40.1190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0CQI6-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9762 | 10 | 426 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A6M1HWT5-F1-model_v4 | deleted | 0.975 | 65 | 293 |
|
| AF-A0A6L9KYK3-F1-model_v4 | Bifunctional folylpolyglutamate synthase/dihydrofolate synthase | 0.9741 | 9 | 286 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046654 |
| AF-A0A537CWG3-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9698 | 10 | 426 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046654 GO:0046656 GO:0046872 |
| AF-K2BNR1-F1-model_v4 | tetrahydrofolate synthase (EC 6.3.2.17) (Tetrahydrofolylpolyglutamate synthase) | 0.9681 | 10 | 428 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar