F476978

General Info

Members Datasets Scaffolds Average Seq Length
715 338 1430 93

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101963979|Ga0070711_1019639791
Length 94
Sequence VRLRRSGHSGAMCRNIRVLHNFEPPATSDEVQAAALQYVRKVSGAAKPSAANQAAFDQAVAAELLDALVTAAPPKDREVEAAKAKARAAERYGR

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
193 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
194 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
195 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
228 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
334 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2855683550 Micromonospora sp. RP3T Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.54
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 5.03
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 21.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101963979 3300005439 Bacteria 514
2 JGI24748J21848_1000006 3300002074 Bacteria 212677
3 JGI24034J26672_10000002 3300002239 Bacteria 925353
4 JGI24742J22300_10004538 3300002244 Bacteria 2277
5 JGI25406J46586_10017293 3300003203 Unclassified 2985
6 rootL2_10159167 3300003322 Bacteria 3196
7 Ga0065714_10243489 3300005288 Unclassified 790
8 Ga0065712_10009133 3300005290 Bacteria 2131
9 Ga0065712_10222665 3300005290 Unclassified 1036
10 Ga0065715_10156330 3300005293 Bacteria 1673
11 Ga0065707_10142594 3300005295 Bacteria 1753
12 Ga0065707_10144940 3300005295 Bacteria 1720
13 Ga0070658_10008767 3300005327 Bacteria 8126
14 Ga0070658_10080476 3300005327 Bacteria 2676
15 Ga0070676_10315210 3300005328 Unclassified 1065
16 Ga0070683_101138075 3300005329 Bacteria 750
17 Ga0070683_102230544 3300005329 Bacteria 526
18 Ga0070690_100920970 3300005330 Bacteria 685
19 Ga0070690_101757385 3300005330 Bacteria 505
20 Ga0070670_100325355 3300005331 Bacteria 1347
21 Ga0070670_100338414 3300005331 Bacteria 1320
22 Ga0070670_100496471 3300005331 Bacteria 1085
23 Ga0068869_100058722 3300005334 Unclassified 2814
24 Ga0068869_100224967 3300005334 Bacteria 1489
25 Ga0068869_101283392 3300005334 Bacteria 645
26 Ga0068869_101415321 3300005334 Bacteria 616
27 Ga0068868_100263661 3300005338 Bacteria 1454
28 Ga0070660_100311495 3300005339 Bacteria 1292
29 Ga0070689_100503521 3300005340 Bacteria 1038
30 Ga0070689_101614397 3300005340 Unclassified 589
31 Ga0070691_10092026 3300005341 Bacteria 1496
32 Ga0070687_100905318 3300005343 Bacteria 633
33 Ga0070661_100016842 3300005344 Bacteria 5174
34 Ga0070661_101277638 3300005344 Unclassified 615
35 Ga0070692_10122407 3300005345 Bacteria 1452
36 Ga0070668_100271576 3300005347 Unclassified 1413
37 Ga0070668_100565351 3300005347 Bacteria 991
38 Ga0070669_100022618 3300005353 Unclassified 4495
39 Ga0070669_100243842 3300005353 Unclassified 1429
40 Ga0070669_100405794 3300005353 Bacteria 1116
41 Ga0070675_100165467 3300005354 Unclassified 1904
42 Ga0070671_100042476 3300005355 Unclassified 3779
43 Ga0070671_100691520 3300005355 Bacteria 884
44 Ga0070674_100196018 3300005356 Bacteria 1556
45 Ga0070674_101968994 3300005356 Unclassified 532
46 Ga0070673_100532744 3300005364 Bacteria 1065
47 Ga0070673_101179858 3300005364 Bacteria 717
48 Ga0070673_101888426 3300005364 Unclassified 566
49 Ga0070688_100912689 3300005365 Unclassified 693
50 Ga0070659_100120805 3300005366 Bacteria 2122
51 Ga0070659_100219108 3300005366 Unclassified 1570
52 Ga0070659_100528165 3300005366 Bacteria 1008
53 Ga0070659_101628846 3300005366 Unclassified 576
54 Ga0070667_100185403 3300005367 Bacteria 1841
55 Ga0070667_100607740 3300005367 Bacteria 1008
56 Ga0070667_100608844 3300005367 Bacteria 1007
57 Ga0070667_100671110 3300005367 Bacteria 958
58 Ga0070703_10107142 3300005406 Bacteria 994
59 Ga0070713_101139303 3300005436 Unclassified 754
60 Ga0070710_10000074 3300005437 Bacteria 45220
61 Ga0070710_11122320 3300005437 Unclassified 578
62 Ga0070701_10149314 3300005438 Unclassified 1344
63 Ga0070701_10264744 3300005438 Bacteria 1043
64 Ga0070701_10416784 3300005438 Bacteria 854
65 Ga0070711_100542736 3300005439 Bacteria 964
66 Ga0070705_100175739 3300005440 Unclassified 1446
67 Ga0070700_100000062 3300005441 Bacteria 79866
68 Ga0070700_100008395 3300005441 Bacteria 5625
69 Ga0070700_100345561 3300005441 Bacteria 1101
70 Ga0070694_100000481 3300005444 Bacteria 21881
71 Ga0070694_100064603 3300005444 Unclassified 2505
72 Ga0070708_100062412 3300005445 Bacteria 3333
73 Ga0070708_100240191 3300005445 Bacteria 1701
74 Ga0070708_100931706 3300005445 Bacteria 815
75 Ga0070663_100811456 3300005455 Bacteria 803
76 Ga0070663_101750286 3300005455 Bacteria 556
77 Ga0070678_100758356 3300005456 Unclassified 878
78 Ga0070662_100675421 3300005457 Unclassified 873
79 Ga0070681_11848903 3300005458 Bacteria 531
80 Ga0070685_10775507 3300005466 Unclassified 705
81 Ga0070706_100073057 3300005467 Bacteria 3174
82 Ga0070707_100012820 3300005468 Bacteria 7826
83 Ga0070707_100031570 3300005468 Bacteria 5047
84 Ga0070707_100320956 3300005468 Bacteria 1505
85 Ga0070707_101580306 3300005468 Bacteria 623
86 Ga0070707_101875463 3300005468 Bacteria 567
87 Ga0070698_100061297 3300005471 Bacteria 3795
88 Ga0070698_100534692 3300005471 Bacteria 1111
89 Ga0070698_100887269 3300005471 Unclassified 837
90 Ga0070699_100854392 3300005518 Bacteria 833
91 Ga0070679_100285827 3300005530 Unclassified 1601
92 Ga0070679_101466343 3300005530 Bacteria 629
93 Ga0070679_101473505 3300005530 Unclassified 627
94 Ga0070684_100373152 3300005535 Bacteria 1313
95 Ga0070697_101607816 3300005536 Bacteria 581
96 Ga0070697_101929572 3300005536 Unclassified 528
97 Ga0068853_100669551 3300005539 Unclassified 988
98 Ga0070672_100053817 3300005543 Bacteria 3148
99 Ga0070686_100809359 3300005544 Bacteria 756
100 Ga0070686_101085792 3300005544 Bacteria 660
101 Ga0070695_100104089 3300005545 Unclassified 1916
102 Ga0070695_100244661 3300005545 Bacteria 1303
103 Ga0070695_100270911 3300005545 Bacteria 1244
104 Ga0070695_100304765 3300005545 Unclassified 1179
105 Ga0070696_100454462 3300005546 Unclassified 1011
106 Ga0070696_100478392 3300005546 Unclassified 987
107 Ga0070693_100136577 3300005547 Unclassified 1539
108 Ga0070693_100172271 3300005547 Unclassified 1387
109 Ga0070693_100583390 3300005547 Unclassified 805
110 Ga0070665_100024939 3300005548 Bacteria 6027
111 Ga0070665_100117113 3300005548 Bacteria 2666
112 Ga0070665_100234373 3300005548 Bacteria 1836
113 Ga0070704_100014439 3300005549 Unclassified 4934
114 Ga0070704_100292980 3300005549 Bacteria 1353
115 Ga0070704_100393903 3300005549 Bacteria 1180
116 Ga0070704_100477368 3300005549 Unclassified 1078
117 Ga0070704_100856534 3300005549 Bacteria 815
118 Ga0068855_100566382 3300005563 Bacteria 1228
119 Ga0068855_101418880 3300005563 Bacteria 715
120 Ga0070664_100028150 3300005564 Bacteria 4674
121 Ga0070664_101628200 3300005564 Bacteria 612
122 Ga0070664_102394834 3300005564 Bacteria 501
123 Ga0068857_100330599 3300005577 Bacteria 1409
124 Ga0068854_100124320 3300005578 Bacteria 1963
125 Ga0068854_101135324 3300005578 Unclassified 698
126 Ga0068854_102143735 3300005578 Bacteria 516
127 Ga0068856_100741799 3300005614 Bacteria 1002
128 Ga0068856_101164646 3300005614 Unclassified 788
129 Ga0068856_101723900 3300005614 Bacteria 639
130 Ga0068856_101832829 3300005614 Bacteria 618
131 Ga0068856_102314914 3300005614 Bacteria 545
132 Ga0070702_100035066 3300005615 Unclassified 2770
133 Ga0070702_100127006 3300005615 Bacteria 1605
134 Ga0068852_100001470 3300005616 Bacteria 15938
135 Ga0068852_101776117 3300005616 Bacteria 639
136 Ga0068859_100006037 3300005617 Bacteria 12300
137 Ga0068859_100034112 3300005617 Bacteria 5109
138 Ga0068859_100179530 3300005617 Bacteria 2199
139 Ga0068859_100456946 3300005617 Bacteria 1373
140 Ga0068859_100479361 3300005617 Bacteria 1340
141 Ga0068859_100569402 3300005617 Bacteria 1227
142 Ga0068859_100668069 3300005617 Bacteria 1130
143 Ga0068864_100304869 3300005618 Bacteria 1492
144 Ga0068864_100410410 3300005618 Bacteria 1288
145 Ga0068864_100962466 3300005618 Bacteria 845
146 Ga0068864_101846451 3300005618 Unclassified 610
147 Ga0068866_10008068 3300005718 Unclassified 4424
148 Ga0068866_10082205 3300005718 Bacteria 1732
149 Ga0068861_100058438 3300005719 Bacteria 2949
150 Ga0068861_101351907 3300005719 Bacteria 694
151 Ga0068851_10252804 3300005834 Unclassified 1000
152 Ga0068870_10313955 3300005840 Bacteria 994
153 Ga0068870_10987158 3300005840 Unclassified 600
154 Ga0068863_100119688 3300005841 Bacteria 2510
155 Ga0068863_100805927 3300005841 Unclassified 937
156 Ga0068863_100961177 3300005841 Bacteria 856
157 Ga0068858_100000227 3300005842 Bacteria 60951
158 Ga0068858_100126313 3300005842 Bacteria 2395
159 Ga0068858_100176828 3300005842 Bacteria 2014
160 Ga0068858_100314074 3300005842 Unclassified 1497
161 Ga0068858_100328753 3300005842 Unclassified 1462
162 Ga0068858_100652438 3300005842 Bacteria 1023
163 Ga0068858_100918724 3300005842 Bacteria 856
164 Ga0068860_100164578 3300005843 Bacteria 2140
165 Ga0068860_100516775 3300005843 Bacteria 1194
166 Ga0068860_101054256 3300005843 Bacteria 832
167 Ga0068862_100176928 3300005844 Bacteria 1913
168 Ga0081455_10005266 3300005937 Bacteria 14208
169 Ga0081455_10011324 3300005937 Bacteria 8972
170 Ga0081455_10197391 3300005937 Bacteria 1510
171 Ga0081538_10034483 3300005981 Bacteria 3345
172 Ga0081539_10000887 3300005985 Bacteria 57193
173 Ga0081539_10028223 3300005985 Bacteria 3533
174 Ga0081539_10084672 3300005985 Bacteria 1656
175 Ga0070717_10005311 3300006028 Bacteria 9389
176 Ga0075432_10145130 3300006058 Bacteria 908
177 Ga0070715_10289512 3300006163 Bacteria 872
178 Ga0070712_100373882 3300006175 Bacteria 1171
179 Ga0068871_100562692 3300006358 Unclassified 1034
180 Ga0068871_100876722 3300006358 Bacteria 831
181 Ga0068871_101362319 3300006358 Bacteria 668
182 Ga0075428_100007462 3300006844 Bacteria 12114
183 Ga0075430_100132524 3300006846 Bacteria 2077
184 Ga0075431_100001263 3300006847 Bacteria 23035
185 Ga0075431_100545391 3300006847 Bacteria 1147
186 Ga0075433_10027748 3300006852 Bacteria 4806
187 Ga0075433_10043943 3300006852 Bacteria 3881
188 Ga0075433_10142522 3300006852 Bacteria 2130
189 Ga0075433_10265730 3300006852 Bacteria 1521
190 Ga0075433_10345434 3300006852 Bacteria 1315
191 Ga0075434_100076692 3300006871 Bacteria 3337
192 Ga0075434_100138121 3300006871 Bacteria 2457
193 Ga0075434_100140510 3300006871 Bacteria 2434
194 Ga0075434_100195350 3300006871 Bacteria 2043
195 Ga0075429_100042999 3300006880 Bacteria 3930
196 Ga0075429_100518998 3300006880 Bacteria 1044
197 Ga0068865_101602959 3300006881 Bacteria 585
198 Ga0075436_100069817 3300006914 Unclassified 2428
199 Ga0097620_100006037 3300006931 Bacteria 12300
200 Ga0097620_100034110 3300006931 Bacteria 5109
201 Ga0097620_100179531 3300006931 Bacteria 2199
202 Ga0097620_100457015 3300006931 Bacteria 1373
203 Ga0097620_100479322 3300006931 Bacteria 1340
204 Ga0097620_100569436 3300006931 Bacteria 1227
205 Ga0097620_100668094 3300006931 Bacteria 1130
206 Ga0075435_100006687 3300007076 Bacteria 8177
207 Ga0075435_100412526 3300007076 Bacteria 1163
208 Ga0099794_10535534 3300007265 Unclassified 618
209 Ga0105240_10585009 3300009093 Unclassified 1231
210 Ga0105240_10665276 3300009093 Bacteria 1140
211 Ga0111539_10068944 3300009094 Bacteria 4176
212 Ga0111539_11596802 3300009094 Bacteria 756
213 Ga0105245_10291592 3300009098 Bacteria 1598
214 Ga0105245_10840767 3300009098 Unclassified 958
215 Ga0105245_10933369 3300009098 Bacteria 910
216 Ga0105245_13205844 3300009098 Unclassified 507
217 Ga0105247_10000001 3300009101 Bacteria 739726
218 Ga0105247_10036812 3300009101 Unclassified 2983
219 Ga0105247_10099233 3300009101 Bacteria 1860
220 Ga0105247_10131880 3300009101 Bacteria 1629
221 Ga0105247_10144818 3300009101 Bacteria 1560
222 Ga0105247_10191542 3300009101 Bacteria 1369
223 Ga0105247_10270285 3300009101 Bacteria 1169
224 Ga0114129_10000255 3300009147 Bacteria 60251
225 Ga0114129_10000853 3300009147 Bacteria 39495
226 Ga0114129_10006436 3300009147 Bacteria 16653
227 Ga0114129_10029398 3300009147 Bacteria 7785
228 Ga0114129_10034373 3300009147 Bacteria 7159
229 Ga0114129_10054216 3300009147 Bacteria 5622
230 Ga0114129_10867267 3300009147 Bacteria 1146
231 Ga0114129_13272172 3300009147 Bacteria 525
232 Ga0105243_10270109 3300009148 Bacteria 1526
233 Ga0105243_11754630 3300009148 Unclassified 651
234 Ga0105243_12133402 3300009148 Unclassified 596
235 Ga0105241_10098274 3300009174 Bacteria 2322
236 Ga0105241_10460536 3300009174 Bacteria 1126
237 Ga0105242_10201429 3300009176 Bacteria 1768
238 Ga0105242_11134631 3300009176 Bacteria 797
239 Ga0105248_10016145 3300009177 Bacteria 8216
240 Ga0105248_10017815 3300009177 Bacteria 7838
241 Ga0105248_10289001 3300009177 Bacteria 1846
242 Ga0105248_10550734 3300009177 Bacteria 1301
243 Ga0105248_10783273 3300009177 Bacteria 1076
244 Ga0105248_11793394 3300009177 Unclassified 696
245 Ga0105237_10049237 3300009545 Unclassified 4236
246 Ga0105237_10939747 3300009545 Bacteria 872
247 Ga0105238_10007038 3300009551 Bacteria 11247
248 Ga0105238_10095455 3300009551 Bacteria 2960
249 Ga0105238_12033314 3300009551 Unclassified 608
250 Ga0105239_10079217 3300010375 Unclassified 3615
251 Ga0105239_10145656 3300010375 Bacteria 2641
252 Ga0105239_10705820 3300010375 Bacteria 1153
253 Ga0105239_10949569 3300010375 Bacteria 987
254 Ga0105246_10450210 3300011119 Unclassified 1082
255 Ga0105246_10488459 3300011119 Unclassified 1043
256 Ga0105246_11188406 3300011119 Bacteria 701
257 Ga0157373_10159394 3300013100 Bacteria 1588
258 Ga0157373_10315793 3300013100 Bacteria 1111
259 Ga0157371_11399420 3300013102 Unclassified 543
260 Ga0157369_10003361 3300013105 Bacteria 18997
261 Ga0157369_10068402 3300013105 Bacteria 3816
262 Ga0157369_11669874 3300013105 Bacteria 647
263 Ga0157374_10157378 3300013296 Bacteria 2212
264 Ga0157374_11781519 3300013296 Unclassified 641
265 Ga0157378_10106623 3300013297 Unclassified 2563
266 Ga0157378_10800516 3300013297 Unclassified 968
267 Ga0157378_12834093 3300013297 Unclassified 537
268 Ga0163162_10042541 3300013306 Bacteria 4548
269 Ga0163162_10239536 3300013306 Unclassified 1945
270 Ga0163162_10254033 3300013306 Bacteria 1890
271 Ga0163162_11474731 3300013306 Bacteria 775
272 Ga0163162_12321242 3300013306 Bacteria 616
273 Ga0157372_10371217 3300013307 Unclassified 1667
274 Ga0157372_11884177 3300013307 Unclassified 687
275 Ga0157372_12545163 3300013307 Bacteria 587
276 Ga0157375_10006727 3300013308 Bacteria 10013
277 Ga0157375_10126739 3300013308 Bacteria 2668
278 Ga0157375_10620685 3300013308 Bacteria 1239
279 Ga0157375_10676180 3300013308 Unclassified 1187
280 Ga0157375_10792205 3300013308 Bacteria 1097
281 Ga0157375_10983139 3300013308 Bacteria 984
282 Ga0157375_12152814 3300013308 Unclassified 664
283 Ga0163163_10006552 3300014325 Bacteria 10196
284 Ga0163163_10109707 3300014325 Bacteria 2787
285 Ga0163163_10632461 3300014325 Bacteria 1133
286 Ga0163163_10813963 3300014325 Unclassified 997
287 Ga0163163_10904367 3300014325 Unclassified 946
288 Ga0157380_10002684 3300014326 Bacteria 12068
289 Ga0157377_10173134 3300014745 Bacteria 1352
290 Ga0157379_10182213 3300014968 Bacteria 1897
291 Ga0157379_10740821 3300014968 Bacteria 925
292 Ga0157379_10785622 3300014968 Bacteria 898
293 Ga0157379_11038772 3300014968 Bacteria 783
294 Ga0157379_11071135 3300014968 Bacteria 771
295 Ga0157379_12209686 3300014968 Unclassified 547
296 Ga0157376_10381117 3300014969 Bacteria 1358
297 Ga0157376_10460166 3300014969 Unclassified 1243
298 Ga0157376_12325801 3300014969 Unclassified 575
299 Ga0163161_10260196 3300017792 Bacteria 1355
300 Ga0197907_10623423 3300020069 Bacteria 693
301 Ga0206356_11306937 3300020070 Bacteria 1778
302 Ga0206356_11315826 3300020070 Bacteria 672
303 Ga0206354_10623933 3300020081 Bacteria 1727
304 Ga0206354_11341636 3300020081 Bacteria 976
305 Ga0206354_11630839 3300020081 Bacteria 937
306 Ga0206353_10194204 3300020082 Bacteria 814
307 Ga0206353_10253207 3300020082 Bacteria 1942
308 Ga0206353_11119700 3300020082 Bacteria 6705
309 Ga0206353_11211840 3300020082 Bacteria 1126
310 Ga0206353_11683266 3300020082 Bacteria 1230
311 Ga0213871_10227139 3300021441 Unclassified 588
312 Ga0207672_1000184 3300025223 Bacteria 8777
313 Ga0207697_10032244 3300025315 Bacteria 2144
314 Ga0207697_10293477 3300025315 Unclassified 721
315 Ga0207697_10370203 3300025315 Unclassified 636
316 Ga0207682_10272990 3300025893 Unclassified 790
317 Ga0207692_10000644 3300025898 Bacteria 12279
318 Ga0207692_10450686 3300025898 Unclassified 810
319 Ga0207642_10005639 3300025899 Unclassified 4101
320 Ga0207710_10000003 3300025900 Bacteria 1071597
321 Ga0207710_10044546 3300025900 Bacteria 1976
322 Ga0207710_10050656 3300025900 Bacteria 1863
323 Ga0207710_10334127 3300025900 Unclassified 770
324 Ga0207710_10523855 3300025900 Unclassified 616
325 Ga0207710_10658411 3300025900 Bacteria 548
326 Ga0207647_10016254 3300025904 Bacteria 5081
327 Ga0207647_10188342 3300025904 Unclassified 1196
328 Ga0207645_10032049 3300025907 Bacteria 3379
329 Ga0207643_10054134 3300025908 Unclassified 2280
330 Ga0207643_10302821 3300025908 Bacteria 995
331 Ga0207705_10009361 3300025909 Bacteria 7122
332 Ga0207705_10054717 3300025909 Bacteria 2876
333 Ga0207705_10340996 3300025909 Bacteria 1153
334 Ga0207684_10000746 3300025910 Bacteria 37987
335 Ga0207684_10056477 3300025910 Bacteria 3330
336 Ga0207707_10002499 3300025912 Bacteria 16555
337 Ga0207707_10082676 3300025912 Bacteria 2804
338 Ga0207707_10256970 3300025912 Bacteria 1516
339 Ga0207695_11126430 3300025913 Bacteria 665
340 Ga0207671_10068565 3300025914 Unclassified 2643
341 Ga0207693_10066547 3300025915 Bacteria 2821
342 Ga0207663_10332064 3300025916 Bacteria 1146
343 Ga0207663_11560133 3300025916 Bacteria 532
344 Ga0207660_10012826 3300025917 Bacteria 5487
345 Ga0207660_10482194 3300025917 Bacteria 1005
346 Ga0207662_10063621 3300025918 Bacteria 2218
347 Ga0207662_10382097 3300025918 Bacteria 951
348 Ga0207662_10886814 3300025918 Bacteria 631
349 Ga0207657_10117383 3300025919 Bacteria 2192
350 Ga0207657_10314080 3300025919 Unclassified 1240
351 Ga0207649_10183365 3300025920 Bacteria 1466
352 Ga0207649_10343559 3300025920 Bacteria 1103
353 Ga0207649_10780614 3300025920 Bacteria 745
354 Ga0207652_10013705 3300025921 Bacteria 6555
355 Ga0207652_10245567 3300025921 Unclassified 1614
356 Ga0207646_10013001 3300025922 Bacteria 7975
357 Ga0207646_10039835 3300025922 Bacteria 4228
358 Ga0207681_10364061 3300025923 Bacteria 1160
359 Ga0207681_11573924 3300025923 Unclassified 550
360 Ga0207694_10000016 3300025924 Bacteria 349087
361 Ga0207694_10069053 3300025924 Bacteria 2761
362 Ga0207694_10847889 3300025924 Bacteria 772
363 Ga0207650_10553350 3300025925 Bacteria 965
364 Ga0207650_11316404 3300025925 Bacteria 615
365 Ga0207659_10016810 3300025926 Bacteria 4770
366 Ga0207659_10212362 3300025926 Bacteria 1552
367 Ga0207659_10432406 3300025926 Bacteria 1106
368 Ga0207659_10518294 3300025926 Unclassified 1011
369 Ga0207659_10853732 3300025926 Unclassified 783
370 Ga0207687_10533530 3300025927 Bacteria 983
371 Ga0207687_11690854 3300025927 Unclassified 542
372 Ga0207700_10667146 3300025928 Unclassified 927
373 Ga0207664_10720689 3300025929 Bacteria 897
374 Ga0207644_10000249 3300025931 Bacteria 36628
375 Ga0207644_10013481 3300025931 Bacteria 5450
376 Ga0207644_10119853 3300025931 Unclassified 2002
377 Ga0207690_10012907 3300025932 Bacteria 5007
378 Ga0207690_10393064 3300025932 Unclassified 1104
379 Ga0207706_10045547 3300025933 Unclassified 3886
380 Ga0207706_10206190 3300025933 Bacteria 1724
381 Ga0207686_10605435 3300025934 Unclassified 863
382 Ga0207670_10195551 3300025936 Bacteria 1533
383 Ga0207670_10227799 3300025936 Bacteria 1430
384 Ga0207669_10672816 3300025937 Unclassified 848
385 Ga0207669_11422808 3300025937 Unclassified 590
386 Ga0207704_11380680 3300025938 Unclassified 603
387 Ga0207704_11390873 3300025938 Bacteria 601
388 Ga0207691_10492373 3300025940 Unclassified 1041
389 Ga0207691_11593558 3300025940 Bacteria 531
390 Ga0207711_10008789 3300025941 Bacteria 8447
391 Ga0207711_10117992 3300025941 Unclassified 2367
392 Ga0207711_10390276 3300025941 Bacteria 1292
393 Ga0207711_11139835 3300025941 Bacteria 721
394 Ga0207711_11366685 3300025941 Unclassified 651
395 Ga0207689_10167898 3300025942 Unclassified 1808
396 Ga0207689_10354297 3300025942 Bacteria 1220
397 Ga0207689_10465056 3300025942 Bacteria 1058
398 Ga0207689_10953235 3300025942 Unclassified 724
399 Ga0207689_10962103 3300025942 Bacteria 720
400 Ga0207661_11472306 3300025944 Bacteria 624
401 Ga0207661_11781608 3300025944 Bacteria 561
402 Ga0207679_10035821 3300025945 Bacteria 3514
403 Ga0207679_10821430 3300025945 Bacteria 848
404 Ga0207651_10021072 3300025960 Bacteria 3951
405 Ga0207651_10108330 3300025960 Bacteria 2079
406 Ga0207668_10437416 3300025972 Bacteria 1113
407 Ga0207668_11002269 3300025972 Unclassified 746
408 Ga0207640_10465217 3300025981 Bacteria 1045
409 Ga0207640_11019928 3300025981 Bacteria 729
410 Ga0207658_10126460 3300025986 Bacteria 2046
411 Ga0207658_10239752 3300025986 Bacteria 1535
412 Ga0207658_10841942 3300025986 Bacteria 834
413 Ga0207677_10261536 3300026023 Bacteria 1411
414 Ga0207703_10000101 3300026035 Bacteria 101290
415 Ga0207703_10331295 3300026035 Unclassified 1396
416 Ga0207703_10397834 3300026035 Bacteria 1278
417 Ga0207703_10690200 3300026035 Bacteria 970
418 Ga0207703_11515500 3300026035 Unclassified 645
419 Ga0207703_12118043 3300026035 Bacteria 539
420 Ga0207639_12178357 3300026041 Bacteria 516
421 Ga0207678_10385634 3300026067 Bacteria 1212
422 Ga0207678_10639747 3300026067 Bacteria 934
423 Ga0207708_10000080 3300026075 Bacteria 74889
424 Ga0207708_10058385 3300026075 Bacteria 2944
425 Ga0207702_11790750 3300026078 Bacteria 606
426 Ga0207702_11843198 3300026078 Bacteria 596
427 Ga0207641_10263221 3300026088 Bacteria 1616
428 Ga0207641_10406974 3300026088 Bacteria 1307
429 Ga0207641_10408657 3300026088 Bacteria 1305
430 Ga0207641_10779467 3300026088 Bacteria 945
431 Ga0207641_12573511 3300026088 Bacteria 507
432 Ga0207648_10403567 3300026089 Bacteria 1239
433 Ga0207648_10644203 3300026089 Bacteria 979
434 Ga0207676_10269377 3300026095 Bacteria 1542
435 Ga0207676_10999163 3300026095 Bacteria 824
436 Ga0207676_11276670 3300026095 Unclassified 729
437 Ga0207676_11543806 3300026095 Bacteria 661
438 Ga0207676_11998336 3300026095 Unclassified 578
439 Ga0207674_10158759 3300026116 Bacteria 2216
440 Ga0207675_100072859 3300026118 Unclassified 3213
441 Ga0207675_100640701 3300026118 Unclassified 1068
442 Ga0207683_10460280 3300026121 Unclassified 1173
443 Ga0207698_10001958 3300026142 Bacteria 12098
444 Ga0207698_11688698 3300026142 Bacteria 649
445 Ga0207698_11741632 3300026142 Bacteria 638
446 Ga0207698_11883771 3300026142 Bacteria 613
447 Ga0209588_1200640 3300027671 Unclassified 621
448 Ga0207428_10049493 3300027907 Bacteria 3367
449 Ga0207428_11302753 3300027907 Bacteria 503
450 Ga0268266_10008303 3300028379 Bacteria 9248
451 Ga0268266_10124274 3300028379 Bacteria 2300
452 Ga0268265_12227220 3300028380 Bacteria 555
453 Ga0268264_10983857 3300028381 Bacteria 850
454 Ga0268264_12376430 3300028381 Unclassified 536
455 Ga0316177_1066554 3300030731 Bacteria 4026
456 Ga0316177_1074620 3300030731 Bacteria 4448
457 Ga0316176_1048497 3300030732 Bacteria 1498
458 Ga0314311_1104544 3300030733 Bacteria 3607
459 Ga0316180_1001819 3300030736 Bacteria 1624
460 Ga0316180_1003512 3300030736 Bacteria 816
461 Ga0307513_10230264 3300031456 Bacteria 1666
462 Ga0307408_100011300 3300031548 Bacteria 5900
463 Ga0307408_100012526 3300031548 Bacteria 5621
464 Ga0307405_10002461 3300031731 Bacteria 8169
465 Ga0307405_10857693 3300031731 Bacteria 765
466 Ga0307413_10010259 3300031824 Bacteria 4533
467 Ga0307410_10027356 3300031852 Bacteria 3604
468 Ga0307406_10129487 3300031901 Bacteria 1769
469 Ga0307406_10366479 3300031901 Bacteria 1131
470 Ga0307407_10007510 3300031903 Unclassified 4941
471 Ga0307412_10008832 3300031911 Bacteria 5770
472 Ga0307412_11105628 3300031911 Bacteria 705
473 Ga0307409_100019527 3300031995 Bacteria 4592
474 Ga0307416_100099164 3300032002 Bacteria 2529
475 Ga0307416_100162473 3300032002 Bacteria 2066
476 Ga0307416_100432381 3300032002 Bacteria 1364
477 Ga0307416_102063425 3300032002 Bacteria 672
478 Ga0307414_10695369 3300032004 Bacteria 920
479 Ga0307411_10123787 3300032005 Bacteria 1876
480 Ga0307415_100077029 3300032126 Bacteria 2366
481 Ga0307415_101936712 3300032126 Bacteria 573
482 Ga0373959_0107532 3300034820 Bacteria 670
483 Ga0373940_0089101 3300035088 Unclassified 922
484 Ga0373951_0245350 3300035091 Bacteria 536
485 Ga0373936_0107380 3300035113 Bacteria 1183
486 Ga0373953_0033221 3300035117 Bacteria 2017
487 Ga0373954_0419624 3300035118 Unclassified 662
488 Ga0373957_0064911 3300035120 Bacteria 1420
489 Ga0373960_0151541 3300035121 Bacteria 792
490 Ga0373943_0209442 3300035170 Unclassified 1082
491 Ga0373955_0030406 3300035172 Bacteria 2819
492 Ga0373942_0070742 3300035207 Bacteria 1018
493 Ga0316574_0164192 3300035398 Bacteria 1430
494 Ga0373931_0096833 3300035691 Bacteria 1654
495 Ga0373927_0052437 3300035695 Bacteria 2639
496 Ga0373937_0139984 3300036401 Bacteria 2263
497 Ga0373937_0718879 3300036401 Bacteria 946
498 Ga0373925_0263150 3300037068 Bacteria 1386
499 Ga0395900_0044133 3300037418 Unclassified 4595
500 Ga0395900_0219497 3300037418 Bacteria 1917
501 Ga0395901_0340472 3300038443 Bacteria 1550
502 Ga0242422_00857 3300038699 Unclassified 2050
503 Ga0242420_004929 3300038996 Unclassified 2043
504 Ga0436360_0359347 3300039438 Unclassified 4276
505 Ga0436360_0672438 3300039438 Unclassified 1512
506 Ga0436360_0992605 3300039438 Unclassified 855
507 Ga0451791_0672891 3300041451 Bacteria 503
508 Ga0451800_0841292 3300041459 Unclassified 505
509 Ga0451802_1509434 3300041460 Bacteria 882
510 Ga0451849_0268742 3300041505 Unclassified 851
511 Ga0439448_0032808 3300042005 Bacteria 1654
512 Ga0439458_0000876 3300042157 Bacteria 7796
513 Ga0439435_0141712 3300042436 Bacteria 766
514 Ga0439460_0083267 3300042461 Bacteria 1007
515 Ga0451577_0028505 3300042876 Bacteria 5049
516 Ga0451577_1641084 3300042876 Bacteria 566
517 Ga0466969_0117251 3300044656 Bacteria 1242
518 Ga0466972_0003512 3300044658 Bacteria 7782
519 Ga0466972_0149900 3300044658 Bacteria 1096
520 Ga0453683_0126580 3300044673 Bacteria 1609
521 Ga0466965_0005504 3300044683 Bacteria 5710
522 Ga0466965_0038031 3300044683 Bacteria 2363
523 Ga0466965_0058421 3300044683 Bacteria 1923
524 Ga0466965_0110783 3300044683 Bacteria 1410
525 Ga0466966_0094292 3300044684 Bacteria 1855
526 Ga0466961_0026139 3300044693 Bacteria 3754
527 Ga0466961_0075769 3300044693 Bacteria 2132
528 Ga0466963_0016759 3300044694 Bacteria 4559
529 Ga0466963_0032013 3300044694 Bacteria 3402
530 Ga0466963_1254808 3300044694 Bacteria 520
531 Ga0466964_0021378 3300044706 Bacteria 2502
532 Ga0453684_0011758 3300044712 Bacteria 14595
533 Ga0466971_0004525 3300044719 Bacteria 6010
534 Ga0466968_0107413 3300044735 Bacteria 1252
535 Ga0466970_0021455 3300044765 Bacteria 3364
536 Ga0466970_0034937 3300044765 Bacteria 2662
537 Ga0466957_0040866 3300044842 Bacteria 2802
538 Ga0466957_0207453 3300044842 Bacteria 1289
539 Ga0466960_0021740 3300044901 Bacteria 2860
540 Ga0466960_0254638 3300044901 Bacteria 976
541 Ga0466960_0466513 3300044901 Bacteria 736
542 Ga0466960_0870708 3300044901 Bacteria 548
543 Ga0466960_0936579 3300044901 Bacteria 530
544 Ga0466959_0041302 3300045049 Bacteria 3405
545 Ga0466959_0127040 3300045049 Bacteria 1809
546 Ga0466959_0172451 3300045049 Bacteria 1517
547 Ga0466959_0714949 3300045049 Bacteria 671
548 Ga0451576_0806367 3300045051 Bacteria 986
549 Ga0451576_1133902 3300045051 Bacteria 818
550 Ga0451576_1318414 3300045051 Bacteria 752
551 Ga0451576_1383109 3300045051 Bacteria 733
552 Ga0466958_0023988 3300045836 Bacteria 3586
553 Ga0466958_0024262 3300045836 Bacteria 3568
554 Ga0466958_0772289 3300045836 Bacteria 626
555 Ga0466967_0094886 3300045976 Bacteria 2717
556 Ga0466967_0190590 3300045976 Bacteria 1937
557 Ga0466967_0221622 3300045976 Bacteria 1798
558 Ga0466967_1699585 3300045976 Bacteria 628
559 Ga0495592_0104112 3300046454 Bacteria 2018
560 Ga0495592_0111968 3300046454 Unclassified 1930
561 Ga0495651_0025616 3300046462 Bacteria 4593
562 Ga0495651_0583827 3300046462 Bacteria 707
563 Ga0495653_0207577 3300046463 Bacteria 1325
564 Ga0495650_0020428 3300046471 Bacteria 3230
565 Ga0495580_0016902 3300046472 Bacteria 5469
566 Ga0495580_0029668 3300046472 Bacteria 3969
567 Ga0495662_0233825 3300046476 Unclassified 906
568 Ga0495608_0288104 3300046511 Bacteria 1018
569 Ga0495618_0039749 3300046514 Bacteria 2958
570 Ga0495620_0389644 3300046515 Bacteria 528
571 Ga0495628_0179299 3300046516 Bacteria 1603
572 Ga0495652_0041932 3300046529 Bacteria 3947
573 Ga0495652_0068720 3300046529 Bacteria 2967
574 Ga0495640_0271211 3300046533 Bacteria 1058
575 Ga0495598_0072474 3300046537 Unclassified 1088
576 Ga0495645_0024335 3300046543 Bacteria 4393
577 Ga0495645_0088882 3300046543 Bacteria 2209
578 Ga0495667_0948507 3300046559 Bacteria 526
579 Ga0495635_0078899 3300046663 Bacteria 2254
580 Ga0495599_0009674 3300046678 Bacteria 5900
581 Ga0495599_0210459 3300046678 Bacteria 1192
582 Ga0495623_0383875 3300046679 Bacteria 759
583 Ga0495646_0064754 3300046680 Bacteria 2166
584 Ga0495669_0058322 3300046684 Bacteria 1742
585 Ga0495613_0140204 3300046689 Bacteria 1728
586 Ga0495600_0888869 3300046809 Unclassified 526
587 Ga0495636_0374409 3300047318 Unclassified 675
588 Ga0495674_1302005 3300047319 Unclassified 545
589 Ga0495675_0092271 3300047444 Bacteria 1900
590 Ga0495684_0046964 3300047471 Bacteria 3303
591 Ga0496100_0876341 3300048903 Unclassified 705
592 Ga0496100_1510546 3300048903 Unclassified 531
593 Ga0496101_0235853 3300048904 Bacteria 1423
594 Ga0496102_0301108 3300048905 Bacteria 1511
595 Ga0496102_0415896 3300048905 Bacteria 1263
596 Ga0496102_0579008 3300048905 Bacteria 1045
597 Ga0496102_1011750 3300048905 Bacteria 751
598 Ga0496103_0430115 3300048906 Bacteria 847
599 Ga0496104_0114928 3300048907 Bacteria 2582
600 Ga0496104_0290859 3300048907 Bacteria 1546
601 Ga0496104_0831633 3300048907 Bacteria 829
602 Ga0496105_0791631 3300048908 Bacteria 721
603 Ga0496105_1426512 3300048908 Unclassified 500
604 Ga0496107_0189224 3300048910 Bacteria 1529
605 Ga0496108_0022460 3300048911 Bacteria 5186
606 Ga0496108_0049820 3300048911 Bacteria 3503
607 Ga0496108_0255249 3300048911 Unclassified 1525
608 Ga0496109_0011200 3300048912 Bacteria 7696
609 Ga0496109_0077417 3300048912 Bacteria 3061
610 Ga0496110_0002821 3300048913 Bacteria 13115
611 Ga0496110_0059520 3300048913 Bacteria 3367
612 Ga0496111_0120762 3300048914 Bacteria 1935
613 Ga0496112_0024956 3300048915 Bacteria 5735
614 Ga0496112_0220837 3300048915 Unclassified 1851
615 Ga0496112_0373143 3300048915 Bacteria 1368
616 Ga0496112_0478243 3300048915 Bacteria 1182
617 Ga0496113_0253547 3300048916 Bacteria 1405
618 Ga0496113_0261392 3300048916 Unclassified 1383
619 Ga0496113_0923070 3300048916 Bacteria 690
620 Ga0496113_1156350 3300048916 Bacteria 605
621 Ga0496114_0032766 3300048917 Bacteria 4279
622 Ga0496114_0337139 3300048917 Bacteria 1333
623 Ga0496115_1128840 3300048918 Bacteria 593
624 Ga0501033_0995355 3300049570 Bacteria 560
625 Ga0501034_0521411 3300049571 Bacteria 1100
626 Ga0501034_1559818 3300049571 Bacteria 534
627 Ga0501036_1026527 3300049572 Unclassified 675
628 Ga0501038_0484354 3300049574 Bacteria 948
629 Ga0501039_0238789 3300049575 Unclassified 1429
630 Ga0501042_0262808 3300049578 Bacteria 1246
631 Ga0501042_0426781 3300049578 Bacteria 961
632 Ga0501046_0362993 3300049580 Bacteria 1050
633 Ga0501046_0488604 3300049580 Bacteria 883
634 Ga0501046_0659475 3300049580 Bacteria 739
635 Ga0501046_1102613 3300049580 Bacteria 548
636 Ga0501046_1157137 3300049580 Bacteria 533
637 Ga0501047_0086120 3300049581 Bacteria 3019
638 Ga0501067_0114380 3300049583 Unclassified 1500
639 Ga0501067_0554976 3300049583 Bacteria 643
640 Ga0501067_0585624 3300049583 Bacteria 625
641 Ga0501067_0609789 3300049583 Bacteria 612
642 Ga0501069_0028116 3300049585 Bacteria 3083
643 Ga0501070_0194646 3300049586 Bacteria 1665
644 Ga0501070_0449588 3300049586 Bacteria 1039
645 Ga0501070_0699263 3300049586 Bacteria 802
646 Ga0501072_0020391 3300049588 Bacteria 5136
647 Ga0501072_0153701 3300049588 Bacteria 1835
648 Ga0501072_0413666 3300049588 Bacteria 1069
649 Ga0501074_0627047 3300049590 Bacteria 760
650 Ga0501075_0129524 3300049591 Bacteria 1922
651 Ga0501075_0165569 3300049591 Bacteria 1687
652 Ga0501075_0706245 3300049591 Bacteria 768
653 Ga0501076_0049088 3300049592 Bacteria 3337
654 Ga0501077_0413181 3300049593 Bacteria 863
655 Ga0501077_0649443 3300049593 Bacteria 678
656 Ga0501079_0187829 3300049741 Bacteria 1613
657 Ga0501079_0739465 3300049741 Bacteria 774
658 Ga0501080_0214835 3300049742 Bacteria 1762
659 Ga0501080_0716523 3300049742 Bacteria 882
660 Ga0501080_1583460 3300049742 Bacteria 555
661 Ga0501081_0192091 3300049743 Bacteria 1479
662 Ga0501081_0193329 3300049743 Bacteria 1474
663 Ga0501081_0203686 3300049743 Bacteria 1436
664 Ga0501081_0912738 3300049743 Bacteria 662
665 Ga0501083_0085072 3300049744 Bacteria 2093
666 Ga0501035_0286295 3300049822 Bacteria 1391
667 Ga0501044_0194600 3300049823 Bacteria 1988
668 Ga0501044_0367005 3300049823 Bacteria 1357
669 Ga0501045_0077588 3300049824 Bacteria 2448
670 Ga0501045_0898754 3300049824 Bacteria 651
671 nmdc:mga0k408_900988_c1 3300050493 Unclassified 513
672 nmdc:mga05p37_105193_c1 3300050507 Bacteria 3472
673 nmdc:mga05p37_1523_c2 3300050507 Bacteria 17414
674 nmdc:mga05p37_16877_c1 3300050507 Bacteria 8803
675 nmdc:mga05p37_1844761_c1 3300050507 Bacteria 581
676 nmdc:mga05p37_186103_c1 3300050507 Bacteria 2525
677 nmdc:mga05p37_2008154_c1 3300050507 Bacteria 547
678 nmdc:mga05p37_393972_c1 3300050507 Bacteria 1619
679 nmdc:mga05p37_854204_c1 3300050507 Bacteria 988
680 nmdc:mga05p37_854_c1 3300050507 Bacteria 34328
681 nmdc:mga05p37_9776_c1 3300050507 Bacteria 5069
682 nmdc:mga09592_200854_c1 3300050508 Bacteria 1726
683 nmdc:mga09592_48971_c1 3300050508 Bacteria 3563
684 nmdc:mga0qj67_888178_c1 3300050509 Bacteria 703
685 nmdc:mga06r32_563_c1 3300050510 Bacteria 32272
686 nmdc:mga06r32_956306_c1 3300050510 Bacteria 811
687 nmdc:mga08y16_55782_c1 3300050511 Bacteria 4129
688 nmdc:mga08y16_719911_c1 3300050511 Bacteria 996
689 nmdc:mga08y16_988783_c1 3300050511 Bacteria 822
690 nmdc:mga0n895_1151550_c1 3300050512 Bacteria 751
691 nmdc:mga0n895_251688_c1 3300050512 Unclassified 1793
692 nmdc:mga0n895_4868_c1 3300050512 Bacteria 11123
693 nmdc:mga0n895_58536_c1 3300050512 Bacteria 3799
694 nmdc:mga0n895_714294_c1 3300050512 Unclassified 997
695 nmdc:mga0n895_793_c1 3300050512 Bacteria 22553
696 nmdc:mga0rr50_135369_c1 3300050513 Bacteria 1977
697 nmdc:mga0rr50_165032_c1 3300050513 Bacteria 1800
698 nmdc:mga08x19_198520_c1 3300050514 Bacteria 1374
699 nmdc:mga08x19_245151_c1 3300050514 Unclassified 1236
700 nmdc:mga08x19_50041_c1 3300050514 Bacteria 2681
701 nmdc:mga08x19_894376_c1 3300050514 Bacteria 631
702 nmdc:mga0a205_106464_c1 3300050515 Bacteria 2702
703 nmdc:mga0a205_144387_c1 3300050515 Bacteria 2280
704 nmdc:mga0a205_262050_c1 3300050515 Bacteria 1606
705 nmdc:mga0a205_93399_c1 3300050515 Bacteria 2907
706 Ga0495601_0490191 3300053077 Unclassified 793
707 Ga0495619_0077517 3300053085 Bacteria 2233
708 Ga0500594_0000002 3300053118 Bacteria 916890
709 Ga0500655_042431 3300053133 Bacteria 894
710 Ga0501082_0161563 3300060353 Bacteria 1947
711 Ga0501082_0731373 3300060353 Bacteria 866
712 Ga0466962_0020860 3300061719 Bacteria 3148
713 Ga0466962_0115190 3300061719 Bacteria 1295
714 Ga0530510_0357649 3300061734 Bacteria 1097
715 2855688227 2855683550 Bacteria 7134265
716 Ga0070711_101963979
717 JGI24748J21848_1000006
718 JGI24034J26672_10000002
719 JGI24742J22300_10004538
720 JGI25406J46586_10017293
721 rootL2_10159167
722 Ga0065714_10243489
723 Ga0065712_10009133
724 Ga0065712_10222665
725 Ga0065715_10156330
726 Ga0065707_10142594
727 Ga0065707_10144940
728 Ga0070658_10008767
729 Ga0070658_10080476
730 Ga0070676_10315210
731 Ga0070683_101138075
732 Ga0070683_102230544
733 Ga0070690_100920970
734 Ga0070690_101757385
735 Ga0070670_100325355
736 Ga0070670_100338414
737 Ga0070670_100496471
738 Ga0068869_100058722
739 Ga0068869_100224967
740 Ga0068869_101283392
741 Ga0068869_101415321
742 Ga0068868_100263661
743 Ga0070660_100311495
744 Ga0070689_100503521
745 Ga0070689_101614397
746 Ga0070691_10092026
747 Ga0070687_100905318
748 Ga0070661_100016842
749 Ga0070661_101277638
750 Ga0070692_10122407
751 Ga0070668_100271576
752 Ga0070668_100565351
753 Ga0070669_100022618
754 Ga0070669_100243842
755 Ga0070669_100405794
756 Ga0070675_100165467
757 Ga0070671_100042476
758 Ga0070671_100691520
759 Ga0070674_100196018
760 Ga0070674_101968994
761 Ga0070673_100532744
762 Ga0070673_101179858
763 Ga0070673_101888426
764 Ga0070688_100912689
765 Ga0070659_100120805
766 Ga0070659_100219108
767 Ga0070659_100528165
768 Ga0070659_101628846
769 Ga0070667_100185403
770 Ga0070667_100607740
771 Ga0070667_100608844
772 Ga0070667_100671110
773 Ga0070703_10107142
774 Ga0070713_101139303
775 Ga0070710_10000074
776 Ga0070710_11122320
777 Ga0070701_10149314
778 Ga0070701_10264744
779 Ga0070701_10416784
780 Ga0070711_100542736
781 Ga0070705_100175739
782 Ga0070700_100000062
783 Ga0070700_100008395
784 Ga0070700_100345561
785 Ga0070694_100000481
786 Ga0070694_100064603
787 Ga0070708_100062412
788 Ga0070708_100240191
789 Ga0070708_100931706
790 Ga0070663_100811456
791 Ga0070663_101750286
792 Ga0070678_100758356
793 Ga0070662_100675421
794 Ga0070681_11848903
795 Ga0070685_10775507
796 Ga0070706_100073057
797 Ga0070707_100012820
798 Ga0070707_100031570
799 Ga0070707_100320956
800 Ga0070707_101580306
801 Ga0070707_101875463
802 Ga0070698_100061297
803 Ga0070698_100534692
804 Ga0070698_100887269
805 Ga0070699_100854392
806 Ga0070679_100285827
807 Ga0070679_101466343
808 Ga0070679_101473505
809 Ga0070684_100373152
810 Ga0070697_101607816
811 Ga0070697_101929572
812 Ga0068853_100669551
813 Ga0070672_100053817
814 Ga0070686_100809359
815 Ga0070686_101085792
816 Ga0070695_100104089
817 Ga0070695_100244661
818 Ga0070695_100270911
819 Ga0070695_100304765
820 Ga0070696_100454462
821 Ga0070696_100478392
822 Ga0070693_100136577
823 Ga0070693_100172271
824 Ga0070693_100583390
825 Ga0070665_100024939
826 Ga0070665_100117113
827 Ga0070665_100234373
828 Ga0070704_100014439
829 Ga0070704_100292980
830 Ga0070704_100393903
831 Ga0070704_100477368
832 Ga0070704_100856534
833 Ga0068855_100566382
834 Ga0068855_101418880
835 Ga0070664_100028150
836 Ga0070664_101628200
837 Ga0070664_102394834
838 Ga0068857_100330599
839 Ga0068854_100124320
840 Ga0068854_101135324
841 Ga0068854_102143735
842 Ga0068856_100741799
843 Ga0068856_101164646
844 Ga0068856_101723900
845 Ga0068856_101832829
846 Ga0068856_102314914
847 Ga0070702_100035066
848 Ga0070702_100127006
849 Ga0068852_100001470
850 Ga0068852_101776117
851 Ga0068859_100006037
852 Ga0068859_100034112
853 Ga0068859_100179530
854 Ga0068859_100456946
855 Ga0068859_100479361
856 Ga0068859_100569402
857 Ga0068859_100668069
858 Ga0068864_100304869
859 Ga0068864_100410410
860 Ga0068864_100962466
861 Ga0068864_101846451
862 Ga0068866_10008068
863 Ga0068866_10082205
864 Ga0068861_100058438
865 Ga0068861_101351907
866 Ga0068851_10252804
867 Ga0068870_10313955
868 Ga0068870_10987158
869 Ga0068863_100119688
870 Ga0068863_100805927
871 Ga0068863_100961177
872 Ga0068858_100000227
873 Ga0068858_100126313
874 Ga0068858_100176828
875 Ga0068858_100314074
876 Ga0068858_100328753
877 Ga0068858_100652438
878 Ga0068858_100918724
879 Ga0068860_100164578
880 Ga0068860_100516775
881 Ga0068860_101054256
882 Ga0068862_100176928
883 Ga0081455_10005266
884 Ga0081455_10011324
885 Ga0081455_10197391
886 Ga0081538_10034483
887 Ga0081539_10000887
888 Ga0081539_10028223
889 Ga0081539_10084672
890 Ga0070717_10005311
891 Ga0075432_10145130
892 Ga0070715_10289512
893 Ga0070712_100373882
894 Ga0068871_100562692
895 Ga0068871_100876722
896 Ga0068871_101362319
897 Ga0075428_100007462
898 Ga0075430_100132524
899 Ga0075431_100001263
900 Ga0075431_100545391
901 Ga0075433_10027748
902 Ga0075433_10043943
903 Ga0075433_10142522
904 Ga0075433_10265730
905 Ga0075433_10345434
906 Ga0075434_100076692
907 Ga0075434_100138121
908 Ga0075434_100140510
909 Ga0075434_100195350
910 Ga0075429_100042999
911 Ga0075429_100518998
912 Ga0068865_101602959
913 Ga0075436_100069817
914 Ga0097620_100006037
915 Ga0097620_100034110
916 Ga0097620_100179531
917 Ga0097620_100457015
918 Ga0097620_100479322
919 Ga0097620_100569436
920 Ga0097620_100668094
921 Ga0075435_100006687
922 Ga0075435_100412526
923 Ga0099794_10535534
924 Ga0105240_10585009
925 Ga0105240_10665276
926 Ga0111539_10068944
927 Ga0111539_11596802
928 Ga0105245_10291592
929 Ga0105245_10840767
930 Ga0105245_10933369
931 Ga0105245_13205844
932 Ga0105247_10000001
933 Ga0105247_10036812
934 Ga0105247_10099233
935 Ga0105247_10131880
936 Ga0105247_10144818
937 Ga0105247_10191542
938 Ga0105247_10270285
939 Ga0114129_10000255
940 Ga0114129_10000853
941 Ga0114129_10006436
942 Ga0114129_10029398
943 Ga0114129_10034373
944 Ga0114129_10054216
945 Ga0114129_10867267
946 Ga0114129_13272172
947 Ga0105243_10270109
948 Ga0105243_11754630
949 Ga0105243_12133402
950 Ga0105241_10098274
951 Ga0105241_10460536
952 Ga0105242_10201429
953 Ga0105242_11134631
954 Ga0105248_10016145
955 Ga0105248_10017815
956 Ga0105248_10289001
957 Ga0105248_10550734
958 Ga0105248_10783273
959 Ga0105248_11793394
960 Ga0105237_10049237
961 Ga0105237_10939747
962 Ga0105238_10007038
963 Ga0105238_10095455
964 Ga0105238_12033314
965 Ga0105239_10079217
966 Ga0105239_10145656
967 Ga0105239_10705820
968 Ga0105239_10949569
969 Ga0105246_10450210
970 Ga0105246_10488459
971 Ga0105246_11188406
972 Ga0157373_10159394
973 Ga0157373_10315793
974 Ga0157371_11399420
975 Ga0157369_10003361
976 Ga0157369_10068402
977 Ga0157369_11669874
978 Ga0157374_10157378
979 Ga0157374_11781519
980 Ga0157378_10106623
981 Ga0157378_10800516
982 Ga0157378_12834093
983 Ga0163162_10042541
984 Ga0163162_10239536
985 Ga0163162_10254033
986 Ga0163162_11474731
987 Ga0163162_12321242
988 Ga0157372_10371217
989 Ga0157372_11884177
990 Ga0157372_12545163
991 Ga0157375_10006727
992 Ga0157375_10126739
993 Ga0157375_10620685
994 Ga0157375_10676180
995 Ga0157375_10792205
996 Ga0157375_10983139
997 Ga0157375_12152814
998 Ga0163163_10006552
999 Ga0163163_10109707
1000 Ga0163163_10632461
1001 Ga0163163_10813963
1002 Ga0163163_10904367
1003 Ga0157380_10002684
1004 Ga0157377_10173134
1005 Ga0157379_10182213
1006 Ga0157379_10740821
1007 Ga0157379_10785622
1008 Ga0157379_11038772
1009 Ga0157379_11071135
1010 Ga0157379_12209686
1011 Ga0157376_10381117
1012 Ga0157376_10460166
1013 Ga0157376_12325801
1014 Ga0163161_10260196
1015 Ga0197907_10623423
1016 Ga0206356_11306937
1017 Ga0206356_11315826
1018 Ga0206354_10623933
1019 Ga0206354_11341636
1020 Ga0206354_11630839
1021 Ga0206353_10194204
1022 Ga0206353_10253207
1023 Ga0206353_11119700
1024 Ga0206353_11211840
1025 Ga0206353_11683266
1026 Ga0213871_10227139
1027 Ga0207672_1000184
1028 Ga0207697_10032244
1029 Ga0207697_10293477
1030 Ga0207697_10370203
1031 Ga0207682_10272990
1032 Ga0207692_10000644
1033 Ga0207692_10450686
1034 Ga0207642_10005639
1035 Ga0207710_10000003
1036 Ga0207710_10044546
1037 Ga0207710_10050656
1038 Ga0207710_10334127
1039 Ga0207710_10523855
1040 Ga0207710_10658411
1041 Ga0207647_10016254
1042 Ga0207647_10188342
1043 Ga0207645_10032049
1044 Ga0207643_10054134
1045 Ga0207643_10302821
1046 Ga0207705_10009361
1047 Ga0207705_10054717
1048 Ga0207705_10340996
1049 Ga0207684_10000746
1050 Ga0207684_10056477
1051 Ga0207707_10002499
1052 Ga0207707_10082676
1053 Ga0207707_10256970
1054 Ga0207695_11126430
1055 Ga0207671_10068565
1056 Ga0207693_10066547
1057 Ga0207663_10332064
1058 Ga0207663_11560133
1059 Ga0207660_10012826
1060 Ga0207660_10482194
1061 Ga0207662_10063621
1062 Ga0207662_10382097
1063 Ga0207662_10886814
1064 Ga0207657_10117383
1065 Ga0207657_10314080
1066 Ga0207649_10183365
1067 Ga0207649_10343559
1068 Ga0207649_10780614
1069 Ga0207652_10013705
1070 Ga0207652_10245567
1071 Ga0207646_10013001
1072 Ga0207646_10039835
1073 Ga0207681_10364061
1074 Ga0207681_11573924
1075 Ga0207694_10000016
1076 Ga0207694_10069053
1077 Ga0207694_10847889
1078 Ga0207650_10553350
1079 Ga0207650_11316404
1080 Ga0207659_10016810
1081 Ga0207659_10212362
1082 Ga0207659_10432406
1083 Ga0207659_10518294
1084 Ga0207659_10853732
1085 Ga0207687_10533530
1086 Ga0207687_11690854
1087 Ga0207700_10667146
1088 Ga0207664_10720689
1089 Ga0207644_10000249
1090 Ga0207644_10013481
1091 Ga0207644_10119853
1092 Ga0207690_10012907
1093 Ga0207690_10393064
1094 Ga0207706_10045547
1095 Ga0207706_10206190
1096 Ga0207686_10605435
1097 Ga0207670_10195551
1098 Ga0207670_10227799
1099 Ga0207669_10672816
1100 Ga0207669_11422808
1101 Ga0207704_11380680
1102 Ga0207704_11390873
1103 Ga0207691_10492373
1104 Ga0207691_11593558
1105 Ga0207711_10008789
1106 Ga0207711_10117992
1107 Ga0207711_10390276
1108 Ga0207711_11139835
1109 Ga0207711_11366685
1110 Ga0207689_10167898
1111 Ga0207689_10354297
1112 Ga0207689_10465056
1113 Ga0207689_10953235
1114 Ga0207689_10962103
1115 Ga0207661_11472306
1116 Ga0207661_11781608
1117 Ga0207679_10035821
1118 Ga0207679_10821430
1119 Ga0207651_10021072
1120 Ga0207651_10108330
1121 Ga0207668_10437416
1122 Ga0207668_11002269
1123 Ga0207640_10465217
1124 Ga0207640_11019928
1125 Ga0207658_10126460
1126 Ga0207658_10239752
1127 Ga0207658_10841942
1128 Ga0207677_10261536
1129 Ga0207703_10000101
1130 Ga0207703_10331295
1131 Ga0207703_10397834
1132 Ga0207703_10690200
1133 Ga0207703_11515500
1134 Ga0207703_12118043
1135 Ga0207639_12178357
1136 Ga0207678_10385634
1137 Ga0207678_10639747
1138 Ga0207708_10000080
1139 Ga0207708_10058385
1140 Ga0207702_11790750
1141 Ga0207702_11843198
1142 Ga0207641_10263221
1143 Ga0207641_10406974
1144 Ga0207641_10408657
1145 Ga0207641_10779467
1146 Ga0207641_12573511
1147 Ga0207648_10403567
1148 Ga0207648_10644203
1149 Ga0207676_10269377
1150 Ga0207676_10999163
1151 Ga0207676_11276670
1152 Ga0207676_11543806
1153 Ga0207676_11998336
1154 Ga0207674_10158759
1155 Ga0207675_100072859
1156 Ga0207675_100640701
1157 Ga0207683_10460280
1158 Ga0207698_10001958
1159 Ga0207698_11688698
1160 Ga0207698_11741632
1161 Ga0207698_11883771
1162 Ga0209588_1200640
1163 Ga0207428_10049493
1164 Ga0207428_11302753
1165 Ga0268266_10008303
1166 Ga0268266_10124274
1167 Ga0268265_12227220
1168 Ga0268264_10983857
1169 Ga0268264_12376430
1170 Ga0316177_1066554
1171 Ga0316177_1074620
1172 Ga0316176_1048497
1173 Ga0314311_1104544
1174 Ga0316180_1001819
1175 Ga0316180_1003512
1176 Ga0307513_10230264
1177 Ga0307408_100011300
1178 Ga0307408_100012526
1179 Ga0307405_10002461
1180 Ga0307405_10857693
1181 Ga0307413_10010259
1182 Ga0307410_10027356
1183 Ga0307406_10129487
1184 Ga0307406_10366479
1185 Ga0307407_10007510
1186 Ga0307412_10008832
1187 Ga0307412_11105628
1188 Ga0307409_100019527
1189 Ga0307416_100099164
1190 Ga0307416_100162473
1191 Ga0307416_100432381
1192 Ga0307416_102063425
1193 Ga0307414_10695369
1194 Ga0307411_10123787
1195 Ga0307415_100077029
1196 Ga0307415_101936712
1197 Ga0373959_0107532
1198 Ga0373940_0089101
1199 Ga0373951_0245350
1200 Ga0373936_0107380
1201 Ga0373953_0033221
1202 Ga0373954_0419624
1203 Ga0373957_0064911
1204 Ga0373960_0151541
1205 Ga0373943_0209442
1206 Ga0373955_0030406
1207 Ga0373942_0070742
1208 Ga0316574_0164192
1209 Ga0373931_0096833
1210 Ga0373927_0052437
1211 Ga0373937_0139984
1212 Ga0373937_0718879
1213 Ga0373925_0263150
1214 Ga0395900_0044133
1215 Ga0395900_0219497
1216 Ga0395901_0340472
1217 Ga0242422_00857
1218 Ga0242420_004929
1219 Ga0436360_0359347
1220 Ga0436360_0672438
1221 Ga0436360_0992605
1222 Ga0451791_0672891
1223 Ga0451800_0841292
1224 Ga0451802_1509434
1225 Ga0451849_0268742
1226 Ga0439448_0032808
1227 Ga0439458_0000876
1228 Ga0439435_0141712
1229 Ga0439460_0083267
1230 Ga0451577_0028505
1231 Ga0451577_1641084
1232 Ga0466969_0117251
1233 Ga0466972_0003512
1234 Ga0466972_0149900
1235 Ga0453683_0126580
1236 Ga0466965_0005504
1237 Ga0466965_0038031
1238 Ga0466965_0058421
1239 Ga0466965_0110783
1240 Ga0466966_0094292
1241 Ga0466961_0026139
1242 Ga0466961_0075769
1243 Ga0466963_0016759
1244 Ga0466963_0032013
1245 Ga0466963_1254808
1246 Ga0466964_0021378
1247 Ga0453684_0011758
1248 Ga0466971_0004525
1249 Ga0466968_0107413
1250 Ga0466970_0021455
1251 Ga0466970_0034937
1252 Ga0466957_0040866
1253 Ga0466957_0207453
1254 Ga0466960_0021740
1255 Ga0466960_0254638
1256 Ga0466960_0466513
1257 Ga0466960_0870708
1258 Ga0466960_0936579
1259 Ga0466959_0041302
1260 Ga0466959_0127040
1261 Ga0466959_0172451
1262 Ga0466959_0714949
1263 Ga0451576_0806367
1264 Ga0451576_1133902
1265 Ga0451576_1318414
1266 Ga0451576_1383109
1267 Ga0466958_0023988
1268 Ga0466958_0024262
1269 Ga0466958_0772289
1270 Ga0466967_0094886
1271 Ga0466967_0190590
1272 Ga0466967_0221622
1273 Ga0466967_1699585
1274 Ga0495592_0104112
1275 Ga0495592_0111968
1276 Ga0495651_0025616
1277 Ga0495651_0583827
1278 Ga0495653_0207577
1279 Ga0495650_0020428
1280 Ga0495580_0016902
1281 Ga0495580_0029668
1282 Ga0495662_0233825
1283 Ga0495608_0288104
1284 Ga0495618_0039749
1285 Ga0495620_0389644
1286 Ga0495628_0179299
1287 Ga0495652_0041932
1288 Ga0495652_0068720
1289 Ga0495640_0271211
1290 Ga0495598_0072474
1291 Ga0495645_0024335
1292 Ga0495645_0088882
1293 Ga0495667_0948507
1294 Ga0495635_0078899
1295 Ga0495599_0009674
1296 Ga0495599_0210459
1297 Ga0495623_0383875
1298 Ga0495646_0064754
1299 Ga0495669_0058322
1300 Ga0495613_0140204
1301 Ga0495600_0888869
1302 Ga0495636_0374409
1303 Ga0495674_1302005
1304 Ga0495675_0092271
1305 Ga0495684_0046964
1306 Ga0496100_0876341
1307 Ga0496100_1510546
1308 Ga0496101_0235853
1309 Ga0496102_0301108
1310 Ga0496102_0415896
1311 Ga0496102_0579008
1312 Ga0496102_1011750
1313 Ga0496103_0430115
1314 Ga0496104_0114928
1315 Ga0496104_0290859
1316 Ga0496104_0831633
1317 Ga0496105_0791631
1318 Ga0496105_1426512
1319 Ga0496107_0189224
1320 Ga0496108_0022460
1321 Ga0496108_0049820
1322 Ga0496108_0255249
1323 Ga0496109_0011200
1324 Ga0496109_0077417
1325 Ga0496110_0002821
1326 Ga0496110_0059520
1327 Ga0496111_0120762
1328 Ga0496112_0024956
1329 Ga0496112_0220837
1330 Ga0496112_0373143
1331 Ga0496112_0478243
1332 Ga0496113_0253547
1333 Ga0496113_0261392
1334 Ga0496113_0923070
1335 Ga0496113_1156350
1336 Ga0496114_0032766
1337 Ga0496114_0337139
1338 Ga0496115_1128840
1339 Ga0501033_0995355
1340 Ga0501034_0521411
1341 Ga0501034_1559818
1342 Ga0501036_1026527
1343 Ga0501038_0484354
1344 Ga0501039_0238789
1345 Ga0501042_0262808
1346 Ga0501042_0426781
1347 Ga0501046_0362993
1348 Ga0501046_0488604
1349 Ga0501046_0659475
1350 Ga0501046_1102613
1351 Ga0501046_1157137
1352 Ga0501047_0086120
1353 Ga0501067_0114380
1354 Ga0501067_0554976
1355 Ga0501067_0585624
1356 Ga0501067_0609789
1357 Ga0501069_0028116
1358 Ga0501070_0194646
1359 Ga0501070_0449588
1360 Ga0501070_0699263
1361 Ga0501072_0020391
1362 Ga0501072_0153701
1363 Ga0501072_0413666
1364 Ga0501074_0627047
1365 Ga0501075_0129524
1366 Ga0501075_0165569
1367 Ga0501075_0706245
1368 Ga0501076_0049088
1369 Ga0501077_0413181
1370 Ga0501077_0649443
1371 Ga0501079_0187829
1372 Ga0501079_0739465
1373 Ga0501080_0214835
1374 Ga0501080_0716523
1375 Ga0501080_1583460
1376 Ga0501081_0192091
1377 Ga0501081_0193329
1378 Ga0501081_0203686
1379 Ga0501081_0912738
1380 Ga0501083_0085072
1381 Ga0501035_0286295
1382 Ga0501044_0194600
1383 Ga0501044_0367005
1384 Ga0501045_0077588
1385 Ga0501045_0898754
1386 nmdc:mga0k408_900988_c1
1387 nmdc:mga05p37_105193_c1
1388 nmdc:mga05p37_1523_c2
1389 nmdc:mga05p37_16877_c1
1390 nmdc:mga05p37_1844761_c1
1391 nmdc:mga05p37_186103_c1
1392 nmdc:mga05p37_2008154_c1
1393 nmdc:mga05p37_393972_c1
1394 nmdc:mga05p37_854204_c1
1395 nmdc:mga05p37_854_c1
1396 nmdc:mga05p37_9776_c1
1397 nmdc:mga09592_200854_c1
1398 nmdc:mga09592_48971_c1
1399 nmdc:mga0qj67_888178_c1
1400 nmdc:mga06r32_563_c1
1401 nmdc:mga06r32_956306_c1
1402 nmdc:mga08y16_55782_c1
1403 nmdc:mga08y16_719911_c1
1404 nmdc:mga08y16_988783_c1
1405 nmdc:mga0n895_1151550_c1
1406 nmdc:mga0n895_251688_c1
1407 nmdc:mga0n895_4868_c1
1408 nmdc:mga0n895_58536_c1
1409 nmdc:mga0n895_714294_c1
1410 nmdc:mga0n895_793_c1
1411 nmdc:mga0rr50_135369_c1
1412 nmdc:mga0rr50_165032_c1
1413 nmdc:mga08x19_198520_c1
1414 nmdc:mga08x19_245151_c1
1415 nmdc:mga08x19_50041_c1
1416 nmdc:mga08x19_894376_c1
1417 nmdc:mga0a205_106464_c1
1418 nmdc:mga0a205_144387_c1
1419 nmdc:mga0a205_262050_c1
1420 nmdc:mga0a205_93399_c1
1421 Ga0495601_0490191
1422 Ga0495619_0077517
1423 Ga0500594_0000002
1424 Ga0500655_042431
1425 Ga0501082_0161563
1426 Ga0501082_0731373
1427 Ga0466962_0020860
1428 Ga0466962_0115190
1429 Ga0530510_0357649
1430 2855688227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

12

83

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8glv-assembly1.cif.gz_AR 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.6294 15 61
5wi4-assembly1.cif.gz_A crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5819 6 61
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5815 6 61
5wi4-assembly1.cif.gz_B crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5773 6 61
5hxl-assembly1.cif.gz_A-2 structure based function annotation of a hypothetical protein mgg_01005 related to the development of rice blast fungus 0.5531 9 70
ID Description Score Start End Superfamily
2lqiA00 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.6718 15 63 1.10.246.20
af_P77475_18_87_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6263 16 63 3.40.50.1000
af_Q59VY8_255_427_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.5604 17 63 1.20.1440.340
af_Q69SJ7_333_414_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5401 15 62 1.10.287.10
af_B4FSG7_322_403_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5399 15 62 1.10.287.10
ID Description Score Start End GO Terms
AF-E0I5X4-F1-model_v4 DUF2277 domain-containing protein 1 1 89
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 1 1 70
AF-A0A1C3YBY4-F1-model_v4 DUF2277 domain-containing protein 0.9986 2 87
AF-A0A327XPT1-F1-model_v4 deleted 0.9964 1 87
AF-A0A3N5PKK7-F1-model_v4 DUF2277 domain-containing protein 0.9958 1 87

Map