F476945
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 385 | 712 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10153882|Ga0157380_101538822 |
| Length | 218 |
| Sequence | LRFGITRRIKEGLVGPFGHLEPSKHERQRRSETQMLTVGDRFPAFNLKAAVSLEKGKEFKDITEKDYAGKWKVVFFWPMDFTFICPTEIAEFGKQNGQFLERDAQVLGASTDTHFVHLAWRKDHPDLRTLPFPMLADTRRELSTQLGILHKTDGVPLRATFIVDPEGIIRWASVNDLSVGRNVSEVLRVLDGLQTDELCPCNWKQGEETLSQKMKKAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 2 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 23 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 148 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 231 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 276 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 279 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 280 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 385 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 2.24 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.38 |
| Nodule | 0 |
| Rhizoplane | 3.08 |
| Rhizosphere | 92.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1005792 | 3300001976 | Bacteria | 1613 |
| 2 | JGI24737J22298_10144013 | 3300001990 | Bacteria | 704 |
| 3 | JGI24743J22301_10001991 | 3300001991 | Bacteria | 2984 |
| 4 | JGI24745J21846_1014103 | 3300002073 | Bacteria | 925 |
| 5 | JGI24748J21848_1016011 | 3300002074 | Bacteria | 895 |
| 6 | JGI24749J21850_1002430 | 3300002076 | Bacteria | 2618 |
| 7 | JGI24035J26624_1009783 | 3300002126 | Bacteria | 947 |
| 8 | JGI24034J26672_10011564 | 3300002239 | Bacteria | 1324 |
| 9 | JGI24742J22300_10035873 | 3300002244 | Bacteria | 875 |
| 10 | JGI24751J29686_10005412 | 3300002459 | Bacteria | 2598 |
| 11 | JGI25406J46586_10060768 | 3300003203 | Unclassified | 1221 |
| 12 | Ga0006777J48905_1011873 | 3300003308 | Bacteria | 685 |
| 13 | Ga0007417J51691_1004037 | 3300003544 | Bacteria | 1391 |
| 14 | Ga0007427J51700_107763 | 3300003559 | Bacteria | 714 |
| 15 | Ga0006781J51513_1013523 | 3300003568 | Bacteria | 680 |
| 16 | Ga0007409J51694_1004929 | 3300003575 | Bacteria | 676 |
| 17 | Ga0007429J51699_1008412 | 3300003579 | Bacteria | 715 |
| 18 | Ga0007411J51799_103535 | 3300003611 | Bacteria | 714 |
| 19 | Ga0007415J51800_105198 | 3300003613 | Bacteria | 707 |
| 20 | JGI25404J52841_10009935 | 3300003659 | Bacteria | 2042 |
| 21 | Ga0032354_1014034 | 3300003693 | Bacteria | 625 |
| 22 | Ga0065704_10260902 | 3300005289 | Bacteria | 966 |
| 23 | Ga0065712_10381837 | 3300005290 | Bacteria | 751 |
| 24 | Ga0065715_10094138 | 3300005293 | Bacteria | 4432 |
| 25 | Ga0065715_10226977 | 3300005293 | Bacteria | 1248 |
| 26 | Ga0065707_10307848 | 3300005295 | Bacteria | 990 |
| 27 | Ga0065707_10492885 | 3300005295 | Bacteria | 764 |
| 28 | Ga0070658_10002993 | 3300005327 | Bacteria | 13979 |
| 29 | Ga0070676_10000714 | 3300005328 | Bacteria | 16252 |
| 30 | Ga0070676_10002103 | 3300005328 | Bacteria | 10135 |
| 31 | Ga0070683_100001881 | 3300005329 | Bacteria | 16392 |
| 32 | Ga0070683_100462577 | 3300005329 | Bacteria | 1211 |
| 33 | Ga0070690_100000665 | 3300005330 | Bacteria | 17495 |
| 34 | Ga0070690_100028478 | 3300005330 | Bacteria | 3461 |
| 35 | Ga0070670_100002019 | 3300005331 | Bacteria | 16603 |
| 36 | Ga0070670_100131259 | 3300005331 | Bacteria | 2163 |
| 37 | Ga0070677_10000828 | 3300005333 | Bacteria | 10144 |
| 38 | Ga0070677_10113431 | 3300005333 | Bacteria | 1213 |
| 39 | Ga0068869_100000053 | 3300005334 | Bacteria | 50209 |
| 40 | Ga0068869_100004382 | 3300005334 | Bacteria | 8764 |
| 41 | Ga0068869_100108759 | 3300005334 | Bacteria | 2106 |
| 42 | Ga0068869_100292735 | 3300005334 | Bacteria | 1312 |
| 43 | Ga0070666_10023498 | 3300005335 | Bacteria | 4013 |
| 44 | Ga0070680_100000934 | 3300005336 | Bacteria | 20654 |
| 45 | Ga0070680_100274735 | 3300005336 | Bacteria | 1427 |
| 46 | Ga0070682_100001571 | 3300005337 | Bacteria | 12752 |
| 47 | Ga0070682_100154508 | 3300005337 | Bacteria | 1578 |
| 48 | Ga0068868_100001316 | 3300005338 | Bacteria | 17121 |
| 49 | Ga0068868_100010020 | 3300005338 | Bacteria | 6847 |
| 50 | Ga0068868_100784478 | 3300005338 | Bacteria | 858 |
| 51 | Ga0070660_100000278 | 3300005339 | Bacteria | 33996 |
| 52 | Ga0070660_100001191 | 3300005339 | Bacteria | 17626 |
| 53 | Ga0070660_100007940 | 3300005339 | Bacteria | 7408 |
| 54 | Ga0070689_100001003 | 3300005340 | Bacteria | 17701 |
| 55 | Ga0070689_100039657 | 3300005340 | Bacteria | 3607 |
| 56 | Ga0070691_10037989 | 3300005341 | Bacteria | 2273 |
| 57 | Ga0070691_10082707 | 3300005341 | Bacteria | 1574 |
| 58 | Ga0070691_10119544 | 3300005341 | Bacteria | 1325 |
| 59 | Ga0070687_100000039 | 3300005343 | Bacteria | 41821 |
| 60 | Ga0070687_100000770 | 3300005343 | Bacteria | 10661 |
| 61 | Ga0070687_100001392 | 3300005343 | Bacteria | 8484 |
| 62 | Ga0070661_100000211 | 3300005344 | Bacteria | 48345 |
| 63 | Ga0070661_100001794 | 3300005344 | Bacteria | 14889 |
| 64 | Ga0070661_100010106 | 3300005344 | Bacteria | 6555 |
| 65 | Ga0070692_10002540 | 3300005345 | Bacteria | 7104 |
| 66 | Ga0070692_10007574 | 3300005345 | Bacteria | 4789 |
| 67 | Ga0070692_10112657 | 3300005345 | Bacteria | 1507 |
| 68 | Ga0070668_100000995 | 3300005347 | Bacteria | 19898 |
| 69 | Ga0070668_100202560 | 3300005347 | Bacteria | 1629 |
| 70 | Ga0070669_100004018 | 3300005353 | Bacteria | 10638 |
| 71 | Ga0070669_100041543 | 3300005353 | Bacteria | 3345 |
| 72 | Ga0070669_100647768 | 3300005353 | Bacteria | 888 |
| 73 | Ga0070675_100006048 | 3300005354 | Bacteria | 9273 |
| 74 | Ga0070675_100278641 | 3300005354 | Bacteria | 1469 |
| 75 | Ga0070671_100000390 | 3300005355 | Bacteria | 30162 |
| 76 | Ga0070671_100194044 | 3300005355 | Bacteria | 1721 |
| 77 | Ga0070674_100000407 | 3300005356 | Bacteria | 21630 |
| 78 | Ga0070674_100101462 | 3300005356 | Bacteria | 2097 |
| 79 | Ga0070673_100000457 | 3300005364 | Bacteria | 21630 |
| 80 | Ga0070673_100200515 | 3300005364 | Bacteria | 1718 |
| 81 | Ga0070688_100000451 | 3300005365 | Bacteria | 20808 |
| 82 | Ga0070688_100246443 | 3300005365 | Bacteria | 1270 |
| 83 | Ga0070659_100000275 | 3300005366 | Bacteria | 40130 |
| 84 | Ga0070659_100003620 | 3300005366 | Bacteria | 10998 |
| 85 | Ga0070659_100148596 | 3300005366 | Bacteria | 1910 |
| 86 | Ga0070667_100003961 | 3300005367 | Bacteria | 12567 |
| 87 | Ga0070667_100046041 | 3300005367 | Bacteria | 3669 |
| 88 | Ga0070703_10004864 | 3300005406 | Bacteria | 3754 |
| 89 | Ga0070714_100416854 | 3300005435 | Bacteria | 1271 |
| 90 | Ga0070701_10001229 | 3300005438 | Bacteria | 9401 |
| 91 | Ga0070701_10003621 | 3300005438 | Bacteria | 6142 |
| 92 | Ga0070701_10306127 | 3300005438 | Bacteria | 978 |
| 93 | Ga0070705_100000576 | 3300005440 | Bacteria | 21287 |
| 94 | Ga0070705_100001410 | 3300005440 | Bacteria | 12716 |
| 95 | Ga0070705_100699836 | 3300005440 | Bacteria | 796 |
| 96 | Ga0070700_100006035 | 3300005441 | Bacteria | 6449 |
| 97 | Ga0070700_100099047 | 3300005441 | Bacteria | 1917 |
| 98 | Ga0070694_100001526 | 3300005444 | Bacteria | 13597 |
| 99 | Ga0070694_100013510 | 3300005444 | Bacteria | 5100 |
| 100 | Ga0070694_100649895 | 3300005444 | Bacteria | 853 |
| 101 | Ga0070663_100002478 | 3300005455 | Bacteria | 10415 |
| 102 | Ga0070663_100006656 | 3300005455 | Bacteria | 6967 |
| 103 | Ga0070663_100024038 | 3300005455 | Bacteria | 4093 |
| 104 | Ga0070678_100000580 | 3300005456 | Bacteria | 17943 |
| 105 | Ga0070662_100000608 | 3300005457 | Bacteria | 21848 |
| 106 | Ga0070662_100002397 | 3300005457 | Bacteria | 11518 |
| 107 | Ga0070662_100433428 | 3300005457 | Bacteria | 1089 |
| 108 | Ga0070681_10038653 | 3300005458 | Bacteria | 4784 |
| 109 | Ga0070681_10045796 | 3300005458 | Bacteria | 4375 |
| 110 | Ga0068867_100001364 | 3300005459 | Bacteria | 16853 |
| 111 | Ga0068867_100003605 | 3300005459 | Bacteria | 10894 |
| 112 | Ga0068867_100304281 | 3300005459 | Bacteria | 1315 |
| 113 | Ga0070685_10000029 | 3300005466 | Bacteria | 89387 |
| 114 | Ga0070685_10071828 | 3300005466 | Bacteria | 2053 |
| 115 | Ga0070679_100004586 | 3300005530 | Bacteria | 12752 |
| 116 | Ga0070684_100099850 | 3300005535 | Bacteria | 2591 |
| 117 | Ga0068853_100000678 | 3300005539 | Bacteria | 23432 |
| 118 | Ga0068853_100002097 | 3300005539 | Bacteria | 14789 |
| 119 | Ga0068853_100015285 | 3300005539 | Bacteria | 6308 |
| 120 | Ga0070672_100020815 | 3300005543 | Bacteria | 4790 |
| 121 | Ga0070672_100094015 | 3300005543 | Bacteria | 2423 |
| 122 | Ga0070686_100000652 | 3300005544 | Bacteria | 20348 |
| 123 | Ga0070686_100079797 | 3300005544 | Bacteria | 2164 |
| 124 | Ga0070695_100002767 | 3300005545 | Bacteria | 10175 |
| 125 | Ga0070695_100006632 | 3300005545 | Bacteria | 6843 |
| 126 | Ga0070695_100009034 | 3300005545 | Bacteria | 5924 |
| 127 | Ga0070695_100571999 | 3300005545 | Bacteria | 883 |
| 128 | Ga0070695_100938605 | 3300005545 | Bacteria | 701 |
| 129 | Ga0070696_100000966 | 3300005546 | Bacteria | 18618 |
| 130 | Ga0070696_100016537 | 3300005546 | Bacteria | 4971 |
| 131 | Ga0070696_100077905 | 3300005546 | Bacteria | 2343 |
| 132 | Ga0070696_100098102 | 3300005546 | Bacteria | 2096 |
| 133 | Ga0070696_100177819 | 3300005546 | Bacteria | 1577 |
| 134 | Ga0070696_100480334 | 3300005546 | Bacteria | 985 |
| 135 | Ga0070693_100000189 | 3300005547 | Bacteria | 28531 |
| 136 | Ga0070693_100017499 | 3300005547 | Bacteria | 3727 |
| 137 | Ga0070693_100233190 | 3300005547 | Bacteria | 1212 |
| 138 | Ga0070665_100003284 | 3300005548 | Bacteria | 17361 |
| 139 | Ga0070665_100075382 | 3300005548 | Bacteria | 3380 |
| 140 | Ga0070665_101232498 | 3300005548 | Bacteria | 759 |
| 141 | Ga0070704_100009072 | 3300005549 | Bacteria | 6000 |
| 142 | Ga0070704_100031769 | 3300005549 | Bacteria | 3555 |
| 143 | Ga0070704_100410663 | 3300005549 | Bacteria | 1157 |
| 144 | Ga0068855_100001417 | 3300005563 | Bacteria | 29769 |
| 145 | Ga0068855_100002802 | 3300005563 | Bacteria | 21454 |
| 146 | Ga0068855_100028396 | 3300005563 | Bacteria | 6693 |
| 147 | Ga0068855_100035134 | 3300005563 | Bacteria | 5971 |
| 148 | Ga0070664_100000413 | 3300005564 | Bacteria | 31911 |
| 149 | Ga0070664_100030855 | 3300005564 | Bacteria | 4474 |
| 150 | Ga0070664_100166635 | 3300005564 | Bacteria | 1952 |
| 151 | Ga0068857_100010610 | 3300005577 | Bacteria | 8010 |
| 152 | Ga0068857_100040946 | 3300005577 | Bacteria | 4107 |
| 153 | Ga0068857_100091502 | 3300005577 | Bacteria | 2723 |
| 154 | Ga0068854_100001086 | 3300005578 | Bacteria | 16390 |
| 155 | Ga0068854_100013498 | 3300005578 | Bacteria | 5364 |
| 156 | Ga0068854_101142575 | 3300005578 | Bacteria | 695 |
| 157 | Ga0068856_100002325 | 3300005614 | Bacteria | 19581 |
| 158 | Ga0068856_100002994 | 3300005614 | Bacteria | 17292 |
| 159 | Ga0068856_100157604 | 3300005614 | Bacteria | 2280 |
| 160 | Ga0070702_100021060 | 3300005615 | Bacteria | 3425 |
| 161 | Ga0070702_100075675 | 3300005615 | Bacteria | 2002 |
| 162 | Ga0070702_100092842 | 3300005615 | Bacteria | 1834 |
| 163 | Ga0068852_100013975 | 3300005616 | Bacteria | 6159 |
| 164 | Ga0068859_100002675 | 3300005617 | Bacteria | 18099 |
| 165 | Ga0068859_100003079 | 3300005617 | Bacteria | 16916 |
| 166 | Ga0068859_100384713 | 3300005617 | Bacteria | 1499 |
| 167 | Ga0068864_100002813 | 3300005618 | Bacteria | 14359 |
| 168 | Ga0068866_10007525 | 3300005718 | Bacteria | 4563 |
| 169 | Ga0068866_10191990 | 3300005718 | Bacteria | 1214 |
| 170 | Ga0068861_100000584 | 3300005719 | Bacteria | 21594 |
| 171 | Ga0068861_100000747 | 3300005719 | Bacteria | 19504 |
| 172 | Ga0068861_100105148 | 3300005719 | Bacteria | 2253 |
| 173 | Ga0068851_10002087 | 3300005834 | Bacteria | 8788 |
| 174 | Ga0068870_10000020 | 3300005840 | Bacteria | 56949 |
| 175 | Ga0068870_10000367 | 3300005840 | Bacteria | 16912 |
| 176 | Ga0068870_10315981 | 3300005840 | Bacteria | 991 |
| 177 | Ga0068863_100057242 | 3300005841 | Bacteria | 3689 |
| 178 | Ga0068863_100066613 | 3300005841 | Bacteria | 3406 |
| 179 | Ga0068863_100245054 | 3300005841 | Bacteria | 1730 |
| 180 | Ga0068858_100016416 | 3300005842 | Bacteria | 6952 |
| 181 | Ga0068858_100045581 | 3300005842 | Bacteria | 4064 |
| 182 | Ga0068858_100162578 | 3300005842 | Bacteria | 2102 |
| 183 | Ga0068860_100019733 | 3300005843 | Bacteria | 6535 |
| 184 | Ga0068860_100093648 | 3300005843 | Bacteria | 2863 |
| 185 | Ga0068860_100154301 | 3300005843 | Bacteria | 2213 |
| 186 | Ga0068862_100000487 | 3300005844 | Bacteria | 42413 |
| 187 | Ga0068862_100032939 | 3300005844 | Bacteria | 4377 |
| 188 | Ga0068862_100157301 | 3300005844 | Bacteria | 2026 |
| 189 | Ga0081455_10000868 | 3300005937 | Bacteria | 39013 |
| 190 | Ga0081540_1000073 | 3300005983 | Bacteria | 108893 |
| 191 | Ga0081540_1000209 | 3300005983 | Bacteria | 61438 |
| 192 | Ga0081540_1002268 | 3300005983 | Bacteria | 15812 |
| 193 | Ga0081540_1112142 | 3300005983 | Bacteria | 1150 |
| 194 | Ga0081539_10002700 | 3300005985 | Bacteria | 24080 |
| 195 | Ga0070717_10042387 | 3300006028 | Bacteria | 3712 |
| 196 | Ga0075365_10153119 | 3300006038 | Bacteria | 1604 |
| 197 | Ga0075363_100028486 | 3300006048 | Bacteria | 2874 |
| 198 | Ga0075364_10006228 | 3300006051 | Bacteria | 6997 |
| 199 | Ga0075362_10002673 | 3300006177 | Bacteria | 6056 |
| 200 | Ga0075367_10002794 | 3300006178 | Bacteria | 8092 |
| 201 | Ga0075367_10085476 | 3300006178 | Bacteria | 1914 |
| 202 | Ga0075366_10000211 | 3300006195 | Bacteria | 25584 |
| 203 | Ga0097621_100000749 | 3300006237 | Bacteria | 22765 |
| 204 | Ga0097621_100009977 | 3300006237 | Bacteria | 6923 |
| 205 | Ga0097621_100234458 | 3300006237 | Bacteria | 1603 |
| 206 | Ga0075370_10029135 | 3300006353 | Bacteria | 3072 |
| 207 | Ga0068871_100001439 | 3300006358 | Bacteria | 15939 |
| 208 | Ga0068871_100282167 | 3300006358 | Bacteria | 1453 |
| 209 | Ga0075428_100032307 | 3300006844 | Bacteria | 5780 |
| 210 | Ga0075428_100783684 | 3300006844 | Bacteria | 1014 |
| 211 | Ga0075430_100293071 | 3300006846 | Bacteria | 1346 |
| 212 | Ga0075430_100500526 | 3300006846 | Bacteria | 1003 |
| 213 | Ga0075431_100357244 | 3300006847 | Bacteria | 1468 |
| 214 | Ga0075431_100445016 | 3300006847 | Bacteria | 1292 |
| 215 | Ga0075433_10015416 | 3300006852 | Bacteria | 6268 |
| 216 | Ga0075433_10122889 | 3300006852 | Bacteria | 2306 |
| 217 | Ga0075433_10422915 | 3300006852 | Bacteria | 1175 |
| 218 | Ga0075434_100002965 | 3300006871 | Bacteria | 15099 |
| 219 | Ga0075434_100073905 | 3300006871 | Bacteria | 3402 |
| 220 | Ga0075429_100044582 | 3300006880 | Bacteria | 3857 |
| 221 | Ga0075429_100888466 | 3300006880 | Bacteria | 780 |
| 222 | Ga0068865_100001088 | 3300006881 | Bacteria | 15661 |
| 223 | Ga0068865_100244513 | 3300006881 | Bacteria | 1413 |
| 224 | Ga0068865_100427726 | 3300006881 | Bacteria | 1090 |
| 225 | Ga0068865_100701553 | 3300006881 | Bacteria | 865 |
| 226 | Ga0075436_100115288 | 3300006914 | Bacteria | 1877 |
| 227 | Ga0097620_100002675 | 3300006931 | Bacteria | 18099 |
| 228 | Ga0097620_100003079 | 3300006931 | Bacteria | 16916 |
| 229 | Ga0097620_100384673 | 3300006931 | Bacteria | 1499 |
| 230 | Ga0075435_100187113 | 3300007076 | Bacteria | 1751 |
| 231 | Ga0075435_100298766 | 3300007076 | Bacteria | 1377 |
| 232 | Ga0105240_10030101 | 3300009093 | Bacteria | 7061 |
| 233 | Ga0111539_10000051 | 3300009094 | Bacteria | 117607 |
| 234 | Ga0111539_10000113 | 3300009094 | Bacteria | 89042 |
| 235 | Ga0111539_10195787 | 3300009094 | Bacteria | 2357 |
| 236 | Ga0105245_10004584 | 3300009098 | Bacteria | 12204 |
| 237 | Ga0105245_10299172 | 3300009098 | Bacteria | 1578 |
| 238 | Ga0105245_10649407 | 3300009098 | Bacteria | 1085 |
| 239 | Ga0105247_10000214 | 3300009101 | Bacteria | 56190 |
| 240 | Ga0114129_10438734 | 3300009147 | Bacteria | 1714 |
| 241 | Ga0114129_10705785 | 3300009147 | Bacteria | 1296 |
| 242 | Ga0114129_11218689 | 3300009147 | Bacteria | 936 |
| 243 | Ga0105243_10002675 | 3300009148 | Bacteria | 14802 |
| 244 | Ga0105243_10141481 | 3300009148 | Bacteria | 2053 |
| 245 | Ga0105243_10432288 | 3300009148 | Bacteria | 1231 |
| 246 | Ga0105243_11295237 | 3300009148 | Bacteria | 746 |
| 247 | Ga0105241_10001059 | 3300009174 | Bacteria | 20968 |
| 248 | Ga0105241_10003142 | 3300009174 | Bacteria | 12285 |
| 249 | Ga0105241_10440638 | 3300009174 | Bacteria | 1150 |
| 250 | Ga0105242_10002175 | 3300009176 | Bacteria | 15459 |
| 251 | Ga0105242_10278126 | 3300009176 | Bacteria | 1519 |
| 252 | Ga0105248_10002337 | 3300009177 | Bacteria | 21039 |
| 253 | Ga0105248_10745226 | 3300009177 | Bacteria | 1105 |
| 254 | Ga0105237_10000421 | 3300009545 | Bacteria | 60441 |
| 255 | Ga0105237_10109298 | 3300009545 | Bacteria | 2757 |
| 256 | Ga0105237_10111971 | 3300009545 | Bacteria | 2721 |
| 257 | Ga0105237_11374424 | 3300009545 | Bacteria | 712 |
| 258 | Ga0105238_10002253 | 3300009551 | Bacteria | 19442 |
| 259 | Ga0105238_10009255 | 3300009551 | Bacteria | 9860 |
| 260 | Ga0105249_10003184 | 3300009553 | Bacteria | 14201 |
| 261 | Ga0105249_10101339 | 3300009553 | Bacteria | 2708 |
| 262 | Ga0105249_10375203 | 3300009553 | Bacteria | 1447 |
| 263 | Ga0105239_10004165 | 3300010375 | Bacteria | 17370 |
| 264 | Ga0105239_10181133 | 3300010375 | Bacteria | 2357 |
| 265 | Ga0105239_11166417 | 3300010375 | Bacteria | 887 |
| 266 | Ga0105246_10010489 | 3300011119 | Bacteria | 5735 |
| 267 | Ga0105246_10080455 | 3300011119 | Bacteria | 2319 |
| 268 | Ga0157373_10003191 | 3300013100 | Bacteria | 12398 |
| 269 | Ga0157373_10107793 | 3300013100 | Bacteria | 1959 |
| 270 | Ga0157371_10000366 | 3300013102 | Bacteria | 57015 |
| 271 | Ga0157371_10186076 | 3300013102 | Bacteria | 1486 |
| 272 | Ga0157370_10074553 | 3300013104 | Bacteria | 3201 |
| 273 | Ga0157369_10000489 | 3300013105 | Bacteria | 52511 |
| 274 | Ga0157369_10027421 | 3300013105 | Bacteria | 6314 |
| 275 | Ga0157369_10517017 | 3300013105 | Bacteria | 1235 |
| 276 | Ga0157374_10023967 | 3300013296 | Bacteria | 5466 |
| 277 | Ga0157374_10084262 | 3300013296 | Bacteria | 3021 |
| 278 | Ga0157378_10001507 | 3300013297 | Bacteria | 21088 |
| 279 | Ga0157378_10496427 | 3300013297 | Bacteria | 1218 |
| 280 | Ga0163162_10001347 | 3300013306 | Bacteria | 22875 |
| 281 | Ga0163162_10279079 | 3300013306 | Bacteria | 1803 |
| 282 | Ga0157372_10003591 | 3300013307 | Bacteria | 16692 |
| 283 | Ga0157372_10006794 | 3300013307 | Bacteria | 12165 |
| 284 | Ga0157372_10054504 | 3300013307 | Bacteria | 4461 |
| 285 | Ga0157372_10199964 | 3300013307 | Bacteria | 2315 |
| 286 | Ga0157375_10002709 | 3300013308 | Bacteria | 15321 |
| 287 | Ga0157375_10021538 | 3300013308 | Bacteria | 5913 |
| 288 | Ga0163163_10015231 | 3300014325 | Bacteria | 7103 |
| 289 | Ga0163163_10181453 | 3300014325 | Bacteria | 2152 |
| 290 | Ga0157380_10153882 | 3300014326 | Bacteria | 1991 |
| 291 | Ga0182008_10227273 | 3300014497 | Bacteria | 956 |
| 292 | Ga0157377_10000764 | 3300014745 | Bacteria | 13292 |
| 293 | Ga0157379_10000390 | 3300014968 | Bacteria | 35479 |
| 294 | Ga0157379_10141398 | 3300014968 | Bacteria | 2170 |
| 295 | Ga0157379_11436765 | 3300014968 | Bacteria | 669 |
| 296 | Ga0157379_11520938 | 3300014968 | Bacteria | 651 |
| 297 | Ga0157376_10000902 | 3300014969 | Bacteria | 19401 |
| 298 | Ga0182007_10155536 | 3300015262 | Bacteria | 779 |
| 299 | Ga0163161_10008932 | 3300017792 | Bacteria | 6929 |
| 300 | Ga0163161_10108321 | 3300017792 | Bacteria | 2074 |
| 301 | Ga0206355_1107471 | 3300020076 | Bacteria | 1368 |
| 302 | Ga0206355_1701660 | 3300020076 | Bacteria | 659 |
| 303 | Ga0206353_11798732 | 3300020082 | Bacteria | 641 |
| 304 | Ga0154015_1082936 | 3300020610 | Bacteria | 798 |
| 305 | Ga0154015_1692643 | 3300020610 | Bacteria | 1324 |
| 306 | Ga0213876_10040137 | 3300021384 | Bacteria | 2472 |
| 307 | Ga0213876_10376992 | 3300021384 | Bacteria | 754 |
| 308 | Ga0224712_10201100 | 3300022467 | Bacteria | 906 |
| 309 | Ga0207697_10000203 | 3300025315 | Bacteria | 31820 |
| 310 | Ga0207656_10001939 | 3300025321 | Bacteria | 6876 |
| 311 | Ga0207653_10003686 | 3300025885 | Bacteria | 4816 |
| 312 | Ga0207682_10000257 | 3300025893 | Bacteria | 23951 |
| 313 | Ga0207642_10000606 | 3300025899 | Bacteria | 11035 |
| 314 | Ga0207710_10002096 | 3300025900 | Bacteria | 9437 |
| 315 | Ga0207688_10003903 | 3300025901 | Bacteria | 8131 |
| 316 | Ga0207688_10022445 | 3300025901 | Bacteria | 3453 |
| 317 | Ga0207680_10002283 | 3300025903 | Bacteria | 8938 |
| 318 | Ga0207647_10000387 | 3300025904 | Bacteria | 35927 |
| 319 | Ga0207647_10345783 | 3300025904 | Bacteria | 842 |
| 320 | Ga0207645_10000400 | 3300025907 | Bacteria | 35898 |
| 321 | Ga0207645_10000417 | 3300025907 | Bacteria | 35339 |
| 322 | Ga0207645_10349998 | 3300025907 | Bacteria | 989 |
| 323 | Ga0207643_10000154 | 3300025908 | Bacteria | 47376 |
| 324 | Ga0207643_10003419 | 3300025908 | Bacteria | 8550 |
| 325 | Ga0207705_10000646 | 3300025909 | Bacteria | 29012 |
| 326 | Ga0207705_10007789 | 3300025909 | Bacteria | 7865 |
| 327 | Ga0207654_10003639 | 3300025911 | Bacteria | 7775 |
| 328 | Ga0207654_10031346 | 3300025911 | Bacteria | 2927 |
| 329 | Ga0207707_10000116 | 3300025912 | Bacteria | 81364 |
| 330 | Ga0207707_10038158 | 3300025912 | Bacteria | 4198 |
| 331 | Ga0207707_10099945 | 3300025912 | Bacteria | 2535 |
| 332 | Ga0207695_10112888 | 3300025913 | Bacteria | 2694 |
| 333 | Ga0207671_10004205 | 3300025914 | Bacteria | 13873 |
| 334 | Ga0207671_10040655 | 3300025914 | Bacteria | 3441 |
| 335 | Ga0207671_10064091 | 3300025914 | Bacteria | 2732 |
| 336 | Ga0207671_10152366 | 3300025914 | Bacteria | 1786 |
| 337 | Ga0207660_10031723 | 3300025917 | Bacteria | 3642 |
| 338 | Ga0207660_10074723 | 3300025917 | Bacteria | 2474 |
| 339 | Ga0207662_10000009 | 3300025918 | Bacteria | 95358 |
| 340 | Ga0207662_10004846 | 3300025918 | Bacteria | 7118 |
| 341 | Ga0207662_10035306 | 3300025918 | Bacteria | 2920 |
| 342 | Ga0207657_10000042 | 3300025919 | Bacteria | 118735 |
| 343 | Ga0207657_10000211 | 3300025919 | Bacteria | 60392 |
| 344 | Ga0207657_10003066 | 3300025919 | Bacteria | 17879 |
| 345 | Ga0207649_10000987 | 3300025920 | Bacteria | 17613 |
| 346 | Ga0207649_10002245 | 3300025920 | Bacteria | 10920 |
| 347 | Ga0207649_10024354 | 3300025920 | Bacteria | 3517 |
| 348 | Ga0207649_10168371 | 3300025920 | Unclassified | 1524 |
| 349 | Ga0207652_10001356 | 3300025921 | Bacteria | 21761 |
| 350 | Ga0207652_10004556 | 3300025921 | Bacteria | 11242 |
| 351 | Ga0207652_10114107 | 3300025921 | Bacteria | 2398 |
| 352 | Ga0207681_10002545 | 3300025923 | Bacteria | 11578 |
| 353 | Ga0207681_10072461 | 3300025923 | Bacteria | 2406 |
| 354 | Ga0207681_10232201 | 3300025923 | Bacteria | 1432 |
| 355 | Ga0207694_10048935 | 3300025924 | Bacteria | 3271 |
| 356 | Ga0207650_10001430 | 3300025925 | Bacteria | 17219 |
| 357 | Ga0207650_10002578 | 3300025925 | Bacteria | 12541 |
| 358 | Ga0207659_10000098 | 3300025926 | Bacteria | 51164 |
| 359 | Ga0207659_10025263 | 3300025926 | Bacteria | 3989 |
| 360 | Ga0207659_10171166 | 3300025926 | Bacteria | 1713 |
| 361 | Ga0207687_10013393 | 3300025927 | Bacteria | 5354 |
| 362 | Ga0207687_10239245 | 3300025927 | Bacteria | 1438 |
| 363 | Ga0207664_10032126 | 3300025929 | Bacteria | 4022 |
| 364 | Ga0207644_10002971 | 3300025931 | Bacteria | 10917 |
| 365 | Ga0207644_10228371 | 3300025931 | Bacteria | 1478 |
| 366 | Ga0207690_10002397 | 3300025932 | Bacteria | 11351 |
| 367 | Ga0207690_10031318 | 3300025932 | Bacteria | 3402 |
| 368 | Ga0207706_10000046 | 3300025933 | Bacteria | 119273 |
| 369 | Ga0207706_10002411 | 3300025933 | Bacteria | 18232 |
| 370 | Ga0207706_10311822 | 3300025933 | Bacteria | 1370 |
| 371 | Ga0207686_10004103 | 3300025934 | Bacteria | 7815 |
| 372 | Ga0207709_10009278 | 3300025935 | Bacteria | 5418 |
| 373 | Ga0207709_10084060 | 3300025935 | Bacteria | 2060 |
| 374 | Ga0207670_10000320 | 3300025936 | Bacteria | 28684 |
| 375 | Ga0207670_10030383 | 3300025936 | Bacteria | 3452 |
| 376 | Ga0207669_10006867 | 3300025937 | Bacteria | 5234 |
| 377 | Ga0207669_10052790 | 3300025937 | Bacteria | 2444 |
| 378 | Ga0207704_10001258 | 3300025938 | Bacteria | 11320 |
| 379 | Ga0207704_10026106 | 3300025938 | Bacteria | 3200 |
| 380 | Ga0207704_10527197 | 3300025938 | Bacteria | 956 |
| 381 | Ga0207704_10630333 | 3300025938 | Bacteria | 881 |
| 382 | Ga0207691_10000766 | 3300025940 | Bacteria | 31756 |
| 383 | Ga0207691_10001566 | 3300025940 | Bacteria | 22711 |
| 384 | Ga0207691_10026597 | 3300025940 | Bacteria | 5429 |
| 385 | Ga0207711_10001432 | 3300025941 | Bacteria | 22337 |
| 386 | Ga0207711_11086753 | 3300025941 | Bacteria | 741 |
| 387 | Ga0207689_10000567 | 3300025942 | Bacteria | 35339 |
| 388 | Ga0207689_10007902 | 3300025942 | Bacteria | 9291 |
| 389 | Ga0207689_10011859 | 3300025942 | Bacteria | 7467 |
| 390 | Ga0207689_10434195 | 3300025942 | Bacteria | 1097 |
| 391 | Ga0207661_10011775 | 3300025944 | Bacteria | 6351 |
| 392 | Ga0207661_10392588 | 3300025944 | Bacteria | 1257 |
| 393 | Ga0207679_10000634 | 3300025945 | Bacteria | 23441 |
| 394 | Ga0207679_10000752 | 3300025945 | Bacteria | 21525 |
| 395 | Ga0207667_10000342 | 3300025949 | Bacteria | 63745 |
| 396 | Ga0207667_10009926 | 3300025949 | Bacteria | 11168 |
| 397 | Ga0207667_10050604 | 3300025949 | Bacteria | 4383 |
| 398 | Ga0207667_10742763 | 3300025949 | Bacteria | 981 |
| 399 | Ga0207651_10000279 | 3300025960 | Bacteria | 21913 |
| 400 | Ga0207651_10156436 | 3300025960 | Bacteria | 1781 |
| 401 | Ga0207712_10001071 | 3300025961 | Bacteria | 19150 |
| 402 | Ga0207668_10009462 | 3300025972 | Bacteria | 5843 |
| 403 | Ga0207668_10204056 | 3300025972 | Bacteria | 1576 |
| 404 | Ga0207640_10003620 | 3300025981 | Bacteria | 8341 |
| 405 | Ga0207640_10398551 | 3300025981 | Bacteria | 1120 |
| 406 | Ga0207658_10000501 | 3300025986 | Bacteria | 35943 |
| 407 | Ga0207658_10113017 | 3300025986 | Bacteria | 2151 |
| 408 | Ga0207658_10462246 | 3300025986 | Bacteria | 1125 |
| 409 | Ga0207677_10000380 | 3300026023 | Bacteria | 30648 |
| 410 | Ga0207677_10004667 | 3300026023 | Bacteria | 7380 |
| 411 | Ga0207677_10106567 | 3300026023 | Bacteria | 2077 |
| 412 | Ga0207703_10000628 | 3300026035 | Bacteria | 35533 |
| 413 | Ga0207703_10072222 | 3300026035 | Bacteria | 2852 |
| 414 | Ga0207703_10212740 | 3300026035 | Bacteria | 1725 |
| 415 | Ga0207639_10001737 | 3300026041 | Bacteria | 14681 |
| 416 | Ga0207639_10002863 | 3300026041 | Bacteria | 11590 |
| 417 | Ga0207639_10006214 | 3300026041 | Bacteria | 8114 |
| 418 | Ga0207678_10000501 | 3300026067 | Bacteria | 35486 |
| 419 | Ga0207678_10032873 | 3300026067 | Bacteria | 4521 |
| 420 | Ga0207678_10039049 | 3300026067 | Bacteria | 4121 |
| 421 | Ga0207678_10105169 | 3300026067 | Bacteria | 2408 |
| 422 | Ga0207708_10034182 | 3300026075 | Bacteria | 3866 |
| 423 | Ga0207708_10063338 | 3300026075 | Bacteria | 2825 |
| 424 | Ga0207708_10913509 | 3300026075 | Bacteria | 760 |
| 425 | Ga0207702_10002217 | 3300026078 | Bacteria | 18618 |
| 426 | Ga0207702_10011537 | 3300026078 | Bacteria | 7363 |
| 427 | Ga0207641_10001707 | 3300026088 | Bacteria | 21354 |
| 428 | Ga0207648_10000811 | 3300026089 | Bacteria | 35339 |
| 429 | Ga0207648_10005284 | 3300026089 | Bacteria | 13031 |
| 430 | Ga0207648_10060925 | 3300026089 | Bacteria | 3290 |
| 431 | Ga0207648_10091775 | 3300026089 | Bacteria | 2655 |
| 432 | Ga0207676_10000688 | 3300026095 | Bacteria | 26734 |
| 433 | Ga0207676_10191058 | 3300026095 | Bacteria | 1802 |
| 434 | Ga0207676_10217709 | 3300026095 | Bacteria | 1698 |
| 435 | Ga0207674_10000038 | 3300026116 | Bacteria | 132350 |
| 436 | Ga0207674_10000951 | 3300026116 | Bacteria | 37804 |
| 437 | Ga0207674_10036269 | 3300026116 | Bacteria | 5140 |
| 438 | Ga0207674_11070908 | 3300026116 | Bacteria | 775 |
| 439 | Ga0207675_100000023 | 3300026118 | Bacteria | 114960 |
| 440 | Ga0207675_100033947 | 3300026118 | Bacteria | 4755 |
| 441 | Ga0207675_100034035 | 3300026118 | Bacteria | 4748 |
| 442 | Ga0207683_10001637 | 3300026121 | Bacteria | 20061 |
| 443 | Ga0207683_10463896 | 3300026121 | Bacteria | 1168 |
| 444 | Ga0207698_10001393 | 3300026142 | Bacteria | 14040 |
| 445 | Ga0209969_1008442 | 3300027360 | Bacteria | 1461 |
| 446 | Ga0209967_1006204 | 3300027364 | Bacteria | 1617 |
| 447 | Ga0209996_1013416 | 3300027395 | Bacteria | 1107 |
| 448 | Ga0209995_1006777 | 3300027471 | Bacteria | 1844 |
| 449 | Ga0209968_1007758 | 3300027526 | Bacteria | 1627 |
| 450 | Ga0209999_1000911 | 3300027543 | Bacteria | 4965 |
| 451 | Ga0209982_1023843 | 3300027552 | Bacteria | 947 |
| 452 | Ga0209970_1000541 | 3300027614 | Bacteria | 6543 |
| 453 | Ga0210002_1016194 | 3300027617 | Bacteria | 1179 |
| 454 | Ga0209983_1000982 | 3300027665 | Bacteria | 6291 |
| 455 | Ga0209971_1000037 | 3300027682 | Bacteria | 45920 |
| 456 | Ga0209971_1102700 | 3300027682 | Bacteria | 700 |
| 457 | Ga0209966_1000467 | 3300027695 | Bacteria | 11064 |
| 458 | Ga0209998_10000042 | 3300027717 | Bacteria | 51743 |
| 459 | Ga0209974_10062797 | 3300027876 | Bacteria | 1259 |
| 460 | Ga0207428_10000016 | 3300027907 | Bacteria | 327690 |
| 461 | Ga0207428_10001085 | 3300027907 | Bacteria | 29652 |
| 462 | Ga0268266_10002035 | 3300028379 | Bacteria | 22441 |
| 463 | Ga0268266_10003855 | 3300028379 | Bacteria | 14632 |
| 464 | Ga0268266_10214331 | 3300028379 | Bacteria | 1767 |
| 465 | Ga0268266_10544594 | 3300028379 | Bacteria | 1111 |
| 466 | Ga0268265_10001348 | 3300028380 | Bacteria | 20919 |
| 467 | Ga0268265_10001893 | 3300028380 | Bacteria | 16656 |
| 468 | Ga0268265_10115491 | 3300028380 | Bacteria | 2200 |
| 469 | Ga0268265_10162433 | 3300028380 | Bacteria | 1899 |
| 470 | Ga0268264_10000191 | 3300028381 | Bacteria | 127257 |
| 471 | Ga0268264_10128763 | 3300028381 | Bacteria | 2241 |
| 472 | Ga0268264_10256056 | 3300028381 | Bacteria | 1628 |
| 473 | Ga0265326_10075248 | 3300028558 | Bacteria | 955 |
| 474 | Ga0265319_1067369 | 3300028563 | Bacteria | 1151 |
| 475 | Ga0265334_10032772 | 3300028573 | Bacteria | 2070 |
| 476 | Ga0265318_10000215 | 3300028577 | Bacteria | 50092 |
| 477 | Ga0265338_10120405 | 3300028800 | Bacteria | 2093 |
| 478 | Ga0265762_1088910 | 3300030760 | Bacteria | 671 |
| 479 | Ga0265330_10005185 | 3300031235 | Bacteria | 6517 |
| 480 | Ga0265332_10002290 | 3300031238 | Bacteria | 9787 |
| 481 | Ga0265328_10005771 | 3300031239 | Bacteria | 5283 |
| 482 | Ga0265329_10001026 | 3300031242 | Bacteria | 13928 |
| 483 | Ga0265340_10076478 | 3300031247 | Bacteria | 1581 |
| 484 | Ga0265339_10047348 | 3300031249 | Bacteria | 2361 |
| 485 | Ga0265331_10000002 | 3300031250 | Bacteria | 511481 |
| 486 | Ga0265331_10001505 | 3300031250 | Bacteria | 17195 |
| 487 | Ga0265327_10000034 | 3300031251 | Bacteria | 316018 |
| 488 | Ga0265316_10004776 | 3300031344 | Bacteria | 13367 |
| 489 | Ga0307513_10493865 | 3300031456 | Bacteria | 942 |
| 490 | Ga0265314_10001991 | 3300031711 | Bacteria | 21691 |
| 491 | Ga0265314_10006841 | 3300031711 | Bacteria | 9991 |
| 492 | Ga0265342_10001504 | 3300031712 | Bacteria | 21609 |
| 493 | Ga0373948_0027813 | 3300034817 | Bacteria | 1122 |
| 494 | Ga0373950_0000025 | 3300034818 | Bacteria | 177524 |
| 495 | Ga0373923_0057529 | 3300035111 | Bacteria | 1644 |
| 496 | Ga0373932_0141900 | 3300035112 | Bacteria | 818 |
| 497 | Ga0373936_0054520 | 3300035113 | Bacteria | 1622 |
| 498 | Ga0373941_0036806 | 3300035115 | Bacteria | 1490 |
| 499 | Ga0373953_0124136 | 3300035117 | Bacteria | 1098 |
| 500 | Ga0373956_0458986 | 3300035119 | Bacteria | 608 |
| 501 | Ga0373957_0276681 | 3300035120 | Bacteria | 709 |
| 502 | Ga0373960_0023435 | 3300035121 | Bacteria | 1662 |
| 503 | Ga0373955_0097096 | 3300035172 | Bacteria | 1687 |
| 504 | Ga0373961_0027993 | 3300035241 | Bacteria | 1551 |
| 505 | Ga0373962_0077980 | 3300035242 | Bacteria | 1001 |
| 506 | Ga0373924_0185633 | 3300035410 | Bacteria | 915 |
| 507 | Ga0373931_0011793 | 3300035691 | Bacteria | 4226 |
| 508 | Ga0373935_0072863 | 3300035692 | Bacteria | 2218 |
| 509 | Ga0373927_0338032 | 3300035695 | Bacteria | 992 |
| 510 | Ga0373933_0014104 | 3300035724 | Bacteria | 4438 |
| 511 | Ga0373947_0852353 | 3300035725 | Bacteria | 622 |
| 512 | Ga0373937_0015816 | 3300036401 | Bacteria | 6684 |
| 513 | Ga0373925_0049098 | 3300037068 | Bacteria | 3145 |
| 514 | Ga0373925_0181603 | 3300037068 | Bacteria | 1666 |
| 515 | Ga0395899_0012252 | 3300037312 | Bacteria | 6567 |
| 516 | Ga0395900_0201832 | 3300037418 | Bacteria | 2011 |
| 517 | Ga0395900_0272983 | 3300037418 | Bacteria | 1685 |
| 518 | Ga0395898_0201793 | 3300037466 | Bacteria | 1898 |
| 519 | Ga0395898_0455085 | 3300037466 | Bacteria | 1219 |
| 520 | Ga0436364_0027385 | 3300037853 | Bacteria | 2864 |
| 521 | Ga0395901_0634719 | 3300038443 | Bacteria | 1073 |
| 522 | Ga0395901_0710824 | 3300038443 | Bacteria | 1001 |
| 523 | Ga0436365_1705686 | 3300039437 | Bacteria | 3434 |
| 524 | Ga0436361_0841563 | 3300039447 | Bacteria | 3336 |
| 525 | Ga0439448_0001809 | 3300042005 | Bacteria | 5656 |
| 526 | Ga0439448_0043070 | 3300042005 | Bacteria | 1465 |
| 527 | Ga0439450_004186 | 3300042008 | Bacteria | 2447 |
| 528 | Ga0439455_0135580 | 3300042012 | Bacteria | 696 |
| 529 | Ga0450889_004365 | 3300042144 | Bacteria | 1397 |
| 530 | Ga0439458_0034276 | 3300042157 | Bacteria | 1218 |
| 531 | Ga0439459_0006217 | 3300042438 | Bacteria | 1982 |
| 532 | Ga0439464_0019320 | 3300042439 | Bacteria | 1859 |
| 533 | Ga0451577_0019330 | 3300042876 | Bacteria | 6264 |
| 534 | Ga0451577_0207056 | 3300042876 | Bacteria | 1771 |
| 535 | Ga0439440_0045336 | 3300042993 | Bacteria | 1084 |
| 536 | Ga0466972_0043091 | 3300044658 | Bacteria | 2192 |
| 537 | Ga0466972_0237069 | 3300044658 | Bacteria | 854 |
| 538 | Ga0453683_0620878 | 3300044673 | Bacteria | 706 |
| 539 | Ga0466965_0014625 | 3300044683 | Bacteria | 3715 |
| 540 | Ga0466963_0047382 | 3300044694 | Bacteria | 2837 |
| 541 | Ga0453684_0103159 | 3300044712 | Bacteria | 3486 |
| 542 | Ga0453684_0868414 | 3300044712 | Bacteria | 968 |
| 543 | Ga0466968_0001698 | 3300044735 | Bacteria | 7930 |
| 544 | Ga0466970_0031269 | 3300044765 | Bacteria | 2811 |
| 545 | Ga0466970_0080870 | 3300044765 | Bacteria | 1756 |
| 546 | Ga0466957_0051034 | 3300044842 | Bacteria | 2517 |
| 547 | Ga0466960_0037474 | 3300044901 | Bacteria | 2274 |
| 548 | Ga0466959_0093724 | 3300045049 | Bacteria | 2155 |
| 549 | Ga0466959_0097972 | 3300045049 | Bacteria | 2100 |
| 550 | Ga0451576_0017994 | 3300045051 | Bacteria | 7753 |
| 551 | Ga0451576_0031917 | 3300045051 | Bacteria | 5613 |
| 552 | Ga0451576_0051976 | 3300045051 | Bacteria | 4295 |
| 553 | Ga0451576_0290384 | 3300045051 | Bacteria | 1710 |
| 554 | Ga0451576_0333654 | 3300045051 | Bacteria | 1587 |
| 555 | Ga0451576_0743057 | 3300045051 | Bacteria | 1030 |
| 556 | Ga0466958_0009323 | 3300045836 | Bacteria | 5469 |
| 557 | Ga0466967_0003987 | 3300045976 | Bacteria | 9832 |
| 558 | Ga0466967_0015597 | 3300045976 | Bacteria | 5959 |
| 559 | Ga0466967_0023877 | 3300045976 | Bacteria | 5018 |
| 560 | Ga0466967_1198005 | 3300045976 | Bacteria | 757 |
| 561 | Ga0495651_0014442 | 3300046462 | Bacteria | 6105 |
| 562 | Ga0495653_0197680 | 3300046463 | Bacteria | 1367 |
| 563 | Ga0495580_0369048 | 3300046472 | Bacteria | 971 |
| 564 | Ga0495664_0555593 | 3300046477 | Bacteria | 684 |
| 565 | Ga0495618_0158805 | 3300046514 | Bacteria | 1442 |
| 566 | Ga0495628_0002592 | 3300046516 | Bacteria | 16251 |
| 567 | Ga0495640_0135895 | 3300046533 | Bacteria | 1588 |
| 568 | Ga0495586_0288129 | 3300046535 | Bacteria | 940 |
| 569 | Ga0495667_0345874 | 3300046559 | Bacteria | 940 |
| 570 | Ga0495635_0489579 | 3300046663 | Bacteria | 810 |
| 571 | Ga0495657_0088061 | 3300046675 | Bacteria | 1997 |
| 572 | Ga0495599_0088818 | 3300046678 | Bacteria | 1929 |
| 573 | Ga0495589_0348009 | 3300046794 | Bacteria | 683 |
| 574 | Ga0495680_0082293 | 3300047322 | Bacteria | 2429 |
| 575 | Ga0495680_0210794 | 3300047322 | Bacteria | 1391 |
| 576 | Ga0495675_0287673 | 3300047444 | Bacteria | 979 |
| 577 | Ga0495677_0068479 | 3300047445 | Bacteria | 1321 |
| 578 | Ga0495684_0050189 | 3300047471 | Bacteria | 3186 |
| 579 | Ga0495684_0117350 | 3300047471 | Bacteria | 2006 |
| 580 | Ga0496101_0030315 | 3300048904 | Bacteria | 3791 |
| 581 | Ga0496101_0083421 | 3300048904 | Bacteria | 2366 |
| 582 | Ga0496102_0005889 | 3300048905 | Bacteria | 10432 |
| 583 | Ga0496102_1159349 | 3300048905 | Bacteria | 692 |
| 584 | Ga0496103_0028856 | 3300048906 | Bacteria | 3370 |
| 585 | Ga0496103_0218091 | 3300048906 | Bacteria | 1227 |
| 586 | Ga0496103_0223942 | 3300048906 | Bacteria | 1209 |
| 587 | Ga0496104_0625191 | 3300048907 | Bacteria | 986 |
| 588 | Ga0496105_0741880 | 3300048908 | Bacteria | 751 |
| 589 | Ga0496106_0050970 | 3300048909 | Bacteria | 3120 |
| 590 | Ga0496106_0304633 | 3300048909 | Bacteria | 1278 |
| 591 | Ga0496107_0010589 | 3300048910 | Bacteria | 6410 |
| 592 | Ga0496108_0150013 | 3300048911 | Bacteria | 2011 |
| 593 | Ga0496108_0383283 | 3300048911 | Bacteria | 1228 |
| 594 | Ga0496109_0018306 | 3300048912 | Bacteria | 6152 |
| 595 | Ga0496111_0034054 | 3300048914 | Bacteria | 3636 |
| 596 | Ga0496112_0027679 | 3300048915 | Bacteria | 5467 |
| 597 | Ga0496112_0029496 | 3300048915 | Bacteria | 5306 |
| 598 | Ga0496112_0117159 | 3300048915 | Bacteria | 2634 |
| 599 | Ga0496113_0014623 | 3300048916 | Bacteria | 5362 |
| 600 | Ga0496114_0020911 | 3300048917 | Bacteria | 5316 |
| 601 | Ga0496114_0349246 | 3300048917 | Bacteria | 1308 |
| 602 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 603 | Ga0496117_0034031 | 3300048920 | Bacteria | 3846 |
| 604 | Ga0496118_0000435 | 3300048921 | Bacteria | 69378 |
| 605 | Ga0496118_0006905 | 3300048921 | Bacteria | 12289 |
| 606 | Ga0496121_0000106 | 3300048924 | Bacteria | 191065 |
| 607 | Ga0496122_0068650 | 3300048925 | Bacteria | 2543 |
| 608 | Ga0496123_0034157 | 3300048926 | Bacteria | 3647 |
| 609 | Ga0501031_0354924 | 3300049568 | Bacteria | 949 |
| 610 | Ga0501031_0613871 | 3300049568 | Bacteria | 699 |
| 611 | Ga0501032_0009488 | 3300049569 | Bacteria | 7053 |
| 612 | Ga0501033_0005242 | 3300049570 | Bacteria | 10291 |
| 613 | Ga0501033_0061650 | 3300049570 | Bacteria | 2764 |
| 614 | Ga0501033_0231920 | 3300049570 | Bacteria | 1311 |
| 615 | Ga0501033_0341668 | 3300049570 | Bacteria | 1049 |
| 616 | Ga0501034_0000120 | 3300049571 | Bacteria | 144382 |
| 617 | Ga0501034_0015666 | 3300049571 | Bacteria | 7784 |
| 618 | Ga0501036_0004223 | 3300049572 | Bacteria | 11580 |
| 619 | Ga0501036_0180767 | 3300049572 | Bacteria | 1775 |
| 620 | Ga0501037_0029170 | 3300049573 | Bacteria | 4076 |
| 621 | Ga0501037_0401731 | 3300049573 | Bacteria | 940 |
| 622 | Ga0501038_0228386 | 3300049574 | Bacteria | 1482 |
| 623 | Ga0501039_0087002 | 3300049575 | Bacteria | 2434 |
| 624 | Ga0501040_0026145 | 3300049576 | Bacteria | 3925 |
| 625 | Ga0501040_0035104 | 3300049576 | Bacteria | 3399 |
| 626 | Ga0501041_0069737 | 3300049577 | Bacteria | 2157 |
| 627 | Ga0501041_0202205 | 3300049577 | Bacteria | 1245 |
| 628 | Ga0501042_0014830 | 3300049578 | Bacteria | 5324 |
| 629 | Ga0501043_0002110 | 3300049579 | Bacteria | 16965 |
| 630 | Ga0501043_0069587 | 3300049579 | Bacteria | 2764 |
| 631 | Ga0501046_0000111 | 3300049580 | Bacteria | 86335 |
| 632 | Ga0501046_0001310 | 3300049580 | Bacteria | 24115 |
| 633 | Ga0501046_0011358 | 3300049580 | Bacteria | 7620 |
| 634 | Ga0501046_0299416 | 3300049580 | Bacteria | 1175 |
| 635 | Ga0501047_0000009 | 3300049581 | Bacteria | 436619 |
| 636 | Ga0501047_0033249 | 3300049581 | Bacteria | 4978 |
| 637 | Ga0501047_0370681 | 3300049581 | Bacteria | 1267 |
| 638 | Ga0501048_0019214 | 3300049582 | Bacteria | 5017 |
| 639 | Ga0501048_0772468 | 3300049582 | Bacteria | 690 |
| 640 | Ga0501068_0012880 | 3300049584 | Bacteria | 4750 |
| 641 | Ga0501068_0154864 | 3300049584 | Bacteria | 1442 |
| 642 | Ga0501068_0672170 | 3300049584 | Bacteria | 677 |
| 643 | Ga0501069_0285871 | 3300049585 | Bacteria | 966 |
| 644 | Ga0501070_0006875 | 3300049586 | Bacteria | 9677 |
| 645 | Ga0501070_0570277 | 3300049586 | Bacteria | 904 |
| 646 | Ga0501072_0000100 | 3300049588 | Bacteria | 64147 |
| 647 | Ga0501072_0348755 | 3300049588 | Bacteria | 1175 |
| 648 | Ga0501072_0500170 | 3300049588 | Bacteria | 961 |
| 649 | Ga0501072_0963351 | 3300049588 | Bacteria | 666 |
| 650 | Ga0501073_0005071 | 3300049589 | Bacteria | 9877 |
| 651 | Ga0501074_0000690 | 3300049590 | Bacteria | 21099 |
| 652 | Ga0501074_0019373 | 3300049590 | Bacteria | 4943 |
| 653 | Ga0501075_0005797 | 3300049591 | Bacteria | 8451 |
| 654 | Ga0501075_0048946 | 3300049591 | Bacteria | 3176 |
| 655 | Ga0501076_0023360 | 3300049592 | Bacteria | 4765 |
| 656 | Ga0501076_0165888 | 3300049592 | Bacteria | 1800 |
| 657 | Ga0501077_0004230 | 3300049593 | Bacteria | 8675 |
| 658 | Ga0501077_0023141 | 3300049593 | Bacteria | 3939 |
| 659 | Ga0501077_0333711 | 3300049593 | Bacteria | 967 |
| 660 | Ga0501079_0000167 | 3300049741 | Bacteria | 36490 |
| 661 | Ga0501079_0009213 | 3300049741 | Bacteria | 7478 |
| 662 | Ga0501079_0120373 | 3300049741 | Bacteria | 2041 |
| 663 | Ga0501080_0001200 | 3300049742 | Bacteria | 21482 |
| 664 | Ga0501080_0036091 | 3300049742 | Bacteria | 4615 |
| 665 | Ga0501080_0580899 | 3300049742 | Bacteria | 996 |
| 666 | Ga0501081_0003920 | 3300049743 | Bacteria | 9537 |
| 667 | Ga0501081_0008091 | 3300049743 | Bacteria | 6824 |
| 668 | Ga0501083_0013818 | 3300049744 | Bacteria | 5645 |
| 669 | Ga0501083_0035659 | 3300049744 | Bacteria | 3396 |
| 670 | Ga0501083_0130604 | 3300049744 | Bacteria | 1646 |
| 671 | Ga0501035_0002184 | 3300049822 | Bacteria | 19411 |
| 672 | Ga0501035_0127560 | 3300049822 | Bacteria | 2220 |
| 673 | Ga0501035_0388899 | 3300049822 | Bacteria | 1162 |
| 674 | Ga0501044_0002158 | 3300049823 | Bacteria | 22557 |
| 675 | Ga0501044_1052033 | 3300049823 | Bacteria | 684 |
| 676 | Ga0501045_0001431 | 3300049824 | Bacteria | 15911 |
| 677 | nmdc:mga03683_76337_c1 | 3300050489 | Bacteria | 1440 |
| 678 | nmdc:mga03n38_31019_c1 | 3300050490 | Bacteria | 2252 |
| 679 | nmdc:mga00v17_8676_c1 | 3300050491 | Bacteria | 5476 |
| 680 | nmdc:mga0k408_13095_c1 | 3300050493 | Bacteria | 4543 |
| 681 | nmdc:mga0k408_3429_c1 | 3300050493 | Bacteria | 8394 |
| 682 | nmdc:mga06z11_428_c1 | 3300050494 | Bacteria | 15736 |
| 683 | nmdc:mga07m45_17916_c1 | 3300050496 | Bacteria | 3811 |
| 684 | nmdc:mga05p37_1194185_c1 | 3300050507 | Bacteria | 787 |
| 685 | nmdc:mga05p37_618393_c1 | 3300050507 | Bacteria | 1219 |
| 686 | nmdc:mga09592_27473_c1 | 3300050508 | Bacteria | 4722 |
| 687 | nmdc:mga09592_364404_c1 | 3300050508 | Bacteria | 1250 |
| 688 | nmdc:mga06r32_781890_c1 | 3300050510 | Bacteria | 916 |
| 689 | nmdc:mga08y16_26_c1 | 3300050511 | Bacteria | 223965 |
| 690 | nmdc:mga08y16_453066_c1 | 3300050511 | Bacteria | 1308 |
| 691 | nmdc:mga08y16_654_c1 | 3300050511 | Bacteria | 32535 |
| 692 | nmdc:mga08y16_903215_c1 | 3300050511 | Bacteria | 869 |
| 693 | nmdc:mga0n895_2177_c1 | 3300050512 | Bacteria | 15160 |
| 694 | nmdc:mga0n895_391108_c1 | 3300050512 | Bacteria | 1407 |
| 695 | nmdc:mga0n895_849977_c1 | 3300050512 | Bacteria | 900 |
| 696 | nmdc:mga0rr50_265684_c1 | 3300050513 | Bacteria | 1429 |
| 697 | nmdc:mga0rr50_8989_c1 | 3300050513 | Bacteria | 6250 |
| 698 | nmdc:mga08x19_62727_c1 | 3300050514 | Bacteria | 2410 |
| 699 | nmdc:mga0a205_100895_c1 | 3300050515 | Bacteria | 2785 |
| 700 | nmdc:mga0a205_437481_c1 | 3300050515 | Bacteria | 1169 |
| 701 | Ga0495619_0082753 | 3300053085 | Bacteria | 2164 |
| 702 | Ga0500642_0026960 | 3300053130 | Bacteria | 2352 |
| 703 | Ga0500604_0153887 | 3300053151 | Bacteria | 782 |
| 704 | Ga0501084_0000006 | 3300054114 | Bacteria | 234041 |
| 705 | Ga0501084_0014397 | 3300054114 | Bacteria | 6554 |
| 706 | Ga0501084_0039803 | 3300054114 | Bacteria | 3931 |
| 707 | Ga0590071_110180 | 3300059421 | Bacteria | 698 |
| 708 | Ga0501082_0001204 | 3300060353 | Bacteria | 22740 |
| 709 | Ga0501082_0002810 | 3300060353 | Bacteria | 15194 |
| 710 | Ga0501082_0437047 | 3300060353 | Bacteria | 1143 |
| 711 | Ga0466962_0044770 | 3300061719 | Bacteria | 2117 |
| 712 | Ga0530510_0087791 | 3300061734 | Bacteria | 2266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049742 | Ga0501080_0580899 | Ga0501080_0580899_449_985 | 168 |
| 2 | iso_pu_bacteria | 2909399089 | 2909400872 | 173 |
| 3 | 3300048919 | Ga0496116_0000005 | Ga0496116_0000005_162606_163136 | 176 |
| 4 | 3300048924 | Ga0496121_0000106 | Ga0496121_0000106_153316_153846 | 176 |
| 5 | 3300006178 | Ga0075367_10085476 | Ga0075367_100854763 | 177 |
| 6 | 3300050511 | nmdc:mga08y16_903215_c1 | nmdc:mga08y16_903215_c1_81_614 | 177 |
| 7 | 3300005438 | Ga0070701_10001229 | Ga0070701_100012297 | 178 |
| 8 | 3300009545 | Ga0105237_10111971 | Ga0105237_101119712 | 178 |
| 9 | 3300021384 | Ga0213876_10040137 | Ga0213876_100401373 | 178 |
| 10 | 3300025914 | Ga0207671_10040655 | Ga0207671_100406553 | 178 |
| 11 | 3300027552 | Ga0209982_1023843 | Ga0209982_10238431 | 178 |
| 12 | 3300039437 | Ga0436365_1705686 | Ga0436365_1705686_894_1430 | 178 |
| 13 | 3300045976 | Ga0466967_1198005 | Ga0466967_1198005_72_608 | 178 |
| 14 | 3300001990 | JGI24737J22298_10144013 | JGI24737J22298_101440131 | 179 |
| 15 | 3300002076 | JGI24749J21850_1002430 | JGI24749J21850_10024303 | 179 |
| 16 | 3300005290 | Ga0065712_10381837 | Ga0065712_103818371 | 179 |
| 17 | 3300005293 | Ga0065715_10226977 | Ga0065715_102269771 | 179 |
| 18 | 3300005295 | Ga0065707_10492885 | Ga0065707_104928851 | 179 |
| 19 | 3300005328 | Ga0070676_10002103 | Ga0070676_100021039 | 179 |
| 20 | 3300005330 | Ga0070690_100028478 | Ga0070690_1000284783 | 179 |
| 21 | 3300005331 | Ga0070670_100002019 | Ga0070670_10000201912 | 179 |
| 22 | 3300005333 | Ga0070677_10113431 | Ga0070677_101134312 | 179 |
| 23 | 3300005334 | Ga0068869_100004382 | Ga0068869_1000043829 | 179 |
| 24 | 3300005334 | Ga0068869_100108759 | Ga0068869_1001087593 | 179 |
| 25 | 3300005334 | Ga0068869_100292735 | Ga0068869_1002927351 | 179 |
| 26 | 3300005336 | Ga0070680_100000934 | Ga0070680_1000009343 | 179 |
| 27 | 3300005336 | Ga0070680_100274735 | Ga0070680_1002747352 | 179 |
| 28 | 3300005337 | Ga0070682_100001571 | Ga0070682_1000015719 | 179 |
| 29 | 3300005337 | Ga0070682_100154508 | Ga0070682_1001545082 | 179 |
| 30 | 3300005338 | Ga0068868_100010020 | Ga0068868_1000100206 | 179 |
| 31 | 3300005338 | Ga0068868_100784478 | Ga0068868_1007844781 | 179 |
| 32 | 3300005339 | Ga0070660_100001191 | Ga0070660_10000119113 | 179 |
| 33 | 3300005339 | Ga0070660_100007940 | Ga0070660_1000079402 | 179 |
| 34 | 3300005340 | Ga0070689_100039657 | Ga0070689_1000396573 | 179 |
| 35 | 3300005341 | Ga0070691_10037989 | Ga0070691_100379892 | 179 |
| 36 | 3300005341 | Ga0070691_10119544 | Ga0070691_101195441 | 179 |
| 37 | 3300005343 | Ga0070687_100000770 | Ga0070687_1000007703 | 179 |
| 38 | 3300005343 | Ga0070687_100001392 | Ga0070687_1000013922 | 179 |
| 39 | 3300005344 | Ga0070661_100000211 | Ga0070661_10000021127 | 179 |
| 40 | 3300005345 | Ga0070692_10007574 | Ga0070692_100075742 | 179 |
| 41 | 3300005345 | Ga0070692_10112657 | Ga0070692_101126572 | 179 |
| 42 | 3300005347 | Ga0070668_100202560 | Ga0070668_1002025602 | 179 |
| 43 | 3300005353 | Ga0070669_100041543 | Ga0070669_1000415433 | 179 |
| 44 | 3300005353 | Ga0070669_100647768 | Ga0070669_1006477682 | 179 |
| 45 | 3300005354 | Ga0070675_100278641 | Ga0070675_1002786411 | 179 |
| 46 | 3300005355 | Ga0070671_100194044 | Ga0070671_1001940443 | 179 |
| 47 | 3300005356 | Ga0070674_100101462 | Ga0070674_1001014622 | 179 |
| 48 | 3300005364 | Ga0070673_100200515 | Ga0070673_1002005152 | 179 |
| 49 | 3300005365 | Ga0070688_100246443 | Ga0070688_1002464432 | 179 |
| 50 | 3300005366 | Ga0070659_100003620 | Ga0070659_10000362011 | 179 |
| 51 | 3300005366 | Ga0070659_100148596 | Ga0070659_1001485962 | 179 |
| 52 | 3300005367 | Ga0070667_100046041 | Ga0070667_1000460413 | 179 |
| 53 | 3300005406 | Ga0070703_10004864 | Ga0070703_100048644 | 179 |
| 54 | 3300005438 | Ga0070701_10306127 | Ga0070701_103061271 | 179 |
| 55 | 3300005440 | Ga0070705_100001410 | Ga0070705_10000141013 | 179 |
| 56 | 3300005440 | Ga0070705_100699836 | Ga0070705_1006998362 | 179 |
| 57 | 3300005441 | Ga0070700_100099047 | Ga0070700_1000990471 | 179 |
| 58 | 3300005444 | Ga0070694_100001526 | Ga0070694_10000152613 | 179 |
| 59 | 3300005444 | Ga0070694_100013510 | Ga0070694_1000135104 | 179 |
| 60 | 3300005444 | Ga0070694_100649895 | Ga0070694_1006498952 | 179 |
| 61 | 3300005455 | Ga0070663_100002478 | Ga0070663_1000024783 | 179 |
| 62 | 3300005455 | Ga0070663_100006656 | Ga0070663_1000066563 | 179 |
| 63 | 3300005457 | Ga0070662_100002397 | Ga0070662_1000023973 | 179 |
| 64 | 3300005457 | Ga0070662_100433428 | Ga0070662_1004334282 | 179 |
| 65 | 3300005458 | Ga0070681_10038653 | Ga0070681_100386534 | 179 |
| 66 | 3300005458 | Ga0070681_10045796 | Ga0070681_100457963 | 179 |
| 67 | 3300005459 | Ga0068867_100003605 | Ga0068867_1000036053 | 179 |
| 68 | 3300005459 | Ga0068867_100304281 | Ga0068867_1003042812 | 179 |
| 69 | 3300005466 | Ga0070685_10071828 | Ga0070685_100718283 | 179 |
| 70 | 3300005530 | Ga0070679_100004586 | Ga0070679_1000045869 | 179 |
| 71 | 3300005539 | Ga0068853_100000678 | Ga0068853_1000006783 | 179 |
| 72 | 3300005539 | Ga0068853_100015285 | Ga0068853_1000152857 | 179 |
| 73 | 3300005543 | Ga0070672_100094015 | Ga0070672_1000940153 | 179 |
| 74 | 3300005544 | Ga0070686_100079797 | Ga0070686_1000797973 | 179 |
| 75 | 3300005545 | Ga0070695_100002767 | Ga0070695_1000027675 | 179 |
| 76 | 3300005545 | Ga0070695_100006632 | Ga0070695_1000066327 | 179 |
| 77 | 3300005545 | Ga0070695_100571999 | Ga0070695_1005719992 | 179 |
| 78 | 3300005545 | Ga0070695_100938605 | Ga0070695_1009386051 | 179 |
| 79 | 3300005546 | Ga0070696_100000966 | Ga0070696_1000009668 | 179 |
| 80 | 3300005546 | Ga0070696_100077905 | Ga0070696_1000779052 | 179 |
| 81 | 3300005546 | Ga0070696_100098102 | Ga0070696_1000981023 | 179 |
| 82 | 3300005546 | Ga0070696_100177819 | Ga0070696_1001778191 | 179 |
| 83 | 3300005546 | Ga0070696_100480334 | Ga0070696_1004803341 | 179 |
| 84 | 3300005547 | Ga0070693_100000189 | Ga0070693_1000001892 | 179 |
| 85 | 3300005547 | Ga0070693_100233190 | Ga0070693_1002331902 | 179 |
| 86 | 3300005548 | Ga0070665_100003284 | Ga0070665_10000328415 | 179 |
| 87 | 3300005548 | Ga0070665_101232498 | Ga0070665_1012324982 | 179 |
| 88 | 3300005549 | Ga0070704_100009072 | Ga0070704_1000090721 | 179 |
| 89 | 3300005549 | Ga0070704_100410663 | Ga0070704_1004106632 | 179 |
| 90 | 3300005563 | Ga0068855_100002802 | Ga0068855_10000280218 | 179 |
| 91 | 3300005563 | Ga0068855_100028396 | Ga0068855_1000283966 | 179 |
| 92 | 3300005563 | Ga0068855_100035134 | Ga0068855_10003513410 | 179 |
| 93 | 3300005564 | Ga0070664_100166635 | Ga0070664_1001666353 | 179 |
| 94 | 3300005577 | Ga0068857_100040946 | Ga0068857_1000409464 | 179 |
| 95 | 3300005577 | Ga0068857_100091502 | Ga0068857_1000915023 | 179 |
| 96 | 3300005578 | Ga0068854_100001086 | Ga0068854_10000108612 | 179 |
| 97 | 3300005578 | Ga0068854_101142575 | Ga0068854_1011425751 | 179 |
| 98 | 3300005614 | Ga0068856_100002994 | Ga0068856_10000299414 | 179 |
| 99 | 3300005614 | Ga0068856_100157604 | Ga0068856_1001576042 | 179 |
| 100 | 3300005615 | Ga0070702_100021060 | Ga0070702_1000210603 | 179 |
| 101 | 3300005615 | Ga0070702_100075675 | Ga0070702_1000756752 | 179 |
| 102 | 3300005617 | Ga0068859_100002675 | Ga0068859_10000267511 | 179 |
| 103 | 3300005617 | Ga0068859_100384713 | Ga0068859_1003847132 | 179 |
| 104 | 3300005718 | Ga0068866_10191990 | Ga0068866_101919901 | 179 |
| 105 | 3300005719 | Ga0068861_100000584 | Ga0068861_10000058410 | 179 |
| 106 | 3300005719 | Ga0068861_100105148 | Ga0068861_1001051484 | 179 |
| 107 | 3300005840 | Ga0068870_10000367 | Ga0068870_1000036712 | 179 |
| 108 | 3300005840 | Ga0068870_10315981 | Ga0068870_103159812 | 179 |
| 109 | 3300005841 | Ga0068863_100066613 | Ga0068863_1000666133 | 179 |
| 110 | 3300005841 | Ga0068863_100245054 | Ga0068863_1002450542 | 179 |
| 111 | 3300005842 | Ga0068858_100016416 | Ga0068858_1000164169 | 179 |
| 112 | 3300005842 | Ga0068858_100162578 | Ga0068858_1001625782 | 179 |
| 113 | 3300005843 | Ga0068860_100019733 | Ga0068860_1000197333 | 179 |
| 114 | 3300005843 | Ga0068860_100154301 | Ga0068860_1001543013 | 179 |
| 115 | 3300005844 | Ga0068862_100000487 | Ga0068862_10000048730 | 179 |
| 116 | 3300005844 | Ga0068862_100157301 | Ga0068862_1001573013 | 179 |
| 117 | 3300005937 | Ga0081455_10000868 | Ga0081455_1000086831 | 179 |
| 118 | 3300005983 | Ga0081540_1112142 | Ga0081540_11121421 | 179 |
| 119 | 3300006028 | Ga0070717_10042387 | Ga0070717_100423874 | 179 |
| 120 | 3300006038 | Ga0075365_10153119 | Ga0075365_101531192 | 179 |
| 121 | 3300006048 | Ga0075363_100028486 | Ga0075363_1000284863 | 179 |
| 122 | 3300006051 | Ga0075364_10006228 | Ga0075364_100062284 | 179 |
| 123 | 3300006177 | Ga0075362_10002673 | Ga0075362_100026734 | 179 |
| 124 | 3300006178 | Ga0075367_10002794 | Ga0075367_100027943 | 179 |
| 125 | 3300006195 | Ga0075366_10000211 | Ga0075366_1000021116 | 179 |
| 126 | 3300006237 | Ga0097621_100009977 | Ga0097621_1000099774 | 179 |
| 127 | 3300006237 | Ga0097621_100234458 | Ga0097621_1002344582 | 179 |
| 128 | 3300006353 | Ga0075370_10029135 | Ga0075370_100291352 | 179 |
| 129 | 3300006358 | Ga0068871_100282167 | Ga0068871_1002821672 | 179 |
| 130 | 3300006844 | Ga0075428_100032307 | Ga0075428_1000323075 | 179 |
| 131 | 3300006844 | Ga0075428_100783684 | Ga0075428_1007836842 | 179 |
| 132 | 3300006846 | Ga0075430_100293071 | Ga0075430_1002930712 | 179 |
| 133 | 3300006846 | Ga0075430_100500526 | Ga0075430_1005005261 | 179 |
| 134 | 3300006847 | Ga0075431_100357244 | Ga0075431_1003572442 | 179 |
| 135 | 3300006847 | Ga0075431_100445016 | Ga0075431_1004450162 | 179 |
| 136 | 3300006852 | Ga0075433_10015416 | Ga0075433_100154162 | 179 |
| 137 | 3300006852 | Ga0075433_10122889 | Ga0075433_101228892 | 179 |
| 138 | 3300006852 | Ga0075433_10422915 | Ga0075433_104229152 | 179 |
| 139 | 3300006871 | Ga0075434_100002965 | Ga0075434_10000296513 | 179 |
| 140 | 3300006871 | Ga0075434_100073905 | Ga0075434_1000739053 | 179 |
| 141 | 3300006880 | Ga0075429_100044582 | Ga0075429_1000445823 | 179 |
| 142 | 3300006880 | Ga0075429_100888466 | Ga0075429_1008884662 | 179 |
| 143 | 3300006881 | Ga0068865_100244513 | Ga0068865_1002445132 | 179 |
| 144 | 3300006881 | Ga0068865_100427726 | Ga0068865_1004277262 | 179 |
| 145 | 3300006881 | Ga0068865_100701553 | Ga0068865_1007015531 | 179 |
| 146 | 3300006914 | Ga0075436_100115288 | Ga0075436_1001152882 | 179 |
| 147 | 3300006931 | Ga0097620_100002675 | Ga0097620_10000267512 | 179 |
| 148 | 3300006931 | Ga0097620_100384673 | Ga0097620_1003846732 | 179 |
| 149 | 3300007076 | Ga0075435_100187113 | Ga0075435_1001871132 | 179 |
| 150 | 3300007076 | Ga0075435_100298766 | Ga0075435_1002987662 | 179 |
| 151 | 3300009094 | Ga0111539_10000051 | Ga0111539_1000005139 | 179 |
| 152 | 3300009094 | Ga0111539_10000113 | Ga0111539_1000011346 | 179 |
| 153 | 3300009094 | Ga0111539_10195787 | Ga0111539_101957872 | 179 |
| 154 | 3300009098 | Ga0105245_10299172 | Ga0105245_102991722 | 179 |
| 155 | 3300009147 | Ga0114129_10438734 | Ga0114129_104387342 | 179 |
| 156 | 3300009147 | Ga0114129_10705785 | Ga0114129_107057851 | 179 |
| 157 | 3300009147 | Ga0114129_11218689 | Ga0114129_112186891 | 179 |
| 158 | 3300009148 | Ga0105243_10141481 | Ga0105243_101414812 | 179 |
| 159 | 3300009148 | Ga0105243_10432288 | Ga0105243_104322881 | 179 |
| 160 | 3300009148 | Ga0105243_11295237 | Ga0105243_112952371 | 179 |
| 161 | 3300009174 | Ga0105241_10003142 | Ga0105241_1000314214 | 179 |
| 162 | 3300009174 | Ga0105241_10440638 | Ga0105241_104406382 | 179 |
| 163 | 3300009176 | Ga0105242_10278126 | Ga0105242_102781263 | 179 |
| 164 | 3300009177 | Ga0105248_10745226 | Ga0105248_107452262 | 179 |
| 165 | 3300009545 | Ga0105237_10109298 | Ga0105237_101092984 | 179 |
| 166 | 3300009545 | Ga0105237_11374424 | Ga0105237_113744241 | 179 |
| 167 | 3300009551 | Ga0105238_10009255 | Ga0105238_100092553 | 179 |
| 168 | 3300009553 | Ga0105249_10101339 | Ga0105249_101013392 | 179 |
| 169 | 3300009553 | Ga0105249_10375203 | Ga0105249_103752032 | 179 |
| 170 | 3300010375 | Ga0105239_10181133 | Ga0105239_101811332 | 179 |
| 171 | 3300010375 | Ga0105239_11166417 | Ga0105239_111664172 | 179 |
| 172 | 3300011119 | Ga0105246_10080455 | Ga0105246_100804553 | 179 |
| 173 | 3300013100 | Ga0157373_10003191 | Ga0157373_1000319112 | 179 |
| 174 | 3300013102 | Ga0157371_10186076 | Ga0157371_101860762 | 179 |
| 175 | 3300013104 | Ga0157370_10074553 | Ga0157370_100745533 | 179 |
| 176 | 3300013105 | Ga0157369_10027421 | Ga0157369_100274213 | 179 |
| 177 | 3300013105 | Ga0157369_10517017 | Ga0157369_105170172 | 179 |
| 178 | 3300013296 | Ga0157374_10084262 | Ga0157374_100842623 | 179 |
| 179 | 3300013297 | Ga0157378_10496427 | Ga0157378_104964272 | 179 |
| 180 | 3300013306 | Ga0163162_10279079 | Ga0163162_102790792 | 179 |
| 181 | 3300013307 | Ga0157372_10006794 | Ga0157372_100067948 | 179 |
| 182 | 3300013307 | Ga0157372_10054504 | Ga0157372_100545041 | 179 |
| 183 | 3300013307 | Ga0157372_10199964 | Ga0157372_101999643 | 179 |
| 184 | 3300013308 | Ga0157375_10021538 | Ga0157375_100215384 | 179 |
| 185 | 3300014325 | Ga0163163_10181453 | Ga0163163_101814532 | 179 |
| 186 | 3300014968 | Ga0157379_10141398 | Ga0157379_101413983 | 179 |
| 187 | 3300014968 | Ga0157379_11436765 | Ga0157379_114367651 | 179 |
| 188 | 3300014968 | Ga0157379_11520938 | Ga0157379_115209381 | 179 |
| 189 | 3300015262 | Ga0182007_10155536 | Ga0182007_101555362 | 179 |
| 190 | 3300017792 | Ga0163161_10108321 | Ga0163161_101083213 | 179 |
| 191 | 3300020082 | Ga0206353_11798732 | Ga0206353_117987321 | 179 |
| 192 | 3300022467 | Ga0224712_10201100 | Ga0224712_102011002 | 179 |
| 193 | 3300025885 | Ga0207653_10003686 | Ga0207653_100036863 | 179 |
| 194 | 3300025901 | Ga0207688_10022445 | Ga0207688_100224454 | 179 |
| 195 | 3300025904 | Ga0207647_10345783 | Ga0207647_103457831 | 179 |
| 196 | 3300025907 | Ga0207645_10000400 | Ga0207645_1000040038 | 179 |
| 197 | 3300025907 | Ga0207645_10349998 | Ga0207645_103499982 | 179 |
| 198 | 3300025908 | Ga0207643_10003419 | Ga0207643_100034192 | 179 |
| 199 | 3300025909 | Ga0207705_10000646 | Ga0207705_1000064619 | 179 |
| 200 | 3300025911 | Ga0207654_10031346 | Ga0207654_100313462 | 179 |
| 201 | 3300025912 | Ga0207707_10000116 | Ga0207707_1000011654 | 179 |
| 202 | 3300025912 | Ga0207707_10038158 | Ga0207707_100381583 | 179 |
| 203 | 3300025912 | Ga0207707_10099945 | Ga0207707_100999451 | 179 |
| 204 | 3300025914 | Ga0207671_10064091 | Ga0207671_100640914 | 179 |
| 205 | 3300025914 | Ga0207671_10152366 | Ga0207671_101523661 | 179 |
| 206 | 3300025917 | Ga0207660_10074723 | Ga0207660_100747233 | 179 |
| 207 | 3300025918 | Ga0207662_10004846 | Ga0207662_100048467 | 179 |
| 208 | 3300025918 | Ga0207662_10035306 | Ga0207662_100353062 | 179 |
| 209 | 3300025919 | Ga0207657_10000211 | Ga0207657_100002119 | 179 |
| 210 | 3300025919 | Ga0207657_10003066 | Ga0207657_1000306617 | 179 |
| 211 | 3300025920 | Ga0207649_10024354 | Ga0207649_100243542 | 179 |
| 212 | 3300025920 | Ga0207649_10168371 | Ga0207649_101683712 | 179 |
| 213 | 3300025921 | Ga0207652_10001356 | Ga0207652_100013569 | 179 |
| 214 | 3300025921 | Ga0207652_10004556 | Ga0207652_1000455616 | 179 |
| 215 | 3300025923 | Ga0207681_10072461 | Ga0207681_100724613 | 179 |
| 216 | 3300025923 | Ga0207681_10232201 | Ga0207681_102322012 | 179 |
| 217 | 3300025924 | Ga0207694_10048935 | Ga0207694_100489355 | 179 |
| 218 | 3300025925 | Ga0207650_10002578 | Ga0207650_100025782 | 179 |
| 219 | 3300025926 | Ga0207659_10025263 | Ga0207659_100252636 | 179 |
| 220 | 3300025926 | Ga0207659_10171166 | Ga0207659_101711661 | 179 |
| 221 | 3300025927 | Ga0207687_10239245 | Ga0207687_102392452 | 179 |
| 222 | 3300025931 | Ga0207644_10228371 | Ga0207644_102283713 | 179 |
| 223 | 3300025932 | Ga0207690_10031318 | Ga0207690_100313183 | 179 |
| 224 | 3300025933 | Ga0207706_10002411 | Ga0207706_100024113 | 179 |
| 225 | 3300025933 | Ga0207706_10311822 | Ga0207706_103118221 | 179 |
| 226 | 3300025935 | Ga0207709_10084060 | Ga0207709_100840603 | 179 |
| 227 | 3300025936 | Ga0207670_10030383 | Ga0207670_100303833 | 179 |
| 228 | 3300025937 | Ga0207669_10052790 | Ga0207669_100527903 | 179 |
| 229 | 3300025938 | Ga0207704_10026106 | Ga0207704_100261063 | 179 |
| 230 | 3300025938 | Ga0207704_10527197 | Ga0207704_105271972 | 179 |
| 231 | 3300025938 | Ga0207704_10630333 | Ga0207704_106303332 | 179 |
| 232 | 3300025940 | Ga0207691_10001566 | Ga0207691_100015664 | 179 |
| 233 | 3300025940 | Ga0207691_10026597 | Ga0207691_100265975 | 179 |
| 234 | 3300025941 | Ga0207711_11086753 | Ga0207711_110867531 | 179 |
| 235 | 3300025942 | Ga0207689_10007902 | Ga0207689_100079022 | 179 |
| 236 | 3300025942 | Ga0207689_10011859 | Ga0207689_100118593 | 179 |
| 237 | 3300025942 | Ga0207689_10434195 | Ga0207689_104341951 | 179 |
| 238 | 3300025945 | Ga0207679_10000634 | Ga0207679_100006343 | 179 |
| 239 | 3300025949 | Ga0207667_10000342 | Ga0207667_1000034227 | 179 |
| 240 | 3300025949 | Ga0207667_10050604 | Ga0207667_100506043 | 179 |
| 241 | 3300025949 | Ga0207667_10742763 | Ga0207667_107427633 | 179 |
| 242 | 3300025960 | Ga0207651_10156436 | Ga0207651_101564362 | 179 |
| 243 | 3300025972 | Ga0207668_10204056 | Ga0207668_102040562 | 179 |
| 244 | 3300025981 | Ga0207640_10398551 | Ga0207640_103985513 | 179 |
| 245 | 3300025986 | Ga0207658_10113017 | Ga0207658_101130172 | 179 |
| 246 | 3300025986 | Ga0207658_10462246 | Ga0207658_104622462 | 179 |
| 247 | 3300026023 | Ga0207677_10004667 | Ga0207677_100046674 | 179 |
| 248 | 3300026023 | Ga0207677_10106567 | Ga0207677_101065672 | 179 |
| 249 | 3300026035 | Ga0207703_10072222 | Ga0207703_100722223 | 179 |
| 250 | 3300026035 | Ga0207703_10212740 | Ga0207703_102127402 | 179 |
| 251 | 3300026041 | Ga0207639_10001737 | Ga0207639_1000173715 | 179 |
| 252 | 3300026041 | Ga0207639_10006214 | Ga0207639_100062149 | 179 |
| 253 | 3300026067 | Ga0207678_10000501 | Ga0207678_1000050136 | 179 |
| 254 | 3300026067 | Ga0207678_10032873 | Ga0207678_100328733 | 179 |
| 255 | 3300026067 | Ga0207678_10105169 | Ga0207678_101051691 | 179 |
| 256 | 3300026075 | Ga0207708_10063338 | Ga0207708_100633383 | 179 |
| 257 | 3300026075 | Ga0207708_10913509 | Ga0207708_109135091 | 179 |
| 258 | 3300026078 | Ga0207702_10002217 | Ga0207702_100022172 | 179 |
| 259 | 3300026089 | Ga0207648_10005284 | Ga0207648_1000528413 | 179 |
| 260 | 3300026089 | Ga0207648_10060925 | Ga0207648_100609255 | 179 |
| 261 | 3300026089 | Ga0207648_10091775 | Ga0207648_100917753 | 179 |
| 262 | 3300026095 | Ga0207676_10191058 | Ga0207676_101910583 | 179 |
| 263 | 3300026095 | Ga0207676_10217709 | Ga0207676_102177092 | 179 |
| 264 | 3300026116 | Ga0207674_10000951 | Ga0207674_1000095136 | 179 |
| 265 | 3300026116 | Ga0207674_10036269 | Ga0207674_100362693 | 179 |
| 266 | 3300026116 | Ga0207674_11070908 | Ga0207674_110709081 | 179 |
| 267 | 3300026118 | Ga0207675_100033947 | Ga0207675_1000339473 | 179 |
| 268 | 3300026118 | Ga0207675_100034035 | Ga0207675_1000340353 | 179 |
| 269 | 3300026121 | Ga0207683_10463896 | Ga0207683_104638962 | 179 |
| 270 | 3300027360 | Ga0209969_1008442 | Ga0209969_10084422 | 179 |
| 271 | 3300027364 | Ga0209967_1006204 | Ga0209967_10062042 | 179 |
| 272 | 3300027395 | Ga0209996_1013416 | Ga0209996_10134162 | 179 |
| 273 | 3300027471 | Ga0209995_1006777 | Ga0209995_10067772 | 179 |
| 274 | 3300027526 | Ga0209968_1007758 | Ga0209968_10077582 | 179 |
| 275 | 3300027543 | Ga0209999_1000911 | Ga0209999_10009112 | 179 |
| 276 | 3300027614 | Ga0209970_1000541 | Ga0209970_10005413 | 179 |
| 277 | 3300027617 | Ga0210002_1016194 | Ga0210002_10161942 | 179 |
| 278 | 3300027665 | Ga0209983_1000982 | Ga0209983_10009822 | 179 |
| 279 | 3300027682 | Ga0209971_1000037 | Ga0209971_100003713 | 179 |
| 280 | 3300027682 | Ga0209971_1102700 | Ga0209971_11027001 | 179 |
| 281 | 3300027695 | Ga0209966_1000467 | Ga0209966_10004678 | 179 |
| 282 | 3300027717 | Ga0209998_10000042 | Ga0209998_1000004243 | 179 |
| 283 | 3300027876 | Ga0209974_10062797 | Ga0209974_100627972 | 179 |
| 284 | 3300027907 | Ga0207428_10000016 | Ga0207428_1000001614 | 179 |
| 285 | 3300027907 | Ga0207428_10001085 | Ga0207428_1000108516 | 179 |
| 286 | 3300028379 | Ga0268266_10003855 | Ga0268266_1000385511 | 179 |
| 287 | 3300028379 | Ga0268266_10214331 | Ga0268266_102143311 | 179 |
| 288 | 3300028379 | Ga0268266_10544594 | Ga0268266_105445942 | 179 |
| 289 | 3300028380 | Ga0268265_10001893 | Ga0268265_1000189317 | 179 |
| 290 | 3300028380 | Ga0268265_10115491 | Ga0268265_101154913 | 179 |
| 291 | 3300028380 | Ga0268265_10162433 | Ga0268265_101624332 | 179 |
| 292 | 3300028381 | Ga0268264_10128763 | Ga0268264_101287633 | 179 |
| 293 | 3300028381 | Ga0268264_10256056 | Ga0268264_102560561 | 179 |
| 294 | 3300028558 | Ga0265326_10075248 | Ga0265326_100752481 | 179 |
| 295 | 3300028563 | Ga0265319_1067369 | Ga0265319_10673692 | 179 |
| 296 | 3300028573 | Ga0265334_10032772 | Ga0265334_100327722 | 179 |
| 297 | 3300028577 | Ga0265318_10000215 | Ga0265318_1000021540 | 179 |
| 298 | 3300028800 | Ga0265338_10120405 | Ga0265338_101204052 | 179 |
| 299 | 3300030760 | Ga0265762_1088910 | Ga0265762_10889101 | 179 |
| 300 | 3300031235 | Ga0265330_10005185 | Ga0265330_100051856 | 179 |
| 301 | 3300031238 | Ga0265332_10002290 | Ga0265332_100022908 | 179 |
| 302 | 3300031239 | Ga0265328_10005771 | Ga0265328_100057714 | 179 |
| 303 | 3300031242 | Ga0265329_10001026 | Ga0265329_100010264 | 179 |
| 304 | 3300031247 | Ga0265340_10076478 | Ga0265340_100764782 | 179 |
| 305 | 3300031249 | Ga0265339_10047348 | Ga0265339_100473482 | 179 |
| 306 | 3300031250 | Ga0265331_10001505 | Ga0265331_100015058 | 179 |
| 307 | 3300031344 | Ga0265316_10004776 | Ga0265316_100047769 | 179 |
| 308 | 3300031456 | Ga0307513_10493865 | Ga0307513_104938652 | 179 |
| 309 | 3300031711 | Ga0265314_10001991 | Ga0265314_100019919 | 179 |
| 310 | 3300031712 | Ga0265342_10001504 | Ga0265342_1000150420 | 179 |
| 311 | 3300034817 | Ga0373948_0027813 | Ga0373948_0027813_418_957 | 179 |
| 312 | 3300034818 | Ga0373950_0000025 | Ga0373950_0000025_64531_65070 | 179 |
| 313 | 3300035111 | Ga0373923_0057529 | Ga0373923_0057529_1019_1573 | 179 |
| 314 | 3300035112 | Ga0373932_0141900 | Ga0373932_0141900_142_681 | 179 |
| 315 | 3300035113 | Ga0373936_0054520 | Ga0373936_0054520_940_1494 | 179 |
| 316 | 3300035115 | Ga0373941_0036806 | Ga0373941_0036806_60_599 | 179 |
| 317 | 3300035117 | Ga0373953_0124136 | Ga0373953_0124136_205_759 | 179 |
| 318 | 3300035119 | Ga0373956_0458986 | Ga0373956_0458986_13_552 | 179 |
| 319 | 3300035120 | Ga0373957_0276681 | Ga0373957_0276681_132_686 | 179 |
| 320 | 3300035121 | Ga0373960_0023435 | Ga0373960_0023435_832_1371 | 179 |
| 321 | 3300035172 | Ga0373955_0097096 | Ga0373955_0097096_651_1205 | 179 |
| 322 | 3300035241 | Ga0373961_0027993 | Ga0373961_0027993_595_1134 | 179 |
| 323 | 3300035242 | Ga0373962_0077980 | Ga0373962_0077980_44_583 | 179 |
| 324 | 3300035410 | Ga0373924_0185633 | Ga0373924_0185633_259_813 | 179 |
| 325 | 3300035691 | Ga0373931_0011793 | Ga0373931_0011793_128_667 | 179 |
| 326 | 3300035692 | Ga0373935_0072863 | Ga0373935_0072863_640_1194 | 179 |
| 327 | 3300035695 | Ga0373927_0338032 | Ga0373927_0338032_207_761 | 179 |
| 328 | 3300035724 | Ga0373933_0014104 | Ga0373933_0014104_2179_2733 | 179 |
| 329 | 3300035725 | Ga0373947_0852353 | Ga0373947_0852353_58_597 | 179 |
| 330 | 3300036401 | Ga0373937_0015816 | Ga0373937_0015816_1170_1724 | 179 |
| 331 | 3300037068 | Ga0373925_0049098 | Ga0373925_0049098_747_1301 | 179 |
| 332 | 3300037312 | Ga0395899_0012252 | Ga0395899_0012252_5401_5949 | 179 |
| 333 | 3300037418 | Ga0395900_0201832 | Ga0395900_0201832_541_1089 | 179 |
| 334 | 3300037418 | Ga0395900_0272983 | Ga0395900_0272983_562_1110 | 179 |
| 335 | 3300037466 | Ga0395898_0201793 | Ga0395898_0201793_756_1304 | 179 |
| 336 | 3300037466 | Ga0395898_0455085 | Ga0395898_0455085_302_841 | 179 |
| 337 | 3300038443 | Ga0395901_0634719 | Ga0395901_0634719_64_603 | 179 |
| 338 | 3300038443 | Ga0395901_0710824 | Ga0395901_0710824_41_589 | 179 |
| 339 | 3300039447 | Ga0436361_0841563 | Ga0436361_0841563_2359_2913 | 179 |
| 340 | 3300042005 | Ga0439448_0001809 | Ga0439448_0001809_2795_3334 | 179 |
| 341 | 3300042008 | Ga0439450_004186 | Ga0439450_004186_719_1258 | 179 |
| 342 | 3300042144 | Ga0450889_004365 | Ga0450889_004365_174_713 | 179 |
| 343 | 3300042157 | Ga0439458_0034276 | Ga0439458_0034276_550_1089 | 179 |
| 344 | 3300042438 | Ga0439459_0006217 | Ga0439459_0006217_729_1268 | 179 |
| 345 | 3300042439 | Ga0439464_0019320 | Ga0439464_0019320_189_728 | 179 |
| 346 | 3300042876 | Ga0451577_0019330 | Ga0451577_0019330_5332_5871 | 179 |
| 347 | 3300042993 | Ga0439440_0045336 | Ga0439440_0045336_219_758 | 179 |
| 348 | 3300044673 | Ga0453683_0620878 | Ga0453683_0620878_110_649 | 179 |
| 349 | 3300044712 | Ga0453684_0103159 | Ga0453684_0103159_418_957 | 179 |
| 350 | 3300045049 | Ga0466959_0093724 | Ga0466959_0093724_821_1360 | 179 |
| 351 | 3300045051 | Ga0451576_0017994 | Ga0451576_0017994_5456_5995 | 179 |
| 352 | 3300045051 | Ga0451576_0031917 | Ga0451576_0031917_4929_5468 | 179 |
| 353 | 3300045051 | Ga0451576_0051976 | Ga0451576_0051976_1823_2362 | 179 |
| 354 | 3300045051 | Ga0451576_0333654 | Ga0451576_0333654_873_1412 | 179 |
| 355 | 3300045051 | Ga0451576_0743057 | Ga0451576_0743057_272_811 | 179 |
| 356 | 3300046462 | Ga0495651_0014442 | Ga0495651_0014442_3722_4276 | 179 |
| 357 | 3300046463 | Ga0495653_0197680 | Ga0495653_0197680_253_792 | 179 |
| 358 | 3300046472 | Ga0495580_0369048 | Ga0495580_0369048_11_550 | 179 |
| 359 | 3300046477 | Ga0495664_0555593 | Ga0495664_0555593_37_576 | 179 |
| 360 | 3300046514 | Ga0495618_0158805 | Ga0495618_0158805_472_1026 | 179 |
| 361 | 3300046516 | Ga0495628_0002592 | Ga0495628_0002592_5847_6386 | 179 |
| 362 | 3300046533 | Ga0495640_0135895 | Ga0495640_0135895_939_1493 | 179 |
| 363 | 3300046535 | Ga0495586_0288129 | Ga0495586_0288129_168_722 | 179 |
| 364 | 3300046559 | Ga0495667_0345874 | Ga0495667_0345874_210_749 | 179 |
| 365 | 3300046663 | Ga0495635_0489579 | Ga0495635_0489579_47_601 | 179 |
| 366 | 3300046675 | Ga0495657_0088061 | Ga0495657_0088061_772_1326 | 179 |
| 367 | 3300046678 | Ga0495599_0088818 | Ga0495599_0088818_261_815 | 179 |
| 368 | 3300046794 | Ga0495589_0348009 | Ga0495589_0348009_67_606 | 179 |
| 369 | 3300047322 | Ga0495680_0082293 | Ga0495680_0082293_1170_1724 | 179 |
| 370 | 3300047322 | Ga0495680_0210794 | Ga0495680_0210794_247_786 | 179 |
| 371 | 3300047444 | Ga0495675_0287673 | Ga0495675_0287673_402_956 | 179 |
| 372 | 3300047445 | Ga0495677_0068479 | Ga0495677_0068479_503_1042 | 179 |
| 373 | 3300047471 | Ga0495684_0050189 | Ga0495684_0050189_573_1112 | 179 |
| 374 | 3300047471 | Ga0495684_0117350 | Ga0495684_0117350_503_1057 | 179 |
| 375 | 3300048905 | Ga0496102_1159349 | Ga0496102_1159349_43_582 | 179 |
| 376 | 3300048906 | Ga0496103_0218091 | Ga0496103_0218091_597_1139 | 179 |
| 377 | 3300048906 | Ga0496103_0223942 | Ga0496103_0223942_572_1111 | 179 |
| 378 | 3300048909 | Ga0496106_0304633 | Ga0496106_0304633_513_1052 | 179 |
| 379 | 3300048911 | Ga0496108_0383283 | Ga0496108_0383283_67_606 | 179 |
| 380 | 3300048915 | Ga0496112_0117159 | Ga0496112_0117159_1369_1908 | 179 |
| 381 | 3300048917 | Ga0496114_0020911 | Ga0496114_0020911_1193_1732 | 179 |
| 382 | 3300048920 | Ga0496117_0034031 | Ga0496117_0034031_823_1365 | 179 |
| 383 | 3300048921 | Ga0496118_0000435 | Ga0496118_0000435_37387_37929 | 179 |
| 384 | 3300048921 | Ga0496118_0006905 | Ga0496118_0006905_7471_8013 | 179 |
| 385 | 3300049568 | Ga0501031_0613871 | Ga0501031_0613871_143_682 | 179 |
| 386 | 3300049570 | Ga0501033_0061650 | Ga0501033_0061650_502_1041 | 179 |
| 387 | 3300049570 | Ga0501033_0231920 | Ga0501033_0231920_609_1148 | 179 |
| 388 | 3300049570 | Ga0501033_0341668 | Ga0501033_0341668_154_693 | 179 |
| 389 | 3300049571 | Ga0501034_0000120 | Ga0501034_0000120_117132_117671 | 179 |
| 390 | 3300049572 | Ga0501036_0004223 | Ga0501036_0004223_4743_5282 | 179 |
| 391 | 3300049573 | Ga0501037_0401731 | Ga0501037_0401731_170_709 | 179 |
| 392 | 3300049574 | Ga0501038_0228386 | Ga0501038_0228386_376_915 | 179 |
| 393 | 3300049575 | Ga0501039_0087002 | Ga0501039_0087002_596_1135 | 179 |
| 394 | 3300049576 | Ga0501040_0026145 | Ga0501040_0026145_3304_3843 | 179 |
| 395 | 3300049576 | Ga0501040_0035104 | Ga0501040_0035104_47_586 | 179 |
| 396 | 3300049577 | Ga0501041_0069737 | Ga0501041_0069737_1606_2145 | 179 |
| 397 | 3300049577 | Ga0501041_0202205 | Ga0501041_0202205_91_630 | 179 |
| 398 | 3300049578 | Ga0501042_0014830 | Ga0501042_0014830_3212_3751 | 179 |
| 399 | 3300049579 | Ga0501043_0002110 | Ga0501043_0002110_6670_7209 | 179 |
| 400 | 3300049580 | Ga0501046_0000111 | Ga0501046_0000111_6911_7450 | 179 |
| 401 | 3300049580 | Ga0501046_0001310 | Ga0501046_0001310_20377_20916 | 179 |
| 402 | 3300049580 | Ga0501046_0299416 | Ga0501046_0299416_538_1077 | 179 |
| 403 | 3300049581 | Ga0501047_0000009 | Ga0501047_0000009_220889_221428 | 179 |
| 404 | 3300049581 | Ga0501047_0033249 | Ga0501047_0033249_4233_4772 | 179 |
| 405 | 3300049582 | Ga0501048_0772468 | Ga0501048_0772468_31_570 | 179 |
| 406 | 3300049584 | Ga0501068_0012880 | Ga0501068_0012880_505_1044 | 179 |
| 407 | 3300049584 | Ga0501068_0154864 | Ga0501068_0154864_608_1147 | 179 |
| 408 | 3300049584 | Ga0501068_0672170 | Ga0501068_0672170_94_633 | 179 |
| 409 | 3300049586 | Ga0501070_0570277 | Ga0501070_0570277_23_562 | 179 |
| 410 | 3300049588 | Ga0501072_0000100 | Ga0501072_0000100_6787_7326 | 179 |
| 411 | 3300049588 | Ga0501072_0348755 | Ga0501072_0348755_230_769 | 179 |
| 412 | 3300049588 | Ga0501072_0500170 | Ga0501072_0500170_50_589 | 179 |
| 413 | 3300049588 | Ga0501072_0963351 | Ga0501072_0963351_66_635 | 179 |
| 414 | 3300049589 | Ga0501073_0005071 | Ga0501073_0005071_5199_5738 | 179 |
| 415 | 3300049590 | Ga0501074_0000690 | Ga0501074_0000690_14568_15107 | 179 |
| 416 | 3300049590 | Ga0501074_0019373 | Ga0501074_0019373_256_795 | 179 |
| 417 | 3300049591 | Ga0501075_0005797 | Ga0501075_0005797_5431_5970 | 179 |
| 418 | 3300049591 | Ga0501075_0048946 | Ga0501075_0048946_2294_2833 | 179 |
| 419 | 3300049592 | Ga0501076_0023360 | Ga0501076_0023360_37_576 | 179 |
| 420 | 3300049592 | Ga0501076_0165888 | Ga0501076_0165888_782_1321 | 179 |
| 421 | 3300049593 | Ga0501077_0004230 | Ga0501077_0004230_3560_4099 | 179 |
| 422 | 3300049593 | Ga0501077_0023141 | Ga0501077_0023141_1104_1643 | 179 |
| 423 | 3300049593 | Ga0501077_0333711 | Ga0501077_0333711_257_796 | 179 |
| 424 | 3300049741 | Ga0501079_0000167 | Ga0501079_0000167_11980_12519 | 179 |
| 425 | 3300049741 | Ga0501079_0009213 | Ga0501079_0009213_4651_5190 | 179 |
| 426 | 3300049741 | Ga0501079_0120373 | Ga0501079_0120373_1359_1898 | 179 |
| 427 | 3300049742 | Ga0501080_0001200 | Ga0501080_0001200_11852_12391 | 179 |
| 428 | 3300049742 | Ga0501080_0036091 | Ga0501080_0036091_727_1266 | 179 |
| 429 | 3300049743 | Ga0501081_0003920 | Ga0501081_0003920_2340_2879 | 179 |
| 430 | 3300049743 | Ga0501081_0008091 | Ga0501081_0008091_4950_5489 | 179 |
| 431 | 3300049744 | Ga0501083_0013818 | Ga0501083_0013818_449_988 | 179 |
| 432 | 3300049744 | Ga0501083_0035659 | Ga0501083_0035659_1108_1647 | 179 |
| 433 | 3300049744 | Ga0501083_0130604 | Ga0501083_0130604_1018_1557 | 179 |
| 434 | 3300049822 | Ga0501035_0127560 | Ga0501035_0127560_1655_2194 | 179 |
| 435 | 3300049822 | Ga0501035_0388899 | Ga0501035_0388899_28_567 | 179 |
| 436 | 3300049823 | Ga0501044_1052033 | Ga0501044_1052033_110_649 | 179 |
| 437 | 3300049824 | Ga0501045_0001431 | Ga0501045_0001431_2251_2790 | 179 |
| 438 | 3300050489 | nmdc:mga03683_76337_c1 | nmdc:mga03683_76337_c1_881_1420 | 179 |
| 439 | 3300050490 | nmdc:mga03n38_31019_c1 | nmdc:mga03n38_31019_c1_1077_1616 | 179 |
| 440 | 3300050491 | nmdc:mga00v17_8676_c1 | nmdc:mga00v17_8676_c1_4034_4573 | 179 |
| 441 | 3300050493 | nmdc:mga0k408_13095_c1 | nmdc:mga0k408_13095_c1_281_820 | 179 |
| 442 | 3300050493 | nmdc:mga0k408_3429_c1 | nmdc:mga0k408_3429_c1_5387_5926 | 179 |
| 443 | 3300050494 | nmdc:mga06z11_428_c1 | nmdc:mga06z11_428_c1_2837_3376 | 179 |
| 444 | 3300050496 | nmdc:mga07m45_17916_c1 | nmdc:mga07m45_17916_c1_1054_1593 | 179 |
| 445 | 3300050507 | nmdc:mga05p37_1194185_c1 | nmdc:mga05p37_1194185_c1_33_572 | 179 |
| 446 | 3300050507 | nmdc:mga05p37_618393_c1 | nmdc:mga05p37_618393_c1_381_920 | 179 |
| 447 | 3300050508 | nmdc:mga09592_27473_c1 | nmdc:mga09592_27473_c1_3441_3980 | 179 |
| 448 | 3300050508 | nmdc:mga09592_364404_c1 | nmdc:mga09592_364404_c1_652_1191 | 179 |
| 449 | 3300050510 | nmdc:mga06r32_781890_c1 | nmdc:mga06r32_781890_c1_299_838 | 179 |
| 450 | 3300050511 | nmdc:mga08y16_26_c1 | nmdc:mga08y16_26_c1_209605_210144 | 179 |
| 451 | 3300050511 | nmdc:mga08y16_453066_c1 | nmdc:mga08y16_453066_c1_448_987 | 179 |
| 452 | 3300050511 | nmdc:mga08y16_654_c1 | nmdc:mga08y16_654_c1_21045_21584 | 179 |
| 453 | 3300050512 | nmdc:mga0n895_2177_c1 | nmdc:mga0n895_2177_c1_9889_10428 | 179 |
| 454 | 3300050512 | nmdc:mga0n895_391108_c1 | nmdc:mga0n895_391108_c1_12_551 | 179 |
| 455 | 3300050513 | nmdc:mga0rr50_265684_c1 | nmdc:mga0rr50_265684_c1_383_922 | 179 |
| 456 | 3300050513 | nmdc:mga0rr50_8989_c1 | nmdc:mga0rr50_8989_c1_5602_6141 | 179 |
| 457 | 3300050514 | nmdc:mga08x19_62727_c1 | nmdc:mga08x19_62727_c1_1002_1541 | 179 |
| 458 | 3300050515 | nmdc:mga0a205_100895_c1 | nmdc:mga0a205_100895_c1_515_1054 | 179 |
| 459 | 3300050515 | nmdc:mga0a205_437481_c1 | nmdc:mga0a205_437481_c1_123_662 | 179 |
| 460 | 3300053085 | Ga0495619_0082753 | Ga0495619_0082753_394_948 | 179 |
| 461 | 3300053130 | Ga0500642_0026960 | Ga0500642_0026960_632_1171 | 179 |
| 462 | 3300053151 | Ga0500604_0153887 | Ga0500604_0153887_90_629 | 179 |
| 463 | 3300054114 | Ga0501084_0000006 | Ga0501084_0000006_220889_221428 | 179 |
| 464 | 3300054114 | Ga0501084_0014397 | Ga0501084_0014397_2820_3359 | 179 |
| 465 | 3300054114 | Ga0501084_0039803 | Ga0501084_0039803_2451_2990 | 179 |
| 466 | 3300060353 | Ga0501082_0001204 | Ga0501082_0001204_3199_3738 | 179 |
| 467 | 3300060353 | Ga0501082_0002810 | Ga0501082_0002810_14629_15168 | 179 |
| 468 | 3300060353 | Ga0501082_0437047 | Ga0501082_0437047_268_807 | 179 |
| 469 | 3300061734 | Ga0530510_0087791 | Ga0530510_0087791_1318_1857 | 179 |
| 470 | 3300003203 | JGI25406J46586_10060768 | JGI25406J46586_100607682 | 180 |
| 471 | 3300005985 | Ga0081539_10002700 | Ga0081539_1000270014 | 180 |
| 472 | 3300031250 | Ga0265331_10000002 | Ga0265331_10000002400 | 180 |
| 473 | 3300031711 | Ga0265314_10006841 | Ga0265314_100068413 | 180 |
| 474 | 3300059421 | Ga0590071_110180 | Ga0590071_110180_11_553 | 180 |
| 475 | iso_pu_bacteria | 2894772417 | 2894774504 | 180 |
| 476 | 3300044765 | Ga0466970_0080870 | Ga0466970_0080870_525_1106 | 182 |
| 477 | 3300005435 | Ga0070714_100416854 | Ga0070714_1004168541 | 183 |
| 478 | 3300020076 | Ga0206355_1107471 | Ga0206355_11074711 | 183 |
| 479 | 3300020610 | Ga0154015_1692643 | Ga0154015_16926432 | 183 |
| 480 | 3300021384 | Ga0213876_10376992 | Ga0213876_103769921 | 183 |
| 481 | 3300025929 | Ga0207664_10032126 | Ga0207664_100321263 | 183 |
| 482 | 3300031251 | Ga0265327_10000034 | Ga0265327_10000034238 | 183 |
| 483 | 3300037853 | Ga0436364_0027385 | Ga0436364_0027385_271_858 | 183 |
| 484 | 3300044658 | Ga0466972_0043091 | Ga0466972_0043091_1025_1612 | 183 |
| 485 | 3300044683 | Ga0466965_0014625 | Ga0466965_0014625_2240_2827 | 183 |
| 486 | 3300044694 | Ga0466963_0047382 | Ga0466963_0047382_1725_2312 | 183 |
| 487 | 3300044735 | Ga0466968_0001698 | Ga0466968_0001698_7042_7629 | 183 |
| 488 | 3300044765 | Ga0466970_0031269 | Ga0466970_0031269_1545_2132 | 183 |
| 489 | 3300044842 | Ga0466957_0051034 | Ga0466957_0051034_906_1493 | 183 |
| 490 | 3300044901 | Ga0466960_0037474 | Ga0466960_0037474_886_1473 | 183 |
| 491 | 3300045049 | Ga0466959_0097972 | Ga0466959_0097972_725_1312 | 183 |
| 492 | 3300045836 | Ga0466958_0009323 | Ga0466958_0009323_1356_1943 | 183 |
| 493 | 3300045976 | Ga0466967_0003987 | Ga0466967_0003987_9232_9819 | 183 |
| 494 | 3300045976 | Ga0466967_0015597 | Ga0466967_0015597_623_1210 | 183 |
| 495 | 3300045976 | Ga0466967_0023877 | Ga0466967_0023877_3666_4253 | 183 |
| 496 | 3300048904 | Ga0496101_0030315 | Ga0496101_0030315_2836_3423 | 183 |
| 497 | 3300048915 | Ga0496112_0029496 | Ga0496112_0029496_4277_4864 | 183 |
| 498 | 3300048916 | Ga0496113_0014623 | Ga0496113_0014623_4732_5319 | 183 |
| 499 | 3300048925 | Ga0496122_0068650 | Ga0496122_0068650_1011_1598 | 183 |
| 500 | 3300048926 | Ga0496123_0034157 | Ga0496123_0034157_1581_2168 | 183 |
| 501 | 3300049568 | Ga0501031_0354924 | Ga0501031_0354924_56_643 | 183 |
| 502 | 3300049569 | Ga0501032_0009488 | Ga0501032_0009488_592_1179 | 183 |
| 503 | 3300049570 | Ga0501033_0005242 | Ga0501033_0005242_6852_7439 | 183 |
| 504 | 3300049571 | Ga0501034_0015666 | Ga0501034_0015666_3882_4469 | 183 |
| 505 | 3300049572 | Ga0501036_0180767 | Ga0501036_0180767_358_945 | 183 |
| 506 | 3300049573 | Ga0501037_0029170 | Ga0501037_0029170_29_616 | 183 |
| 507 | 3300049579 | Ga0501043_0069587 | Ga0501043_0069587_408_995 | 183 |
| 508 | 3300049580 | Ga0501046_0011358 | Ga0501046_0011358_6925_7512 | 183 |
| 509 | 3300049581 | Ga0501047_0370681 | Ga0501047_0370681_210_797 | 183 |
| 510 | 3300049582 | Ga0501048_0019214 | Ga0501048_0019214_3891_4478 | 183 |
| 511 | 3300049585 | Ga0501069_0285871 | Ga0501069_0285871_54_641 | 183 |
| 512 | 3300049586 | Ga0501070_0006875 | Ga0501070_0006875_690_1277 | 183 |
| 513 | 3300049822 | Ga0501035_0002184 | Ga0501035_0002184_10686_11273 | 183 |
| 514 | 3300049823 | Ga0501044_0002158 | Ga0501044_0002158_18977_19564 | 183 |
| 515 | 3300061719 | Ga0466962_0044770 | Ga0466962_0044770_335_922 | 183 |
| 516 | 3300001976 | JGI24752J21851_1005792 | JGI24752J21851_10057921 | 184 |
| 517 | 3300001991 | JGI24743J22301_10001991 | JGI24743J22301_100019913 | 184 |
| 518 | 3300002073 | JGI24745J21846_1014103 | JGI24745J21846_10141031 | 184 |
| 519 | 3300002074 | JGI24748J21848_1016011 | JGI24748J21848_10160111 | 184 |
| 520 | 3300002126 | JGI24035J26624_1009783 | JGI24035J26624_10097831 | 184 |
| 521 | 3300002239 | JGI24034J26672_10011564 | JGI24034J26672_100115642 | 184 |
| 522 | 3300002244 | JGI24742J22300_10035873 | JGI24742J22300_100358731 | 184 |
| 523 | 3300002459 | JGI24751J29686_10005412 | JGI24751J29686_100054123 | 184 |
| 524 | 3300003308 | Ga0006777J48905_1011873 | Ga0006777J48905_10118731 | 184 |
| 525 | 3300003544 | Ga0007417J51691_1004037 | Ga0007417J51691_10040371 | 184 |
| 526 | 3300003559 | Ga0007427J51700_107763 | Ga0007427J51700_1077631 | 184 |
| 527 | 3300003568 | Ga0006781J51513_1013523 | Ga0006781J51513_10135231 | 184 |
| 528 | 3300003575 | Ga0007409J51694_1004929 | Ga0007409J51694_10049291 | 184 |
| 529 | 3300003579 | Ga0007429J51699_1008412 | Ga0007429J51699_10084121 | 184 |
| 530 | 3300003611 | Ga0007411J51799_103535 | Ga0007411J51799_1035351 | 184 |
| 531 | 3300003613 | Ga0007415J51800_105198 | Ga0007415J51800_1051981 | 184 |
| 532 | 3300003659 | JGI25404J52841_10009935 | JGI25404J52841_100099352 | 184 |
| 533 | 3300003693 | Ga0032354_1014034 | Ga0032354_10140341 | 184 |
| 534 | 3300005289 | Ga0065704_10260902 | Ga0065704_102609022 | 184 |
| 535 | 3300005293 | Ga0065715_10094138 | Ga0065715_100941384 | 184 |
| 536 | 3300005295 | Ga0065707_10307848 | Ga0065707_103078482 | 184 |
| 537 | 3300005327 | Ga0070658_10002993 | Ga0070658_100029934 | 184 |
| 538 | 3300005328 | Ga0070676_10000714 | Ga0070676_1000071415 | 184 |
| 539 | 3300005329 | Ga0070683_100001881 | Ga0070683_10000188114 | 184 |
| 540 | 3300005329 | Ga0070683_100462577 | Ga0070683_1004625771 | 184 |
| 541 | 3300005330 | Ga0070690_100000665 | Ga0070690_1000006653 | 184 |
| 542 | 3300005331 | Ga0070670_100131259 | Ga0070670_1001312592 | 184 |
| 543 | 3300005333 | Ga0070677_10000828 | Ga0070677_100008287 | 184 |
| 544 | 3300005334 | Ga0068869_100000053 | Ga0068869_10000005338 | 184 |
| 545 | 3300005335 | Ga0070666_10023498 | Ga0070666_100234983 | 184 |
| 546 | 3300005338 | Ga0068868_100001316 | Ga0068868_10000131615 | 184 |
| 547 | 3300005339 | Ga0070660_100000278 | Ga0070660_10000027816 | 184 |
| 548 | 3300005340 | Ga0070689_100001003 | Ga0070689_10000100315 | 184 |
| 549 | 3300005341 | Ga0070691_10082707 | Ga0070691_100827072 | 184 |
| 550 | 3300005343 | Ga0070687_100000039 | Ga0070687_10000003939 | 184 |
| 551 | 3300005344 | Ga0070661_100001794 | Ga0070661_10000179416 | 184 |
| 552 | 3300005344 | Ga0070661_100010106 | Ga0070661_1000101062 | 184 |
| 553 | 3300005345 | Ga0070692_10002540 | Ga0070692_100025401 | 184 |
| 554 | 3300005347 | Ga0070668_100000995 | Ga0070668_1000009955 | 184 |
| 555 | 3300005353 | Ga0070669_100004018 | Ga0070669_1000040188 | 184 |
| 556 | 3300005354 | Ga0070675_100006048 | Ga0070675_1000060483 | 184 |
| 557 | 3300005355 | Ga0070671_100000390 | Ga0070671_10000039015 | 184 |
| 558 | 3300005356 | Ga0070674_100000407 | Ga0070674_1000004074 | 184 |
| 559 | 3300005364 | Ga0070673_100000457 | Ga0070673_1000004574 | 184 |
| 560 | 3300005365 | Ga0070688_100000451 | Ga0070688_1000004517 | 184 |
| 561 | 3300005366 | Ga0070659_100000275 | Ga0070659_1000002752 | 184 |
| 562 | 3300005367 | Ga0070667_100003961 | Ga0070667_1000039612 | 184 |
| 563 | 3300005438 | Ga0070701_10003621 | Ga0070701_100036215 | 184 |
| 564 | 3300005440 | Ga0070705_100000576 | Ga0070705_1000005762 | 184 |
| 565 | 3300005441 | Ga0070700_100006035 | Ga0070700_1000060352 | 184 |
| 566 | 3300005455 | Ga0070663_100024038 | Ga0070663_1000240383 | 184 |
| 567 | 3300005456 | Ga0070678_100000580 | Ga0070678_1000005805 | 184 |
| 568 | 3300005457 | Ga0070662_100000608 | Ga0070662_1000006087 | 184 |
| 569 | 3300005459 | Ga0068867_100001364 | Ga0068867_1000013642 | 184 |
| 570 | 3300005466 | Ga0070685_10000029 | Ga0070685_1000002916 | 184 |
| 571 | 3300005535 | Ga0070684_100099850 | Ga0070684_1000998502 | 184 |
| 572 | 3300005539 | Ga0068853_100002097 | Ga0068853_10000209715 | 184 |
| 573 | 3300005543 | Ga0070672_100020815 | Ga0070672_1000208152 | 184 |
| 574 | 3300005544 | Ga0070686_100000652 | Ga0070686_1000006522 | 184 |
| 575 | 3300005545 | Ga0070695_100009034 | Ga0070695_1000090342 | 184 |
| 576 | 3300005546 | Ga0070696_100016537 | Ga0070696_1000165374 | 184 |
| 577 | 3300005547 | Ga0070693_100017499 | Ga0070693_1000174992 | 184 |
| 578 | 3300005548 | Ga0070665_100075382 | Ga0070665_1000753824 | 184 |
| 579 | 3300005549 | Ga0070704_100031769 | Ga0070704_1000317692 | 184 |
| 580 | 3300005563 | Ga0068855_100001417 | Ga0068855_10000141714 | 184 |
| 581 | 3300005564 | Ga0070664_100000413 | Ga0070664_10000041312 | 184 |
| 582 | 3300005564 | Ga0070664_100030855 | Ga0070664_1000308554 | 184 |
| 583 | 3300005577 | Ga0068857_100010610 | Ga0068857_1000106108 | 184 |
| 584 | 3300005578 | Ga0068854_100013498 | Ga0068854_1000134984 | 184 |
| 585 | 3300005614 | Ga0068856_100002325 | Ga0068856_10000232520 | 184 |
| 586 | 3300005615 | Ga0070702_100092842 | Ga0070702_1000928423 | 184 |
| 587 | 3300005616 | Ga0068852_100013975 | Ga0068852_1000139754 | 184 |
| 588 | 3300005617 | Ga0068859_100003079 | Ga0068859_10000307915 | 184 |
| 589 | 3300005618 | Ga0068864_100002813 | Ga0068864_1000028133 | 184 |
| 590 | 3300005718 | Ga0068866_10007525 | Ga0068866_100075252 | 184 |
| 591 | 3300005719 | Ga0068861_100000747 | Ga0068861_10000074717 | 184 |
| 592 | 3300005834 | Ga0068851_10002087 | Ga0068851_100020877 | 184 |
| 593 | 3300005840 | Ga0068870_10000020 | Ga0068870_1000002046 | 184 |
| 594 | 3300005841 | Ga0068863_100057242 | Ga0068863_1000572421 | 184 |
| 595 | 3300005842 | Ga0068858_100045581 | Ga0068858_1000455812 | 184 |
| 596 | 3300005843 | Ga0068860_100093648 | Ga0068860_1000936482 | 184 |
| 597 | 3300005844 | Ga0068862_100032939 | Ga0068862_1000329392 | 184 |
| 598 | 3300005983 | Ga0081540_1000073 | Ga0081540_100007398 | 184 |
| 599 | 3300005983 | Ga0081540_1000209 | Ga0081540_100020944 | 184 |
| 600 | 3300005983 | Ga0081540_1002268 | Ga0081540_10022688 | 184 |
| 601 | 3300006237 | Ga0097621_100000749 | Ga0097621_1000007493 | 184 |
| 602 | 3300006358 | Ga0068871_100001439 | Ga0068871_10000143915 | 184 |
| 603 | 3300006881 | Ga0068865_100001088 | Ga0068865_10000108815 | 184 |
| 604 | 3300006931 | Ga0097620_100003079 | Ga0097620_10000307915 | 184 |
| 605 | 3300009093 | Ga0105240_10030101 | Ga0105240_100301017 | 184 |
| 606 | 3300009098 | Ga0105245_10004584 | Ga0105245_1000458412 | 184 |
| 607 | 3300009098 | Ga0105245_10649407 | Ga0105245_106494071 | 184 |
| 608 | 3300009101 | Ga0105247_10000214 | Ga0105247_1000021422 | 184 |
| 609 | 3300009148 | Ga0105243_10002675 | Ga0105243_100026755 | 184 |
| 610 | 3300009174 | Ga0105241_10001059 | Ga0105241_100010599 | 184 |
| 611 | 3300009176 | Ga0105242_10002175 | Ga0105242_100021754 | 184 |
| 612 | 3300009177 | Ga0105248_10002337 | Ga0105248_100023372 | 184 |
| 613 | 3300009545 | Ga0105237_10000421 | Ga0105237_1000042140 | 184 |
| 614 | 3300009551 | Ga0105238_10002253 | Ga0105238_1000225315 | 184 |
| 615 | 3300009553 | Ga0105249_10003184 | Ga0105249_1000318412 | 184 |
| 616 | 3300010375 | Ga0105239_10004165 | Ga0105239_100041654 | 184 |
| 617 | 3300011119 | Ga0105246_10010489 | Ga0105246_100104892 | 184 |
| 618 | 3300013100 | Ga0157373_10107793 | Ga0157373_101077932 | 184 |
| 619 | 3300013102 | Ga0157371_10000366 | Ga0157371_1000036641 | 184 |
| 620 | 3300013105 | Ga0157369_10000489 | Ga0157369_100004893 | 184 |
| 621 | 3300013296 | Ga0157374_10023967 | Ga0157374_100239673 | 184 |
| 622 | 3300013297 | Ga0157378_10001507 | Ga0157378_1000150716 | 184 |
| 623 | 3300013306 | Ga0163162_10001347 | Ga0163162_1000134720 | 184 |
| 624 | 3300013307 | Ga0157372_10003591 | Ga0157372_100035914 | 184 |
| 625 | 3300013308 | Ga0157375_10002709 | Ga0157375_1000270915 | 184 |
| 626 | 3300014325 | Ga0163163_10015231 | Ga0163163_100152318 | 184 |
| 627 | 3300014326 | Ga0157380_10153882 | Ga0157380_101538822 | 184 |
| 628 | 3300014497 | Ga0182008_10227273 | Ga0182008_102272732 | 184 |
| 629 | 3300014745 | Ga0157377_10000764 | Ga0157377_100007647 | 184 |
| 630 | 3300014968 | Ga0157379_10000390 | Ga0157379_1000039015 | 184 |
| 631 | 3300014969 | Ga0157376_10000902 | Ga0157376_100009025 | 184 |
| 632 | 3300017792 | Ga0163161_10008932 | Ga0163161_100089327 | 184 |
| 633 | 3300020076 | Ga0206355_1701660 | Ga0206355_17016601 | 184 |
| 634 | 3300020610 | Ga0154015_1082936 | Ga0154015_10829361 | 184 |
| 635 | 3300025315 | Ga0207697_10000203 | Ga0207697_100002032 | 184 |
| 636 | 3300025321 | Ga0207656_10001939 | Ga0207656_100019394 | 184 |
| 637 | 3300025893 | Ga0207682_10000257 | Ga0207682_100002575 | 184 |
| 638 | 3300025899 | Ga0207642_10000606 | Ga0207642_1000060612 | 184 |
| 639 | 3300025900 | Ga0207710_10002096 | Ga0207710_100020967 | 184 |
| 640 | 3300025901 | Ga0207688_10003903 | Ga0207688_100039037 | 184 |
| 641 | 3300025903 | Ga0207680_10002283 | Ga0207680_100022833 | 184 |
| 642 | 3300025904 | Ga0207647_10000387 | Ga0207647_1000038715 | 184 |
| 643 | 3300025907 | Ga0207645_10000417 | Ga0207645_1000041714 | 184 |
| 644 | 3300025908 | Ga0207643_10000154 | Ga0207643_1000015440 | 184 |
| 645 | 3300025909 | Ga0207705_10007789 | Ga0207705_100077898 | 184 |
| 646 | 3300025911 | Ga0207654_10003639 | Ga0207654_100036398 | 184 |
| 647 | 3300025913 | Ga0207695_10112888 | Ga0207695_101128881 | 184 |
| 648 | 3300025914 | Ga0207671_10004205 | Ga0207671_1000420514 | 184 |
| 649 | 3300025917 | Ga0207660_10031723 | Ga0207660_100317233 | 184 |
| 650 | 3300025918 | Ga0207662_10000009 | Ga0207662_100000093 | 184 |
| 651 | 3300025919 | Ga0207657_10000042 | Ga0207657_1000004296 | 184 |
| 652 | 3300025920 | Ga0207649_10000987 | Ga0207649_100009874 | 184 |
| 653 | 3300025920 | Ga0207649_10002245 | Ga0207649_100022453 | 184 |
| 654 | 3300025921 | Ga0207652_10114107 | Ga0207652_101141072 | 184 |
| 655 | 3300025923 | Ga0207681_10002545 | Ga0207681_1000254512 | 184 |
| 656 | 3300025925 | Ga0207650_10001430 | Ga0207650_100014302 | 184 |
| 657 | 3300025926 | Ga0207659_10000098 | Ga0207659_1000009840 | 184 |
| 658 | 3300025927 | Ga0207687_10013393 | Ga0207687_100133935 | 184 |
| 659 | 3300025931 | Ga0207644_10002971 | Ga0207644_100029718 | 184 |
| 660 | 3300025932 | Ga0207690_10002397 | Ga0207690_1000239711 | 184 |
| 661 | 3300025933 | Ga0207706_10000046 | Ga0207706_1000004696 | 184 |
| 662 | 3300025934 | Ga0207686_10004103 | Ga0207686_100041032 | 184 |
| 663 | 3300025935 | Ga0207709_10009278 | Ga0207709_100092782 | 184 |
| 664 | 3300025936 | Ga0207670_10000320 | Ga0207670_1000032026 | 184 |
| 665 | 3300025937 | Ga0207669_10006867 | Ga0207669_100068673 | 184 |
| 666 | 3300025938 | Ga0207704_10001258 | Ga0207704_100012582 | 184 |
| 667 | 3300025940 | Ga0207691_10000766 | Ga0207691_100007664 | 184 |
| 668 | 3300025941 | Ga0207711_10001432 | Ga0207711_1000143220 | 184 |
| 669 | 3300025942 | Ga0207689_10000567 | Ga0207689_1000056714 | 184 |
| 670 | 3300025944 | Ga0207661_10011775 | Ga0207661_100117754 | 184 |
| 671 | 3300025944 | Ga0207661_10392588 | Ga0207661_103925882 | 184 |
| 672 | 3300025945 | Ga0207679_10000752 | Ga0207679_100007527 | 184 |
| 673 | 3300025949 | Ga0207667_10009926 | Ga0207667_1000992611 | 184 |
| 674 | 3300025960 | Ga0207651_10000279 | Ga0207651_100002792 | 184 |
| 675 | 3300025961 | Ga0207712_10001071 | Ga0207712_100010714 | 184 |
| 676 | 3300025972 | Ga0207668_10009462 | Ga0207668_100094623 | 184 |
| 677 | 3300025981 | Ga0207640_10003620 | Ga0207640_100036204 | 184 |
| 678 | 3300025986 | Ga0207658_10000501 | Ga0207658_1000050114 | 184 |
| 679 | 3300026023 | Ga0207677_10000380 | Ga0207677_1000038016 | 184 |
| 680 | 3300026035 | Ga0207703_10000628 | Ga0207703_1000062820 | 184 |
| 681 | 3300026041 | Ga0207639_10002863 | Ga0207639_1000286311 | 184 |
| 682 | 3300026067 | Ga0207678_10039049 | Ga0207678_100390493 | 184 |
| 683 | 3300026075 | Ga0207708_10034182 | Ga0207708_100341822 | 184 |
| 684 | 3300026078 | Ga0207702_10011537 | Ga0207702_100115372 | 184 |
| 685 | 3300026088 | Ga0207641_10001707 | Ga0207641_100017077 | 184 |
| 686 | 3300026089 | Ga0207648_10000811 | Ga0207648_1000081120 | 184 |
| 687 | 3300026095 | Ga0207676_10000688 | Ga0207676_1000068814 | 184 |
| 688 | 3300026116 | Ga0207674_10000038 | Ga0207674_1000003860 | 184 |
| 689 | 3300026118 | Ga0207675_100000023 | Ga0207675_1000000235 | 184 |
| 690 | 3300026121 | Ga0207683_10001637 | Ga0207683_1000163720 | 184 |
| 691 | 3300026142 | Ga0207698_10001393 | Ga0207698_100013934 | 184 |
| 692 | 3300028379 | Ga0268266_10002035 | Ga0268266_100020354 | 184 |
| 693 | 3300028380 | Ga0268265_10001348 | Ga0268265_100013482 | 184 |
| 694 | 3300028381 | Ga0268264_10000191 | Ga0268264_1000019127 | 184 |
| 695 | 3300037068 | Ga0373925_0181603 | Ga0373925_0181603_966_1520 | 184 |
| 696 | 3300042005 | Ga0439448_0043070 | Ga0439448_0043070_100_654 | 184 |
| 697 | 3300042012 | Ga0439455_0135580 | Ga0439455_0135580_31_585 | 184 |
| 698 | 3300042876 | Ga0451577_0207056 | Ga0451577_0207056_71_625 | 184 |
| 699 | 3300044658 | Ga0466972_0237069 | Ga0466972_0237069_138_692 | 184 |
| 700 | 3300044712 | Ga0453684_0868414 | Ga0453684_0868414_259_813 | 184 |
| 701 | 3300045051 | Ga0451576_0290384 | Ga0451576_0290384_711_1265 | 184 |
| 702 | 3300048904 | Ga0496101_0083421 | Ga0496101_0083421_812_1366 | 184 |
| 703 | 3300048905 | Ga0496102_0005889 | Ga0496102_0005889_7868_8422 | 184 |
| 704 | 3300048906 | Ga0496103_0028856 | Ga0496103_0028856_1761_2315 | 184 |
| 705 | 3300048907 | Ga0496104_0625191 | Ga0496104_0625191_323_877 | 184 |
| 706 | 3300048908 | Ga0496105_0741880 | Ga0496105_0741880_67_621 | 184 |
| 707 | 3300048909 | Ga0496106_0050970 | Ga0496106_0050970_1189_1743 | 184 |
| 708 | 3300048910 | Ga0496107_0010589 | Ga0496107_0010589_1606_2160 | 184 |
| 709 | 3300048911 | Ga0496108_0150013 | Ga0496108_0150013_279_833 | 184 |
| 710 | 3300048912 | Ga0496109_0018306 | Ga0496109_0018306_451_1005 | 184 |
| 711 | 3300048914 | Ga0496111_0034054 | Ga0496111_0034054_2375_2929 | 184 |
| 712 | 3300048915 | Ga0496112_0027679 | Ga0496112_0027679_1377_1931 | 184 |
| 713 | 3300048917 | Ga0496114_0349246 | Ga0496114_0349246_558_1112 | 184 |
| 714 | 3300050512 | nmdc:mga0n895_849977_c1 | nmdc:mga0n895_849977_c1_146_700 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xts-assembly2.cif.gz_T | salmonella typhimurium ahpc t43a mutant | 0.9385 | 4 | 162 |
| 3emp-assembly1.cif.gz_D-2 | crystal structure of the s-acetanilide modified form of c165s ahpc | 0.9319 | 4 | 161 |
| 4xs1-assembly1.cif.gz_D-2 | salmonella typhimurium ahpc t43v mutant | 0.9313 | 2 | 161 |
| 6e0f-assembly1.cif.gz_J | mitochondrial peroxiredoxin from leishmania infantum in complex with unfolding client protein after heat stress | 0.931 | 1 | 161 |
| 4ql7-assembly1.cif.gz_D-2 | crystal structure of c-terminus truncated alkylhydroperoxide reductase subunit c (ahpc1-172) from e. coli | 0.9279 | 1 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQB7_4_193_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9391 | 2 | 184 | 3.40.30.10 |
| 2bmxC00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9345 | 1 | 160 | 3.40.30.10 |
| af_P9WQB7_4_193_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9292 | 2 | 184 | 3.40.30.10 |
| af_A0A0R4J2P7_61_260_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9189 | 1 | 174 | 3.40.30.10 |
| 5id2B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9114 | 1 | 159 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521TV92-F1-model_v4 | Peroxiredoxin | 0.9908 | 1 | 176 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A4P5VZT6-F1-model_v4 | Alkyl hydroperoxide reductase | 0.9904 | 1 | 176 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A4Q6BRM0-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9884 | 1 | 176 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A2B4R3Y6-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) | 0.9872 | 53 | 176 |
GO:0005829
GO:0006979 GO:0008379 GO:0018580 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A651FDP7-F1-model_v4 | Peroxiredoxin | 0.9868 | 1 | 176 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar