F476945

General Info

Members Datasets Scaffolds Average Seq Length
714 385 712 182

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10153882|Ga0157380_101538822
Length 218
Sequence LRFGITRRIKEGLVGPFGHLEPSKHERQRRSETQMLTVGDRFPAFNLKAAVSLEKGKEFKDITEKDYAGKWKVVFFWPMDFTFICPTEIAEFGKQNGQFLERDAQVLGASTDTHFVHLAWRKDHPDLRTLPFPMLADTRRELSTQLGILHKTDGVPLRATFIVDPEGIIRWASVNDLSVGRNVSEVLRVLDGLQTDELCPCNWKQGEETLSQKMKKAS

Samples

Sample ID Description Type Environment
1 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
2 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
230 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
231 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
232 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
233 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
234 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
238 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
248 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
276 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
279 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
280 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.24
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 3.08
Rhizosphere 92.72
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005792 3300001976 Bacteria 1613
2 JGI24737J22298_10144013 3300001990 Bacteria 704
3 JGI24743J22301_10001991 3300001991 Bacteria 2984
4 JGI24745J21846_1014103 3300002073 Bacteria 925
5 JGI24748J21848_1016011 3300002074 Bacteria 895
6 JGI24749J21850_1002430 3300002076 Bacteria 2618
7 JGI24035J26624_1009783 3300002126 Bacteria 947
8 JGI24034J26672_10011564 3300002239 Bacteria 1324
9 JGI24742J22300_10035873 3300002244 Bacteria 875
10 JGI24751J29686_10005412 3300002459 Bacteria 2598
11 JGI25406J46586_10060768 3300003203 Unclassified 1221
12 Ga0006777J48905_1011873 3300003308 Bacteria 685
13 Ga0007417J51691_1004037 3300003544 Bacteria 1391
14 Ga0007427J51700_107763 3300003559 Bacteria 714
15 Ga0006781J51513_1013523 3300003568 Bacteria 680
16 Ga0007409J51694_1004929 3300003575 Bacteria 676
17 Ga0007429J51699_1008412 3300003579 Bacteria 715
18 Ga0007411J51799_103535 3300003611 Bacteria 714
19 Ga0007415J51800_105198 3300003613 Bacteria 707
20 JGI25404J52841_10009935 3300003659 Bacteria 2042
21 Ga0032354_1014034 3300003693 Bacteria 625
22 Ga0065704_10260902 3300005289 Bacteria 966
23 Ga0065712_10381837 3300005290 Bacteria 751
24 Ga0065715_10094138 3300005293 Bacteria 4432
25 Ga0065715_10226977 3300005293 Bacteria 1248
26 Ga0065707_10307848 3300005295 Bacteria 990
27 Ga0065707_10492885 3300005295 Bacteria 764
28 Ga0070658_10002993 3300005327 Bacteria 13979
29 Ga0070676_10000714 3300005328 Bacteria 16252
30 Ga0070676_10002103 3300005328 Bacteria 10135
31 Ga0070683_100001881 3300005329 Bacteria 16392
32 Ga0070683_100462577 3300005329 Bacteria 1211
33 Ga0070690_100000665 3300005330 Bacteria 17495
34 Ga0070690_100028478 3300005330 Bacteria 3461
35 Ga0070670_100002019 3300005331 Bacteria 16603
36 Ga0070670_100131259 3300005331 Bacteria 2163
37 Ga0070677_10000828 3300005333 Bacteria 10144
38 Ga0070677_10113431 3300005333 Bacteria 1213
39 Ga0068869_100000053 3300005334 Bacteria 50209
40 Ga0068869_100004382 3300005334 Bacteria 8764
41 Ga0068869_100108759 3300005334 Bacteria 2106
42 Ga0068869_100292735 3300005334 Bacteria 1312
43 Ga0070666_10023498 3300005335 Bacteria 4013
44 Ga0070680_100000934 3300005336 Bacteria 20654
45 Ga0070680_100274735 3300005336 Bacteria 1427
46 Ga0070682_100001571 3300005337 Bacteria 12752
47 Ga0070682_100154508 3300005337 Bacteria 1578
48 Ga0068868_100001316 3300005338 Bacteria 17121
49 Ga0068868_100010020 3300005338 Bacteria 6847
50 Ga0068868_100784478 3300005338 Bacteria 858
51 Ga0070660_100000278 3300005339 Bacteria 33996
52 Ga0070660_100001191 3300005339 Bacteria 17626
53 Ga0070660_100007940 3300005339 Bacteria 7408
54 Ga0070689_100001003 3300005340 Bacteria 17701
55 Ga0070689_100039657 3300005340 Bacteria 3607
56 Ga0070691_10037989 3300005341 Bacteria 2273
57 Ga0070691_10082707 3300005341 Bacteria 1574
58 Ga0070691_10119544 3300005341 Bacteria 1325
59 Ga0070687_100000039 3300005343 Bacteria 41821
60 Ga0070687_100000770 3300005343 Bacteria 10661
61 Ga0070687_100001392 3300005343 Bacteria 8484
62 Ga0070661_100000211 3300005344 Bacteria 48345
63 Ga0070661_100001794 3300005344 Bacteria 14889
64 Ga0070661_100010106 3300005344 Bacteria 6555
65 Ga0070692_10002540 3300005345 Bacteria 7104
66 Ga0070692_10007574 3300005345 Bacteria 4789
67 Ga0070692_10112657 3300005345 Bacteria 1507
68 Ga0070668_100000995 3300005347 Bacteria 19898
69 Ga0070668_100202560 3300005347 Bacteria 1629
70 Ga0070669_100004018 3300005353 Bacteria 10638
71 Ga0070669_100041543 3300005353 Bacteria 3345
72 Ga0070669_100647768 3300005353 Bacteria 888
73 Ga0070675_100006048 3300005354 Bacteria 9273
74 Ga0070675_100278641 3300005354 Bacteria 1469
75 Ga0070671_100000390 3300005355 Bacteria 30162
76 Ga0070671_100194044 3300005355 Bacteria 1721
77 Ga0070674_100000407 3300005356 Bacteria 21630
78 Ga0070674_100101462 3300005356 Bacteria 2097
79 Ga0070673_100000457 3300005364 Bacteria 21630
80 Ga0070673_100200515 3300005364 Bacteria 1718
81 Ga0070688_100000451 3300005365 Bacteria 20808
82 Ga0070688_100246443 3300005365 Bacteria 1270
83 Ga0070659_100000275 3300005366 Bacteria 40130
84 Ga0070659_100003620 3300005366 Bacteria 10998
85 Ga0070659_100148596 3300005366 Bacteria 1910
86 Ga0070667_100003961 3300005367 Bacteria 12567
87 Ga0070667_100046041 3300005367 Bacteria 3669
88 Ga0070703_10004864 3300005406 Bacteria 3754
89 Ga0070714_100416854 3300005435 Bacteria 1271
90 Ga0070701_10001229 3300005438 Bacteria 9401
91 Ga0070701_10003621 3300005438 Bacteria 6142
92 Ga0070701_10306127 3300005438 Bacteria 978
93 Ga0070705_100000576 3300005440 Bacteria 21287
94 Ga0070705_100001410 3300005440 Bacteria 12716
95 Ga0070705_100699836 3300005440 Bacteria 796
96 Ga0070700_100006035 3300005441 Bacteria 6449
97 Ga0070700_100099047 3300005441 Bacteria 1917
98 Ga0070694_100001526 3300005444 Bacteria 13597
99 Ga0070694_100013510 3300005444 Bacteria 5100
100 Ga0070694_100649895 3300005444 Bacteria 853
101 Ga0070663_100002478 3300005455 Bacteria 10415
102 Ga0070663_100006656 3300005455 Bacteria 6967
103 Ga0070663_100024038 3300005455 Bacteria 4093
104 Ga0070678_100000580 3300005456 Bacteria 17943
105 Ga0070662_100000608 3300005457 Bacteria 21848
106 Ga0070662_100002397 3300005457 Bacteria 11518
107 Ga0070662_100433428 3300005457 Bacteria 1089
108 Ga0070681_10038653 3300005458 Bacteria 4784
109 Ga0070681_10045796 3300005458 Bacteria 4375
110 Ga0068867_100001364 3300005459 Bacteria 16853
111 Ga0068867_100003605 3300005459 Bacteria 10894
112 Ga0068867_100304281 3300005459 Bacteria 1315
113 Ga0070685_10000029 3300005466 Bacteria 89387
114 Ga0070685_10071828 3300005466 Bacteria 2053
115 Ga0070679_100004586 3300005530 Bacteria 12752
116 Ga0070684_100099850 3300005535 Bacteria 2591
117 Ga0068853_100000678 3300005539 Bacteria 23432
118 Ga0068853_100002097 3300005539 Bacteria 14789
119 Ga0068853_100015285 3300005539 Bacteria 6308
120 Ga0070672_100020815 3300005543 Bacteria 4790
121 Ga0070672_100094015 3300005543 Bacteria 2423
122 Ga0070686_100000652 3300005544 Bacteria 20348
123 Ga0070686_100079797 3300005544 Bacteria 2164
124 Ga0070695_100002767 3300005545 Bacteria 10175
125 Ga0070695_100006632 3300005545 Bacteria 6843
126 Ga0070695_100009034 3300005545 Bacteria 5924
127 Ga0070695_100571999 3300005545 Bacteria 883
128 Ga0070695_100938605 3300005545 Bacteria 701
129 Ga0070696_100000966 3300005546 Bacteria 18618
130 Ga0070696_100016537 3300005546 Bacteria 4971
131 Ga0070696_100077905 3300005546 Bacteria 2343
132 Ga0070696_100098102 3300005546 Bacteria 2096
133 Ga0070696_100177819 3300005546 Bacteria 1577
134 Ga0070696_100480334 3300005546 Bacteria 985
135 Ga0070693_100000189 3300005547 Bacteria 28531
136 Ga0070693_100017499 3300005547 Bacteria 3727
137 Ga0070693_100233190 3300005547 Bacteria 1212
138 Ga0070665_100003284 3300005548 Bacteria 17361
139 Ga0070665_100075382 3300005548 Bacteria 3380
140 Ga0070665_101232498 3300005548 Bacteria 759
141 Ga0070704_100009072 3300005549 Bacteria 6000
142 Ga0070704_100031769 3300005549 Bacteria 3555
143 Ga0070704_100410663 3300005549 Bacteria 1157
144 Ga0068855_100001417 3300005563 Bacteria 29769
145 Ga0068855_100002802 3300005563 Bacteria 21454
146 Ga0068855_100028396 3300005563 Bacteria 6693
147 Ga0068855_100035134 3300005563 Bacteria 5971
148 Ga0070664_100000413 3300005564 Bacteria 31911
149 Ga0070664_100030855 3300005564 Bacteria 4474
150 Ga0070664_100166635 3300005564 Bacteria 1952
151 Ga0068857_100010610 3300005577 Bacteria 8010
152 Ga0068857_100040946 3300005577 Bacteria 4107
153 Ga0068857_100091502 3300005577 Bacteria 2723
154 Ga0068854_100001086 3300005578 Bacteria 16390
155 Ga0068854_100013498 3300005578 Bacteria 5364
156 Ga0068854_101142575 3300005578 Bacteria 695
157 Ga0068856_100002325 3300005614 Bacteria 19581
158 Ga0068856_100002994 3300005614 Bacteria 17292
159 Ga0068856_100157604 3300005614 Bacteria 2280
160 Ga0070702_100021060 3300005615 Bacteria 3425
161 Ga0070702_100075675 3300005615 Bacteria 2002
162 Ga0070702_100092842 3300005615 Bacteria 1834
163 Ga0068852_100013975 3300005616 Bacteria 6159
164 Ga0068859_100002675 3300005617 Bacteria 18099
165 Ga0068859_100003079 3300005617 Bacteria 16916
166 Ga0068859_100384713 3300005617 Bacteria 1499
167 Ga0068864_100002813 3300005618 Bacteria 14359
168 Ga0068866_10007525 3300005718 Bacteria 4563
169 Ga0068866_10191990 3300005718 Bacteria 1214
170 Ga0068861_100000584 3300005719 Bacteria 21594
171 Ga0068861_100000747 3300005719 Bacteria 19504
172 Ga0068861_100105148 3300005719 Bacteria 2253
173 Ga0068851_10002087 3300005834 Bacteria 8788
174 Ga0068870_10000020 3300005840 Bacteria 56949
175 Ga0068870_10000367 3300005840 Bacteria 16912
176 Ga0068870_10315981 3300005840 Bacteria 991
177 Ga0068863_100057242 3300005841 Bacteria 3689
178 Ga0068863_100066613 3300005841 Bacteria 3406
179 Ga0068863_100245054 3300005841 Bacteria 1730
180 Ga0068858_100016416 3300005842 Bacteria 6952
181 Ga0068858_100045581 3300005842 Bacteria 4064
182 Ga0068858_100162578 3300005842 Bacteria 2102
183 Ga0068860_100019733 3300005843 Bacteria 6535
184 Ga0068860_100093648 3300005843 Bacteria 2863
185 Ga0068860_100154301 3300005843 Bacteria 2213
186 Ga0068862_100000487 3300005844 Bacteria 42413
187 Ga0068862_100032939 3300005844 Bacteria 4377
188 Ga0068862_100157301 3300005844 Bacteria 2026
189 Ga0081455_10000868 3300005937 Bacteria 39013
190 Ga0081540_1000073 3300005983 Bacteria 108893
191 Ga0081540_1000209 3300005983 Bacteria 61438
192 Ga0081540_1002268 3300005983 Bacteria 15812
193 Ga0081540_1112142 3300005983 Bacteria 1150
194 Ga0081539_10002700 3300005985 Bacteria 24080
195 Ga0070717_10042387 3300006028 Bacteria 3712
196 Ga0075365_10153119 3300006038 Bacteria 1604
197 Ga0075363_100028486 3300006048 Bacteria 2874
198 Ga0075364_10006228 3300006051 Bacteria 6997
199 Ga0075362_10002673 3300006177 Bacteria 6056
200 Ga0075367_10002794 3300006178 Bacteria 8092
201 Ga0075367_10085476 3300006178 Bacteria 1914
202 Ga0075366_10000211 3300006195 Bacteria 25584
203 Ga0097621_100000749 3300006237 Bacteria 22765
204 Ga0097621_100009977 3300006237 Bacteria 6923
205 Ga0097621_100234458 3300006237 Bacteria 1603
206 Ga0075370_10029135 3300006353 Bacteria 3072
207 Ga0068871_100001439 3300006358 Bacteria 15939
208 Ga0068871_100282167 3300006358 Bacteria 1453
209 Ga0075428_100032307 3300006844 Bacteria 5780
210 Ga0075428_100783684 3300006844 Bacteria 1014
211 Ga0075430_100293071 3300006846 Bacteria 1346
212 Ga0075430_100500526 3300006846 Bacteria 1003
213 Ga0075431_100357244 3300006847 Bacteria 1468
214 Ga0075431_100445016 3300006847 Bacteria 1292
215 Ga0075433_10015416 3300006852 Bacteria 6268
216 Ga0075433_10122889 3300006852 Bacteria 2306
217 Ga0075433_10422915 3300006852 Bacteria 1175
218 Ga0075434_100002965 3300006871 Bacteria 15099
219 Ga0075434_100073905 3300006871 Bacteria 3402
220 Ga0075429_100044582 3300006880 Bacteria 3857
221 Ga0075429_100888466 3300006880 Bacteria 780
222 Ga0068865_100001088 3300006881 Bacteria 15661
223 Ga0068865_100244513 3300006881 Bacteria 1413
224 Ga0068865_100427726 3300006881 Bacteria 1090
225 Ga0068865_100701553 3300006881 Bacteria 865
226 Ga0075436_100115288 3300006914 Bacteria 1877
227 Ga0097620_100002675 3300006931 Bacteria 18099
228 Ga0097620_100003079 3300006931 Bacteria 16916
229 Ga0097620_100384673 3300006931 Bacteria 1499
230 Ga0075435_100187113 3300007076 Bacteria 1751
231 Ga0075435_100298766 3300007076 Bacteria 1377
232 Ga0105240_10030101 3300009093 Bacteria 7061
233 Ga0111539_10000051 3300009094 Bacteria 117607
234 Ga0111539_10000113 3300009094 Bacteria 89042
235 Ga0111539_10195787 3300009094 Bacteria 2357
236 Ga0105245_10004584 3300009098 Bacteria 12204
237 Ga0105245_10299172 3300009098 Bacteria 1578
238 Ga0105245_10649407 3300009098 Bacteria 1085
239 Ga0105247_10000214 3300009101 Bacteria 56190
240 Ga0114129_10438734 3300009147 Bacteria 1714
241 Ga0114129_10705785 3300009147 Bacteria 1296
242 Ga0114129_11218689 3300009147 Bacteria 936
243 Ga0105243_10002675 3300009148 Bacteria 14802
244 Ga0105243_10141481 3300009148 Bacteria 2053
245 Ga0105243_10432288 3300009148 Bacteria 1231
246 Ga0105243_11295237 3300009148 Bacteria 746
247 Ga0105241_10001059 3300009174 Bacteria 20968
248 Ga0105241_10003142 3300009174 Bacteria 12285
249 Ga0105241_10440638 3300009174 Bacteria 1150
250 Ga0105242_10002175 3300009176 Bacteria 15459
251 Ga0105242_10278126 3300009176 Bacteria 1519
252 Ga0105248_10002337 3300009177 Bacteria 21039
253 Ga0105248_10745226 3300009177 Bacteria 1105
254 Ga0105237_10000421 3300009545 Bacteria 60441
255 Ga0105237_10109298 3300009545 Bacteria 2757
256 Ga0105237_10111971 3300009545 Bacteria 2721
257 Ga0105237_11374424 3300009545 Bacteria 712
258 Ga0105238_10002253 3300009551 Bacteria 19442
259 Ga0105238_10009255 3300009551 Bacteria 9860
260 Ga0105249_10003184 3300009553 Bacteria 14201
261 Ga0105249_10101339 3300009553 Bacteria 2708
262 Ga0105249_10375203 3300009553 Bacteria 1447
263 Ga0105239_10004165 3300010375 Bacteria 17370
264 Ga0105239_10181133 3300010375 Bacteria 2357
265 Ga0105239_11166417 3300010375 Bacteria 887
266 Ga0105246_10010489 3300011119 Bacteria 5735
267 Ga0105246_10080455 3300011119 Bacteria 2319
268 Ga0157373_10003191 3300013100 Bacteria 12398
269 Ga0157373_10107793 3300013100 Bacteria 1959
270 Ga0157371_10000366 3300013102 Bacteria 57015
271 Ga0157371_10186076 3300013102 Bacteria 1486
272 Ga0157370_10074553 3300013104 Bacteria 3201
273 Ga0157369_10000489 3300013105 Bacteria 52511
274 Ga0157369_10027421 3300013105 Bacteria 6314
275 Ga0157369_10517017 3300013105 Bacteria 1235
276 Ga0157374_10023967 3300013296 Bacteria 5466
277 Ga0157374_10084262 3300013296 Bacteria 3021
278 Ga0157378_10001507 3300013297 Bacteria 21088
279 Ga0157378_10496427 3300013297 Bacteria 1218
280 Ga0163162_10001347 3300013306 Bacteria 22875
281 Ga0163162_10279079 3300013306 Bacteria 1803
282 Ga0157372_10003591 3300013307 Bacteria 16692
283 Ga0157372_10006794 3300013307 Bacteria 12165
284 Ga0157372_10054504 3300013307 Bacteria 4461
285 Ga0157372_10199964 3300013307 Bacteria 2315
286 Ga0157375_10002709 3300013308 Bacteria 15321
287 Ga0157375_10021538 3300013308 Bacteria 5913
288 Ga0163163_10015231 3300014325 Bacteria 7103
289 Ga0163163_10181453 3300014325 Bacteria 2152
290 Ga0157380_10153882 3300014326 Bacteria 1991
291 Ga0182008_10227273 3300014497 Bacteria 956
292 Ga0157377_10000764 3300014745 Bacteria 13292
293 Ga0157379_10000390 3300014968 Bacteria 35479
294 Ga0157379_10141398 3300014968 Bacteria 2170
295 Ga0157379_11436765 3300014968 Bacteria 669
296 Ga0157379_11520938 3300014968 Bacteria 651
297 Ga0157376_10000902 3300014969 Bacteria 19401
298 Ga0182007_10155536 3300015262 Bacteria 779
299 Ga0163161_10008932 3300017792 Bacteria 6929
300 Ga0163161_10108321 3300017792 Bacteria 2074
301 Ga0206355_1107471 3300020076 Bacteria 1368
302 Ga0206355_1701660 3300020076 Bacteria 659
303 Ga0206353_11798732 3300020082 Bacteria 641
304 Ga0154015_1082936 3300020610 Bacteria 798
305 Ga0154015_1692643 3300020610 Bacteria 1324
306 Ga0213876_10040137 3300021384 Bacteria 2472
307 Ga0213876_10376992 3300021384 Bacteria 754
308 Ga0224712_10201100 3300022467 Bacteria 906
309 Ga0207697_10000203 3300025315 Bacteria 31820
310 Ga0207656_10001939 3300025321 Bacteria 6876
311 Ga0207653_10003686 3300025885 Bacteria 4816
312 Ga0207682_10000257 3300025893 Bacteria 23951
313 Ga0207642_10000606 3300025899 Bacteria 11035
314 Ga0207710_10002096 3300025900 Bacteria 9437
315 Ga0207688_10003903 3300025901 Bacteria 8131
316 Ga0207688_10022445 3300025901 Bacteria 3453
317 Ga0207680_10002283 3300025903 Bacteria 8938
318 Ga0207647_10000387 3300025904 Bacteria 35927
319 Ga0207647_10345783 3300025904 Bacteria 842
320 Ga0207645_10000400 3300025907 Bacteria 35898
321 Ga0207645_10000417 3300025907 Bacteria 35339
322 Ga0207645_10349998 3300025907 Bacteria 989
323 Ga0207643_10000154 3300025908 Bacteria 47376
324 Ga0207643_10003419 3300025908 Bacteria 8550
325 Ga0207705_10000646 3300025909 Bacteria 29012
326 Ga0207705_10007789 3300025909 Bacteria 7865
327 Ga0207654_10003639 3300025911 Bacteria 7775
328 Ga0207654_10031346 3300025911 Bacteria 2927
329 Ga0207707_10000116 3300025912 Bacteria 81364
330 Ga0207707_10038158 3300025912 Bacteria 4198
331 Ga0207707_10099945 3300025912 Bacteria 2535
332 Ga0207695_10112888 3300025913 Bacteria 2694
333 Ga0207671_10004205 3300025914 Bacteria 13873
334 Ga0207671_10040655 3300025914 Bacteria 3441
335 Ga0207671_10064091 3300025914 Bacteria 2732
336 Ga0207671_10152366 3300025914 Bacteria 1786
337 Ga0207660_10031723 3300025917 Bacteria 3642
338 Ga0207660_10074723 3300025917 Bacteria 2474
339 Ga0207662_10000009 3300025918 Bacteria 95358
340 Ga0207662_10004846 3300025918 Bacteria 7118
341 Ga0207662_10035306 3300025918 Bacteria 2920
342 Ga0207657_10000042 3300025919 Bacteria 118735
343 Ga0207657_10000211 3300025919 Bacteria 60392
344 Ga0207657_10003066 3300025919 Bacteria 17879
345 Ga0207649_10000987 3300025920 Bacteria 17613
346 Ga0207649_10002245 3300025920 Bacteria 10920
347 Ga0207649_10024354 3300025920 Bacteria 3517
348 Ga0207649_10168371 3300025920 Unclassified 1524
349 Ga0207652_10001356 3300025921 Bacteria 21761
350 Ga0207652_10004556 3300025921 Bacteria 11242
351 Ga0207652_10114107 3300025921 Bacteria 2398
352 Ga0207681_10002545 3300025923 Bacteria 11578
353 Ga0207681_10072461 3300025923 Bacteria 2406
354 Ga0207681_10232201 3300025923 Bacteria 1432
355 Ga0207694_10048935 3300025924 Bacteria 3271
356 Ga0207650_10001430 3300025925 Bacteria 17219
357 Ga0207650_10002578 3300025925 Bacteria 12541
358 Ga0207659_10000098 3300025926 Bacteria 51164
359 Ga0207659_10025263 3300025926 Bacteria 3989
360 Ga0207659_10171166 3300025926 Bacteria 1713
361 Ga0207687_10013393 3300025927 Bacteria 5354
362 Ga0207687_10239245 3300025927 Bacteria 1438
363 Ga0207664_10032126 3300025929 Bacteria 4022
364 Ga0207644_10002971 3300025931 Bacteria 10917
365 Ga0207644_10228371 3300025931 Bacteria 1478
366 Ga0207690_10002397 3300025932 Bacteria 11351
367 Ga0207690_10031318 3300025932 Bacteria 3402
368 Ga0207706_10000046 3300025933 Bacteria 119273
369 Ga0207706_10002411 3300025933 Bacteria 18232
370 Ga0207706_10311822 3300025933 Bacteria 1370
371 Ga0207686_10004103 3300025934 Bacteria 7815
372 Ga0207709_10009278 3300025935 Bacteria 5418
373 Ga0207709_10084060 3300025935 Bacteria 2060
374 Ga0207670_10000320 3300025936 Bacteria 28684
375 Ga0207670_10030383 3300025936 Bacteria 3452
376 Ga0207669_10006867 3300025937 Bacteria 5234
377 Ga0207669_10052790 3300025937 Bacteria 2444
378 Ga0207704_10001258 3300025938 Bacteria 11320
379 Ga0207704_10026106 3300025938 Bacteria 3200
380 Ga0207704_10527197 3300025938 Bacteria 956
381 Ga0207704_10630333 3300025938 Bacteria 881
382 Ga0207691_10000766 3300025940 Bacteria 31756
383 Ga0207691_10001566 3300025940 Bacteria 22711
384 Ga0207691_10026597 3300025940 Bacteria 5429
385 Ga0207711_10001432 3300025941 Bacteria 22337
386 Ga0207711_11086753 3300025941 Bacteria 741
387 Ga0207689_10000567 3300025942 Bacteria 35339
388 Ga0207689_10007902 3300025942 Bacteria 9291
389 Ga0207689_10011859 3300025942 Bacteria 7467
390 Ga0207689_10434195 3300025942 Bacteria 1097
391 Ga0207661_10011775 3300025944 Bacteria 6351
392 Ga0207661_10392588 3300025944 Bacteria 1257
393 Ga0207679_10000634 3300025945 Bacteria 23441
394 Ga0207679_10000752 3300025945 Bacteria 21525
395 Ga0207667_10000342 3300025949 Bacteria 63745
396 Ga0207667_10009926 3300025949 Bacteria 11168
397 Ga0207667_10050604 3300025949 Bacteria 4383
398 Ga0207667_10742763 3300025949 Bacteria 981
399 Ga0207651_10000279 3300025960 Bacteria 21913
400 Ga0207651_10156436 3300025960 Bacteria 1781
401 Ga0207712_10001071 3300025961 Bacteria 19150
402 Ga0207668_10009462 3300025972 Bacteria 5843
403 Ga0207668_10204056 3300025972 Bacteria 1576
404 Ga0207640_10003620 3300025981 Bacteria 8341
405 Ga0207640_10398551 3300025981 Bacteria 1120
406 Ga0207658_10000501 3300025986 Bacteria 35943
407 Ga0207658_10113017 3300025986 Bacteria 2151
408 Ga0207658_10462246 3300025986 Bacteria 1125
409 Ga0207677_10000380 3300026023 Bacteria 30648
410 Ga0207677_10004667 3300026023 Bacteria 7380
411 Ga0207677_10106567 3300026023 Bacteria 2077
412 Ga0207703_10000628 3300026035 Bacteria 35533
413 Ga0207703_10072222 3300026035 Bacteria 2852
414 Ga0207703_10212740 3300026035 Bacteria 1725
415 Ga0207639_10001737 3300026041 Bacteria 14681
416 Ga0207639_10002863 3300026041 Bacteria 11590
417 Ga0207639_10006214 3300026041 Bacteria 8114
418 Ga0207678_10000501 3300026067 Bacteria 35486
419 Ga0207678_10032873 3300026067 Bacteria 4521
420 Ga0207678_10039049 3300026067 Bacteria 4121
421 Ga0207678_10105169 3300026067 Bacteria 2408
422 Ga0207708_10034182 3300026075 Bacteria 3866
423 Ga0207708_10063338 3300026075 Bacteria 2825
424 Ga0207708_10913509 3300026075 Bacteria 760
425 Ga0207702_10002217 3300026078 Bacteria 18618
426 Ga0207702_10011537 3300026078 Bacteria 7363
427 Ga0207641_10001707 3300026088 Bacteria 21354
428 Ga0207648_10000811 3300026089 Bacteria 35339
429 Ga0207648_10005284 3300026089 Bacteria 13031
430 Ga0207648_10060925 3300026089 Bacteria 3290
431 Ga0207648_10091775 3300026089 Bacteria 2655
432 Ga0207676_10000688 3300026095 Bacteria 26734
433 Ga0207676_10191058 3300026095 Bacteria 1802
434 Ga0207676_10217709 3300026095 Bacteria 1698
435 Ga0207674_10000038 3300026116 Bacteria 132350
436 Ga0207674_10000951 3300026116 Bacteria 37804
437 Ga0207674_10036269 3300026116 Bacteria 5140
438 Ga0207674_11070908 3300026116 Bacteria 775
439 Ga0207675_100000023 3300026118 Bacteria 114960
440 Ga0207675_100033947 3300026118 Bacteria 4755
441 Ga0207675_100034035 3300026118 Bacteria 4748
442 Ga0207683_10001637 3300026121 Bacteria 20061
443 Ga0207683_10463896 3300026121 Bacteria 1168
444 Ga0207698_10001393 3300026142 Bacteria 14040
445 Ga0209969_1008442 3300027360 Bacteria 1461
446 Ga0209967_1006204 3300027364 Bacteria 1617
447 Ga0209996_1013416 3300027395 Bacteria 1107
448 Ga0209995_1006777 3300027471 Bacteria 1844
449 Ga0209968_1007758 3300027526 Bacteria 1627
450 Ga0209999_1000911 3300027543 Bacteria 4965
451 Ga0209982_1023843 3300027552 Bacteria 947
452 Ga0209970_1000541 3300027614 Bacteria 6543
453 Ga0210002_1016194 3300027617 Bacteria 1179
454 Ga0209983_1000982 3300027665 Bacteria 6291
455 Ga0209971_1000037 3300027682 Bacteria 45920
456 Ga0209971_1102700 3300027682 Bacteria 700
457 Ga0209966_1000467 3300027695 Bacteria 11064
458 Ga0209998_10000042 3300027717 Bacteria 51743
459 Ga0209974_10062797 3300027876 Bacteria 1259
460 Ga0207428_10000016 3300027907 Bacteria 327690
461 Ga0207428_10001085 3300027907 Bacteria 29652
462 Ga0268266_10002035 3300028379 Bacteria 22441
463 Ga0268266_10003855 3300028379 Bacteria 14632
464 Ga0268266_10214331 3300028379 Bacteria 1767
465 Ga0268266_10544594 3300028379 Bacteria 1111
466 Ga0268265_10001348 3300028380 Bacteria 20919
467 Ga0268265_10001893 3300028380 Bacteria 16656
468 Ga0268265_10115491 3300028380 Bacteria 2200
469 Ga0268265_10162433 3300028380 Bacteria 1899
470 Ga0268264_10000191 3300028381 Bacteria 127257
471 Ga0268264_10128763 3300028381 Bacteria 2241
472 Ga0268264_10256056 3300028381 Bacteria 1628
473 Ga0265326_10075248 3300028558 Bacteria 955
474 Ga0265319_1067369 3300028563 Bacteria 1151
475 Ga0265334_10032772 3300028573 Bacteria 2070
476 Ga0265318_10000215 3300028577 Bacteria 50092
477 Ga0265338_10120405 3300028800 Bacteria 2093
478 Ga0265762_1088910 3300030760 Bacteria 671
479 Ga0265330_10005185 3300031235 Bacteria 6517
480 Ga0265332_10002290 3300031238 Bacteria 9787
481 Ga0265328_10005771 3300031239 Bacteria 5283
482 Ga0265329_10001026 3300031242 Bacteria 13928
483 Ga0265340_10076478 3300031247 Bacteria 1581
484 Ga0265339_10047348 3300031249 Bacteria 2361
485 Ga0265331_10000002 3300031250 Bacteria 511481
486 Ga0265331_10001505 3300031250 Bacteria 17195
487 Ga0265327_10000034 3300031251 Bacteria 316018
488 Ga0265316_10004776 3300031344 Bacteria 13367
489 Ga0307513_10493865 3300031456 Bacteria 942
490 Ga0265314_10001991 3300031711 Bacteria 21691
491 Ga0265314_10006841 3300031711 Bacteria 9991
492 Ga0265342_10001504 3300031712 Bacteria 21609
493 Ga0373948_0027813 3300034817 Bacteria 1122
494 Ga0373950_0000025 3300034818 Bacteria 177524
495 Ga0373923_0057529 3300035111 Bacteria 1644
496 Ga0373932_0141900 3300035112 Bacteria 818
497 Ga0373936_0054520 3300035113 Bacteria 1622
498 Ga0373941_0036806 3300035115 Bacteria 1490
499 Ga0373953_0124136 3300035117 Bacteria 1098
500 Ga0373956_0458986 3300035119 Bacteria 608
501 Ga0373957_0276681 3300035120 Bacteria 709
502 Ga0373960_0023435 3300035121 Bacteria 1662
503 Ga0373955_0097096 3300035172 Bacteria 1687
504 Ga0373961_0027993 3300035241 Bacteria 1551
505 Ga0373962_0077980 3300035242 Bacteria 1001
506 Ga0373924_0185633 3300035410 Bacteria 915
507 Ga0373931_0011793 3300035691 Bacteria 4226
508 Ga0373935_0072863 3300035692 Bacteria 2218
509 Ga0373927_0338032 3300035695 Bacteria 992
510 Ga0373933_0014104 3300035724 Bacteria 4438
511 Ga0373947_0852353 3300035725 Bacteria 622
512 Ga0373937_0015816 3300036401 Bacteria 6684
513 Ga0373925_0049098 3300037068 Bacteria 3145
514 Ga0373925_0181603 3300037068 Bacteria 1666
515 Ga0395899_0012252 3300037312 Bacteria 6567
516 Ga0395900_0201832 3300037418 Bacteria 2011
517 Ga0395900_0272983 3300037418 Bacteria 1685
518 Ga0395898_0201793 3300037466 Bacteria 1898
519 Ga0395898_0455085 3300037466 Bacteria 1219
520 Ga0436364_0027385 3300037853 Bacteria 2864
521 Ga0395901_0634719 3300038443 Bacteria 1073
522 Ga0395901_0710824 3300038443 Bacteria 1001
523 Ga0436365_1705686 3300039437 Bacteria 3434
524 Ga0436361_0841563 3300039447 Bacteria 3336
525 Ga0439448_0001809 3300042005 Bacteria 5656
526 Ga0439448_0043070 3300042005 Bacteria 1465
527 Ga0439450_004186 3300042008 Bacteria 2447
528 Ga0439455_0135580 3300042012 Bacteria 696
529 Ga0450889_004365 3300042144 Bacteria 1397
530 Ga0439458_0034276 3300042157 Bacteria 1218
531 Ga0439459_0006217 3300042438 Bacteria 1982
532 Ga0439464_0019320 3300042439 Bacteria 1859
533 Ga0451577_0019330 3300042876 Bacteria 6264
534 Ga0451577_0207056 3300042876 Bacteria 1771
535 Ga0439440_0045336 3300042993 Bacteria 1084
536 Ga0466972_0043091 3300044658 Bacteria 2192
537 Ga0466972_0237069 3300044658 Bacteria 854
538 Ga0453683_0620878 3300044673 Bacteria 706
539 Ga0466965_0014625 3300044683 Bacteria 3715
540 Ga0466963_0047382 3300044694 Bacteria 2837
541 Ga0453684_0103159 3300044712 Bacteria 3486
542 Ga0453684_0868414 3300044712 Bacteria 968
543 Ga0466968_0001698 3300044735 Bacteria 7930
544 Ga0466970_0031269 3300044765 Bacteria 2811
545 Ga0466970_0080870 3300044765 Bacteria 1756
546 Ga0466957_0051034 3300044842 Bacteria 2517
547 Ga0466960_0037474 3300044901 Bacteria 2274
548 Ga0466959_0093724 3300045049 Bacteria 2155
549 Ga0466959_0097972 3300045049 Bacteria 2100
550 Ga0451576_0017994 3300045051 Bacteria 7753
551 Ga0451576_0031917 3300045051 Bacteria 5613
552 Ga0451576_0051976 3300045051 Bacteria 4295
553 Ga0451576_0290384 3300045051 Bacteria 1710
554 Ga0451576_0333654 3300045051 Bacteria 1587
555 Ga0451576_0743057 3300045051 Bacteria 1030
556 Ga0466958_0009323 3300045836 Bacteria 5469
557 Ga0466967_0003987 3300045976 Bacteria 9832
558 Ga0466967_0015597 3300045976 Bacteria 5959
559 Ga0466967_0023877 3300045976 Bacteria 5018
560 Ga0466967_1198005 3300045976 Bacteria 757
561 Ga0495651_0014442 3300046462 Bacteria 6105
562 Ga0495653_0197680 3300046463 Bacteria 1367
563 Ga0495580_0369048 3300046472 Bacteria 971
564 Ga0495664_0555593 3300046477 Bacteria 684
565 Ga0495618_0158805 3300046514 Bacteria 1442
566 Ga0495628_0002592 3300046516 Bacteria 16251
567 Ga0495640_0135895 3300046533 Bacteria 1588
568 Ga0495586_0288129 3300046535 Bacteria 940
569 Ga0495667_0345874 3300046559 Bacteria 940
570 Ga0495635_0489579 3300046663 Bacteria 810
571 Ga0495657_0088061 3300046675 Bacteria 1997
572 Ga0495599_0088818 3300046678 Bacteria 1929
573 Ga0495589_0348009 3300046794 Bacteria 683
574 Ga0495680_0082293 3300047322 Bacteria 2429
575 Ga0495680_0210794 3300047322 Bacteria 1391
576 Ga0495675_0287673 3300047444 Bacteria 979
577 Ga0495677_0068479 3300047445 Bacteria 1321
578 Ga0495684_0050189 3300047471 Bacteria 3186
579 Ga0495684_0117350 3300047471 Bacteria 2006
580 Ga0496101_0030315 3300048904 Bacteria 3791
581 Ga0496101_0083421 3300048904 Bacteria 2366
582 Ga0496102_0005889 3300048905 Bacteria 10432
583 Ga0496102_1159349 3300048905 Bacteria 692
584 Ga0496103_0028856 3300048906 Bacteria 3370
585 Ga0496103_0218091 3300048906 Bacteria 1227
586 Ga0496103_0223942 3300048906 Bacteria 1209
587 Ga0496104_0625191 3300048907 Bacteria 986
588 Ga0496105_0741880 3300048908 Bacteria 751
589 Ga0496106_0050970 3300048909 Bacteria 3120
590 Ga0496106_0304633 3300048909 Bacteria 1278
591 Ga0496107_0010589 3300048910 Bacteria 6410
592 Ga0496108_0150013 3300048911 Bacteria 2011
593 Ga0496108_0383283 3300048911 Bacteria 1228
594 Ga0496109_0018306 3300048912 Bacteria 6152
595 Ga0496111_0034054 3300048914 Bacteria 3636
596 Ga0496112_0027679 3300048915 Bacteria 5467
597 Ga0496112_0029496 3300048915 Bacteria 5306
598 Ga0496112_0117159 3300048915 Bacteria 2634
599 Ga0496113_0014623 3300048916 Bacteria 5362
600 Ga0496114_0020911 3300048917 Bacteria 5316
601 Ga0496114_0349246 3300048917 Bacteria 1308
602 Ga0496116_0000005 3300048919 Bacteria 827804
603 Ga0496117_0034031 3300048920 Bacteria 3846
604 Ga0496118_0000435 3300048921 Bacteria 69378
605 Ga0496118_0006905 3300048921 Bacteria 12289
606 Ga0496121_0000106 3300048924 Bacteria 191065
607 Ga0496122_0068650 3300048925 Bacteria 2543
608 Ga0496123_0034157 3300048926 Bacteria 3647
609 Ga0501031_0354924 3300049568 Bacteria 949
610 Ga0501031_0613871 3300049568 Bacteria 699
611 Ga0501032_0009488 3300049569 Bacteria 7053
612 Ga0501033_0005242 3300049570 Bacteria 10291
613 Ga0501033_0061650 3300049570 Bacteria 2764
614 Ga0501033_0231920 3300049570 Bacteria 1311
615 Ga0501033_0341668 3300049570 Bacteria 1049
616 Ga0501034_0000120 3300049571 Bacteria 144382
617 Ga0501034_0015666 3300049571 Bacteria 7784
618 Ga0501036_0004223 3300049572 Bacteria 11580
619 Ga0501036_0180767 3300049572 Bacteria 1775
620 Ga0501037_0029170 3300049573 Bacteria 4076
621 Ga0501037_0401731 3300049573 Bacteria 940
622 Ga0501038_0228386 3300049574 Bacteria 1482
623 Ga0501039_0087002 3300049575 Bacteria 2434
624 Ga0501040_0026145 3300049576 Bacteria 3925
625 Ga0501040_0035104 3300049576 Bacteria 3399
626 Ga0501041_0069737 3300049577 Bacteria 2157
627 Ga0501041_0202205 3300049577 Bacteria 1245
628 Ga0501042_0014830 3300049578 Bacteria 5324
629 Ga0501043_0002110 3300049579 Bacteria 16965
630 Ga0501043_0069587 3300049579 Bacteria 2764
631 Ga0501046_0000111 3300049580 Bacteria 86335
632 Ga0501046_0001310 3300049580 Bacteria 24115
633 Ga0501046_0011358 3300049580 Bacteria 7620
634 Ga0501046_0299416 3300049580 Bacteria 1175
635 Ga0501047_0000009 3300049581 Bacteria 436619
636 Ga0501047_0033249 3300049581 Bacteria 4978
637 Ga0501047_0370681 3300049581 Bacteria 1267
638 Ga0501048_0019214 3300049582 Bacteria 5017
639 Ga0501048_0772468 3300049582 Bacteria 690
640 Ga0501068_0012880 3300049584 Bacteria 4750
641 Ga0501068_0154864 3300049584 Bacteria 1442
642 Ga0501068_0672170 3300049584 Bacteria 677
643 Ga0501069_0285871 3300049585 Bacteria 966
644 Ga0501070_0006875 3300049586 Bacteria 9677
645 Ga0501070_0570277 3300049586 Bacteria 904
646 Ga0501072_0000100 3300049588 Bacteria 64147
647 Ga0501072_0348755 3300049588 Bacteria 1175
648 Ga0501072_0500170 3300049588 Bacteria 961
649 Ga0501072_0963351 3300049588 Bacteria 666
650 Ga0501073_0005071 3300049589 Bacteria 9877
651 Ga0501074_0000690 3300049590 Bacteria 21099
652 Ga0501074_0019373 3300049590 Bacteria 4943
653 Ga0501075_0005797 3300049591 Bacteria 8451
654 Ga0501075_0048946 3300049591 Bacteria 3176
655 Ga0501076_0023360 3300049592 Bacteria 4765
656 Ga0501076_0165888 3300049592 Bacteria 1800
657 Ga0501077_0004230 3300049593 Bacteria 8675
658 Ga0501077_0023141 3300049593 Bacteria 3939
659 Ga0501077_0333711 3300049593 Bacteria 967
660 Ga0501079_0000167 3300049741 Bacteria 36490
661 Ga0501079_0009213 3300049741 Bacteria 7478
662 Ga0501079_0120373 3300049741 Bacteria 2041
663 Ga0501080_0001200 3300049742 Bacteria 21482
664 Ga0501080_0036091 3300049742 Bacteria 4615
665 Ga0501080_0580899 3300049742 Bacteria 996
666 Ga0501081_0003920 3300049743 Bacteria 9537
667 Ga0501081_0008091 3300049743 Bacteria 6824
668 Ga0501083_0013818 3300049744 Bacteria 5645
669 Ga0501083_0035659 3300049744 Bacteria 3396
670 Ga0501083_0130604 3300049744 Bacteria 1646
671 Ga0501035_0002184 3300049822 Bacteria 19411
672 Ga0501035_0127560 3300049822 Bacteria 2220
673 Ga0501035_0388899 3300049822 Bacteria 1162
674 Ga0501044_0002158 3300049823 Bacteria 22557
675 Ga0501044_1052033 3300049823 Bacteria 684
676 Ga0501045_0001431 3300049824 Bacteria 15911
677 nmdc:mga03683_76337_c1 3300050489 Bacteria 1440
678 nmdc:mga03n38_31019_c1 3300050490 Bacteria 2252
679 nmdc:mga00v17_8676_c1 3300050491 Bacteria 5476
680 nmdc:mga0k408_13095_c1 3300050493 Bacteria 4543
681 nmdc:mga0k408_3429_c1 3300050493 Bacteria 8394
682 nmdc:mga06z11_428_c1 3300050494 Bacteria 15736
683 nmdc:mga07m45_17916_c1 3300050496 Bacteria 3811
684 nmdc:mga05p37_1194185_c1 3300050507 Bacteria 787
685 nmdc:mga05p37_618393_c1 3300050507 Bacteria 1219
686 nmdc:mga09592_27473_c1 3300050508 Bacteria 4722
687 nmdc:mga09592_364404_c1 3300050508 Bacteria 1250
688 nmdc:mga06r32_781890_c1 3300050510 Bacteria 916
689 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
690 nmdc:mga08y16_453066_c1 3300050511 Bacteria 1308
691 nmdc:mga08y16_654_c1 3300050511 Bacteria 32535
692 nmdc:mga08y16_903215_c1 3300050511 Bacteria 869
693 nmdc:mga0n895_2177_c1 3300050512 Bacteria 15160
694 nmdc:mga0n895_391108_c1 3300050512 Bacteria 1407
695 nmdc:mga0n895_849977_c1 3300050512 Bacteria 900
696 nmdc:mga0rr50_265684_c1 3300050513 Bacteria 1429
697 nmdc:mga0rr50_8989_c1 3300050513 Bacteria 6250
698 nmdc:mga08x19_62727_c1 3300050514 Bacteria 2410
699 nmdc:mga0a205_100895_c1 3300050515 Bacteria 2785
700 nmdc:mga0a205_437481_c1 3300050515 Bacteria 1169
701 Ga0495619_0082753 3300053085 Bacteria 2164
702 Ga0500642_0026960 3300053130 Bacteria 2352
703 Ga0500604_0153887 3300053151 Bacteria 782
704 Ga0501084_0000006 3300054114 Bacteria 234041
705 Ga0501084_0014397 3300054114 Bacteria 6554
706 Ga0501084_0039803 3300054114 Bacteria 3931
707 Ga0590071_110180 3300059421 Bacteria 698
708 Ga0501082_0001204 3300060353 Bacteria 22740
709 Ga0501082_0002810 3300060353 Bacteria 15194
710 Ga0501082_0437047 3300060353 Bacteria 1143
711 Ga0466962_0044770 3300061719 Bacteria 2117
712 Ga0530510_0087791 3300061734 Bacteria 2266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0580899 Ga0501080_0580899_449_985 168
2 iso_pu_bacteria 2909399089 2909400872 173
3 3300048919 Ga0496116_0000005 Ga0496116_0000005_162606_163136 176
4 3300048924 Ga0496121_0000106 Ga0496121_0000106_153316_153846 176
5 3300006178 Ga0075367_10085476 Ga0075367_100854763 177
6 3300050511 nmdc:mga08y16_903215_c1 nmdc:mga08y16_903215_c1_81_614 177
7 3300005438 Ga0070701_10001229 Ga0070701_100012297 178
8 3300009545 Ga0105237_10111971 Ga0105237_101119712 178
9 3300021384 Ga0213876_10040137 Ga0213876_100401373 178
10 3300025914 Ga0207671_10040655 Ga0207671_100406553 178
11 3300027552 Ga0209982_1023843 Ga0209982_10238431 178
12 3300039437 Ga0436365_1705686 Ga0436365_1705686_894_1430 178
13 3300045976 Ga0466967_1198005 Ga0466967_1198005_72_608 178
14 3300001990 JGI24737J22298_10144013 JGI24737J22298_101440131 179
15 3300002076 JGI24749J21850_1002430 JGI24749J21850_10024303 179
16 3300005290 Ga0065712_10381837 Ga0065712_103818371 179
17 3300005293 Ga0065715_10226977 Ga0065715_102269771 179
18 3300005295 Ga0065707_10492885 Ga0065707_104928851 179
19 3300005328 Ga0070676_10002103 Ga0070676_100021039 179
20 3300005330 Ga0070690_100028478 Ga0070690_1000284783 179
21 3300005331 Ga0070670_100002019 Ga0070670_10000201912 179
22 3300005333 Ga0070677_10113431 Ga0070677_101134312 179
23 3300005334 Ga0068869_100004382 Ga0068869_1000043829 179
24 3300005334 Ga0068869_100108759 Ga0068869_1001087593 179
25 3300005334 Ga0068869_100292735 Ga0068869_1002927351 179
26 3300005336 Ga0070680_100000934 Ga0070680_1000009343 179
27 3300005336 Ga0070680_100274735 Ga0070680_1002747352 179
28 3300005337 Ga0070682_100001571 Ga0070682_1000015719 179
29 3300005337 Ga0070682_100154508 Ga0070682_1001545082 179
30 3300005338 Ga0068868_100010020 Ga0068868_1000100206 179
31 3300005338 Ga0068868_100784478 Ga0068868_1007844781 179
32 3300005339 Ga0070660_100001191 Ga0070660_10000119113 179
33 3300005339 Ga0070660_100007940 Ga0070660_1000079402 179
34 3300005340 Ga0070689_100039657 Ga0070689_1000396573 179
35 3300005341 Ga0070691_10037989 Ga0070691_100379892 179
36 3300005341 Ga0070691_10119544 Ga0070691_101195441 179
37 3300005343 Ga0070687_100000770 Ga0070687_1000007703 179
38 3300005343 Ga0070687_100001392 Ga0070687_1000013922 179
39 3300005344 Ga0070661_100000211 Ga0070661_10000021127 179
40 3300005345 Ga0070692_10007574 Ga0070692_100075742 179
41 3300005345 Ga0070692_10112657 Ga0070692_101126572 179
42 3300005347 Ga0070668_100202560 Ga0070668_1002025602 179
43 3300005353 Ga0070669_100041543 Ga0070669_1000415433 179
44 3300005353 Ga0070669_100647768 Ga0070669_1006477682 179
45 3300005354 Ga0070675_100278641 Ga0070675_1002786411 179
46 3300005355 Ga0070671_100194044 Ga0070671_1001940443 179
47 3300005356 Ga0070674_100101462 Ga0070674_1001014622 179
48 3300005364 Ga0070673_100200515 Ga0070673_1002005152 179
49 3300005365 Ga0070688_100246443 Ga0070688_1002464432 179
50 3300005366 Ga0070659_100003620 Ga0070659_10000362011 179
51 3300005366 Ga0070659_100148596 Ga0070659_1001485962 179
52 3300005367 Ga0070667_100046041 Ga0070667_1000460413 179
53 3300005406 Ga0070703_10004864 Ga0070703_100048644 179
54 3300005438 Ga0070701_10306127 Ga0070701_103061271 179
55 3300005440 Ga0070705_100001410 Ga0070705_10000141013 179
56 3300005440 Ga0070705_100699836 Ga0070705_1006998362 179
57 3300005441 Ga0070700_100099047 Ga0070700_1000990471 179
58 3300005444 Ga0070694_100001526 Ga0070694_10000152613 179
59 3300005444 Ga0070694_100013510 Ga0070694_1000135104 179
60 3300005444 Ga0070694_100649895 Ga0070694_1006498952 179
61 3300005455 Ga0070663_100002478 Ga0070663_1000024783 179
62 3300005455 Ga0070663_100006656 Ga0070663_1000066563 179
63 3300005457 Ga0070662_100002397 Ga0070662_1000023973 179
64 3300005457 Ga0070662_100433428 Ga0070662_1004334282 179
65 3300005458 Ga0070681_10038653 Ga0070681_100386534 179
66 3300005458 Ga0070681_10045796 Ga0070681_100457963 179
67 3300005459 Ga0068867_100003605 Ga0068867_1000036053 179
68 3300005459 Ga0068867_100304281 Ga0068867_1003042812 179
69 3300005466 Ga0070685_10071828 Ga0070685_100718283 179
70 3300005530 Ga0070679_100004586 Ga0070679_1000045869 179
71 3300005539 Ga0068853_100000678 Ga0068853_1000006783 179
72 3300005539 Ga0068853_100015285 Ga0068853_1000152857 179
73 3300005543 Ga0070672_100094015 Ga0070672_1000940153 179
74 3300005544 Ga0070686_100079797 Ga0070686_1000797973 179
75 3300005545 Ga0070695_100002767 Ga0070695_1000027675 179
76 3300005545 Ga0070695_100006632 Ga0070695_1000066327 179
77 3300005545 Ga0070695_100571999 Ga0070695_1005719992 179
78 3300005545 Ga0070695_100938605 Ga0070695_1009386051 179
79 3300005546 Ga0070696_100000966 Ga0070696_1000009668 179
80 3300005546 Ga0070696_100077905 Ga0070696_1000779052 179
81 3300005546 Ga0070696_100098102 Ga0070696_1000981023 179
82 3300005546 Ga0070696_100177819 Ga0070696_1001778191 179
83 3300005546 Ga0070696_100480334 Ga0070696_1004803341 179
84 3300005547 Ga0070693_100000189 Ga0070693_1000001892 179
85 3300005547 Ga0070693_100233190 Ga0070693_1002331902 179
86 3300005548 Ga0070665_100003284 Ga0070665_10000328415 179
87 3300005548 Ga0070665_101232498 Ga0070665_1012324982 179
88 3300005549 Ga0070704_100009072 Ga0070704_1000090721 179
89 3300005549 Ga0070704_100410663 Ga0070704_1004106632 179
90 3300005563 Ga0068855_100002802 Ga0068855_10000280218 179
91 3300005563 Ga0068855_100028396 Ga0068855_1000283966 179
92 3300005563 Ga0068855_100035134 Ga0068855_10003513410 179
93 3300005564 Ga0070664_100166635 Ga0070664_1001666353 179
94 3300005577 Ga0068857_100040946 Ga0068857_1000409464 179
95 3300005577 Ga0068857_100091502 Ga0068857_1000915023 179
96 3300005578 Ga0068854_100001086 Ga0068854_10000108612 179
97 3300005578 Ga0068854_101142575 Ga0068854_1011425751 179
98 3300005614 Ga0068856_100002994 Ga0068856_10000299414 179
99 3300005614 Ga0068856_100157604 Ga0068856_1001576042 179
100 3300005615 Ga0070702_100021060 Ga0070702_1000210603 179
101 3300005615 Ga0070702_100075675 Ga0070702_1000756752 179
102 3300005617 Ga0068859_100002675 Ga0068859_10000267511 179
103 3300005617 Ga0068859_100384713 Ga0068859_1003847132 179
104 3300005718 Ga0068866_10191990 Ga0068866_101919901 179
105 3300005719 Ga0068861_100000584 Ga0068861_10000058410 179
106 3300005719 Ga0068861_100105148 Ga0068861_1001051484 179
107 3300005840 Ga0068870_10000367 Ga0068870_1000036712 179
108 3300005840 Ga0068870_10315981 Ga0068870_103159812 179
109 3300005841 Ga0068863_100066613 Ga0068863_1000666133 179
110 3300005841 Ga0068863_100245054 Ga0068863_1002450542 179
111 3300005842 Ga0068858_100016416 Ga0068858_1000164169 179
112 3300005842 Ga0068858_100162578 Ga0068858_1001625782 179
113 3300005843 Ga0068860_100019733 Ga0068860_1000197333 179
114 3300005843 Ga0068860_100154301 Ga0068860_1001543013 179
115 3300005844 Ga0068862_100000487 Ga0068862_10000048730 179
116 3300005844 Ga0068862_100157301 Ga0068862_1001573013 179
117 3300005937 Ga0081455_10000868 Ga0081455_1000086831 179
118 3300005983 Ga0081540_1112142 Ga0081540_11121421 179
119 3300006028 Ga0070717_10042387 Ga0070717_100423874 179
120 3300006038 Ga0075365_10153119 Ga0075365_101531192 179
121 3300006048 Ga0075363_100028486 Ga0075363_1000284863 179
122 3300006051 Ga0075364_10006228 Ga0075364_100062284 179
123 3300006177 Ga0075362_10002673 Ga0075362_100026734 179
124 3300006178 Ga0075367_10002794 Ga0075367_100027943 179
125 3300006195 Ga0075366_10000211 Ga0075366_1000021116 179
126 3300006237 Ga0097621_100009977 Ga0097621_1000099774 179
127 3300006237 Ga0097621_100234458 Ga0097621_1002344582 179
128 3300006353 Ga0075370_10029135 Ga0075370_100291352 179
129 3300006358 Ga0068871_100282167 Ga0068871_1002821672 179
130 3300006844 Ga0075428_100032307 Ga0075428_1000323075 179
131 3300006844 Ga0075428_100783684 Ga0075428_1007836842 179
132 3300006846 Ga0075430_100293071 Ga0075430_1002930712 179
133 3300006846 Ga0075430_100500526 Ga0075430_1005005261 179
134 3300006847 Ga0075431_100357244 Ga0075431_1003572442 179
135 3300006847 Ga0075431_100445016 Ga0075431_1004450162 179
136 3300006852 Ga0075433_10015416 Ga0075433_100154162 179
137 3300006852 Ga0075433_10122889 Ga0075433_101228892 179
138 3300006852 Ga0075433_10422915 Ga0075433_104229152 179
139 3300006871 Ga0075434_100002965 Ga0075434_10000296513 179
140 3300006871 Ga0075434_100073905 Ga0075434_1000739053 179
141 3300006880 Ga0075429_100044582 Ga0075429_1000445823 179
142 3300006880 Ga0075429_100888466 Ga0075429_1008884662 179
143 3300006881 Ga0068865_100244513 Ga0068865_1002445132 179
144 3300006881 Ga0068865_100427726 Ga0068865_1004277262 179
145 3300006881 Ga0068865_100701553 Ga0068865_1007015531 179
146 3300006914 Ga0075436_100115288 Ga0075436_1001152882 179
147 3300006931 Ga0097620_100002675 Ga0097620_10000267512 179
148 3300006931 Ga0097620_100384673 Ga0097620_1003846732 179
149 3300007076 Ga0075435_100187113 Ga0075435_1001871132 179
150 3300007076 Ga0075435_100298766 Ga0075435_1002987662 179
151 3300009094 Ga0111539_10000051 Ga0111539_1000005139 179
152 3300009094 Ga0111539_10000113 Ga0111539_1000011346 179
153 3300009094 Ga0111539_10195787 Ga0111539_101957872 179
154 3300009098 Ga0105245_10299172 Ga0105245_102991722 179
155 3300009147 Ga0114129_10438734 Ga0114129_104387342 179
156 3300009147 Ga0114129_10705785 Ga0114129_107057851 179
157 3300009147 Ga0114129_11218689 Ga0114129_112186891 179
158 3300009148 Ga0105243_10141481 Ga0105243_101414812 179
159 3300009148 Ga0105243_10432288 Ga0105243_104322881 179
160 3300009148 Ga0105243_11295237 Ga0105243_112952371 179
161 3300009174 Ga0105241_10003142 Ga0105241_1000314214 179
162 3300009174 Ga0105241_10440638 Ga0105241_104406382 179
163 3300009176 Ga0105242_10278126 Ga0105242_102781263 179
164 3300009177 Ga0105248_10745226 Ga0105248_107452262 179
165 3300009545 Ga0105237_10109298 Ga0105237_101092984 179
166 3300009545 Ga0105237_11374424 Ga0105237_113744241 179
167 3300009551 Ga0105238_10009255 Ga0105238_100092553 179
168 3300009553 Ga0105249_10101339 Ga0105249_101013392 179
169 3300009553 Ga0105249_10375203 Ga0105249_103752032 179
170 3300010375 Ga0105239_10181133 Ga0105239_101811332 179
171 3300010375 Ga0105239_11166417 Ga0105239_111664172 179
172 3300011119 Ga0105246_10080455 Ga0105246_100804553 179
173 3300013100 Ga0157373_10003191 Ga0157373_1000319112 179
174 3300013102 Ga0157371_10186076 Ga0157371_101860762 179
175 3300013104 Ga0157370_10074553 Ga0157370_100745533 179
176 3300013105 Ga0157369_10027421 Ga0157369_100274213 179
177 3300013105 Ga0157369_10517017 Ga0157369_105170172 179
178 3300013296 Ga0157374_10084262 Ga0157374_100842623 179
179 3300013297 Ga0157378_10496427 Ga0157378_104964272 179
180 3300013306 Ga0163162_10279079 Ga0163162_102790792 179
181 3300013307 Ga0157372_10006794 Ga0157372_100067948 179
182 3300013307 Ga0157372_10054504 Ga0157372_100545041 179
183 3300013307 Ga0157372_10199964 Ga0157372_101999643 179
184 3300013308 Ga0157375_10021538 Ga0157375_100215384 179
185 3300014325 Ga0163163_10181453 Ga0163163_101814532 179
186 3300014968 Ga0157379_10141398 Ga0157379_101413983 179
187 3300014968 Ga0157379_11436765 Ga0157379_114367651 179
188 3300014968 Ga0157379_11520938 Ga0157379_115209381 179
189 3300015262 Ga0182007_10155536 Ga0182007_101555362 179
190 3300017792 Ga0163161_10108321 Ga0163161_101083213 179
191 3300020082 Ga0206353_11798732 Ga0206353_117987321 179
192 3300022467 Ga0224712_10201100 Ga0224712_102011002 179
193 3300025885 Ga0207653_10003686 Ga0207653_100036863 179
194 3300025901 Ga0207688_10022445 Ga0207688_100224454 179
195 3300025904 Ga0207647_10345783 Ga0207647_103457831 179
196 3300025907 Ga0207645_10000400 Ga0207645_1000040038 179
197 3300025907 Ga0207645_10349998 Ga0207645_103499982 179
198 3300025908 Ga0207643_10003419 Ga0207643_100034192 179
199 3300025909 Ga0207705_10000646 Ga0207705_1000064619 179
200 3300025911 Ga0207654_10031346 Ga0207654_100313462 179
201 3300025912 Ga0207707_10000116 Ga0207707_1000011654 179
202 3300025912 Ga0207707_10038158 Ga0207707_100381583 179
203 3300025912 Ga0207707_10099945 Ga0207707_100999451 179
204 3300025914 Ga0207671_10064091 Ga0207671_100640914 179
205 3300025914 Ga0207671_10152366 Ga0207671_101523661 179
206 3300025917 Ga0207660_10074723 Ga0207660_100747233 179
207 3300025918 Ga0207662_10004846 Ga0207662_100048467 179
208 3300025918 Ga0207662_10035306 Ga0207662_100353062 179
209 3300025919 Ga0207657_10000211 Ga0207657_100002119 179
210 3300025919 Ga0207657_10003066 Ga0207657_1000306617 179
211 3300025920 Ga0207649_10024354 Ga0207649_100243542 179
212 3300025920 Ga0207649_10168371 Ga0207649_101683712 179
213 3300025921 Ga0207652_10001356 Ga0207652_100013569 179
214 3300025921 Ga0207652_10004556 Ga0207652_1000455616 179
215 3300025923 Ga0207681_10072461 Ga0207681_100724613 179
216 3300025923 Ga0207681_10232201 Ga0207681_102322012 179
217 3300025924 Ga0207694_10048935 Ga0207694_100489355 179
218 3300025925 Ga0207650_10002578 Ga0207650_100025782 179
219 3300025926 Ga0207659_10025263 Ga0207659_100252636 179
220 3300025926 Ga0207659_10171166 Ga0207659_101711661 179
221 3300025927 Ga0207687_10239245 Ga0207687_102392452 179
222 3300025931 Ga0207644_10228371 Ga0207644_102283713 179
223 3300025932 Ga0207690_10031318 Ga0207690_100313183 179
224 3300025933 Ga0207706_10002411 Ga0207706_100024113 179
225 3300025933 Ga0207706_10311822 Ga0207706_103118221 179
226 3300025935 Ga0207709_10084060 Ga0207709_100840603 179
227 3300025936 Ga0207670_10030383 Ga0207670_100303833 179
228 3300025937 Ga0207669_10052790 Ga0207669_100527903 179
229 3300025938 Ga0207704_10026106 Ga0207704_100261063 179
230 3300025938 Ga0207704_10527197 Ga0207704_105271972 179
231 3300025938 Ga0207704_10630333 Ga0207704_106303332 179
232 3300025940 Ga0207691_10001566 Ga0207691_100015664 179
233 3300025940 Ga0207691_10026597 Ga0207691_100265975 179
234 3300025941 Ga0207711_11086753 Ga0207711_110867531 179
235 3300025942 Ga0207689_10007902 Ga0207689_100079022 179
236 3300025942 Ga0207689_10011859 Ga0207689_100118593 179
237 3300025942 Ga0207689_10434195 Ga0207689_104341951 179
238 3300025945 Ga0207679_10000634 Ga0207679_100006343 179
239 3300025949 Ga0207667_10000342 Ga0207667_1000034227 179
240 3300025949 Ga0207667_10050604 Ga0207667_100506043 179
241 3300025949 Ga0207667_10742763 Ga0207667_107427633 179
242 3300025960 Ga0207651_10156436 Ga0207651_101564362 179
243 3300025972 Ga0207668_10204056 Ga0207668_102040562 179
244 3300025981 Ga0207640_10398551 Ga0207640_103985513 179
245 3300025986 Ga0207658_10113017 Ga0207658_101130172 179
246 3300025986 Ga0207658_10462246 Ga0207658_104622462 179
247 3300026023 Ga0207677_10004667 Ga0207677_100046674 179
248 3300026023 Ga0207677_10106567 Ga0207677_101065672 179
249 3300026035 Ga0207703_10072222 Ga0207703_100722223 179
250 3300026035 Ga0207703_10212740 Ga0207703_102127402 179
251 3300026041 Ga0207639_10001737 Ga0207639_1000173715 179
252 3300026041 Ga0207639_10006214 Ga0207639_100062149 179
253 3300026067 Ga0207678_10000501 Ga0207678_1000050136 179
254 3300026067 Ga0207678_10032873 Ga0207678_100328733 179
255 3300026067 Ga0207678_10105169 Ga0207678_101051691 179
256 3300026075 Ga0207708_10063338 Ga0207708_100633383 179
257 3300026075 Ga0207708_10913509 Ga0207708_109135091 179
258 3300026078 Ga0207702_10002217 Ga0207702_100022172 179
259 3300026089 Ga0207648_10005284 Ga0207648_1000528413 179
260 3300026089 Ga0207648_10060925 Ga0207648_100609255 179
261 3300026089 Ga0207648_10091775 Ga0207648_100917753 179
262 3300026095 Ga0207676_10191058 Ga0207676_101910583 179
263 3300026095 Ga0207676_10217709 Ga0207676_102177092 179
264 3300026116 Ga0207674_10000951 Ga0207674_1000095136 179
265 3300026116 Ga0207674_10036269 Ga0207674_100362693 179
266 3300026116 Ga0207674_11070908 Ga0207674_110709081 179
267 3300026118 Ga0207675_100033947 Ga0207675_1000339473 179
268 3300026118 Ga0207675_100034035 Ga0207675_1000340353 179
269 3300026121 Ga0207683_10463896 Ga0207683_104638962 179
270 3300027360 Ga0209969_1008442 Ga0209969_10084422 179
271 3300027364 Ga0209967_1006204 Ga0209967_10062042 179
272 3300027395 Ga0209996_1013416 Ga0209996_10134162 179
273 3300027471 Ga0209995_1006777 Ga0209995_10067772 179
274 3300027526 Ga0209968_1007758 Ga0209968_10077582 179
275 3300027543 Ga0209999_1000911 Ga0209999_10009112 179
276 3300027614 Ga0209970_1000541 Ga0209970_10005413 179
277 3300027617 Ga0210002_1016194 Ga0210002_10161942 179
278 3300027665 Ga0209983_1000982 Ga0209983_10009822 179
279 3300027682 Ga0209971_1000037 Ga0209971_100003713 179
280 3300027682 Ga0209971_1102700 Ga0209971_11027001 179
281 3300027695 Ga0209966_1000467 Ga0209966_10004678 179
282 3300027717 Ga0209998_10000042 Ga0209998_1000004243 179
283 3300027876 Ga0209974_10062797 Ga0209974_100627972 179
284 3300027907 Ga0207428_10000016 Ga0207428_1000001614 179
285 3300027907 Ga0207428_10001085 Ga0207428_1000108516 179
286 3300028379 Ga0268266_10003855 Ga0268266_1000385511 179
287 3300028379 Ga0268266_10214331 Ga0268266_102143311 179
288 3300028379 Ga0268266_10544594 Ga0268266_105445942 179
289 3300028380 Ga0268265_10001893 Ga0268265_1000189317 179
290 3300028380 Ga0268265_10115491 Ga0268265_101154913 179
291 3300028380 Ga0268265_10162433 Ga0268265_101624332 179
292 3300028381 Ga0268264_10128763 Ga0268264_101287633 179
293 3300028381 Ga0268264_10256056 Ga0268264_102560561 179
294 3300028558 Ga0265326_10075248 Ga0265326_100752481 179
295 3300028563 Ga0265319_1067369 Ga0265319_10673692 179
296 3300028573 Ga0265334_10032772 Ga0265334_100327722 179
297 3300028577 Ga0265318_10000215 Ga0265318_1000021540 179
298 3300028800 Ga0265338_10120405 Ga0265338_101204052 179
299 3300030760 Ga0265762_1088910 Ga0265762_10889101 179
300 3300031235 Ga0265330_10005185 Ga0265330_100051856 179
301 3300031238 Ga0265332_10002290 Ga0265332_100022908 179
302 3300031239 Ga0265328_10005771 Ga0265328_100057714 179
303 3300031242 Ga0265329_10001026 Ga0265329_100010264 179
304 3300031247 Ga0265340_10076478 Ga0265340_100764782 179
305 3300031249 Ga0265339_10047348 Ga0265339_100473482 179
306 3300031250 Ga0265331_10001505 Ga0265331_100015058 179
307 3300031344 Ga0265316_10004776 Ga0265316_100047769 179
308 3300031456 Ga0307513_10493865 Ga0307513_104938652 179
309 3300031711 Ga0265314_10001991 Ga0265314_100019919 179
310 3300031712 Ga0265342_10001504 Ga0265342_1000150420 179
311 3300034817 Ga0373948_0027813 Ga0373948_0027813_418_957 179
312 3300034818 Ga0373950_0000025 Ga0373950_0000025_64531_65070 179
313 3300035111 Ga0373923_0057529 Ga0373923_0057529_1019_1573 179
314 3300035112 Ga0373932_0141900 Ga0373932_0141900_142_681 179
315 3300035113 Ga0373936_0054520 Ga0373936_0054520_940_1494 179
316 3300035115 Ga0373941_0036806 Ga0373941_0036806_60_599 179
317 3300035117 Ga0373953_0124136 Ga0373953_0124136_205_759 179
318 3300035119 Ga0373956_0458986 Ga0373956_0458986_13_552 179
319 3300035120 Ga0373957_0276681 Ga0373957_0276681_132_686 179
320 3300035121 Ga0373960_0023435 Ga0373960_0023435_832_1371 179
321 3300035172 Ga0373955_0097096 Ga0373955_0097096_651_1205 179
322 3300035241 Ga0373961_0027993 Ga0373961_0027993_595_1134 179
323 3300035242 Ga0373962_0077980 Ga0373962_0077980_44_583 179
324 3300035410 Ga0373924_0185633 Ga0373924_0185633_259_813 179
325 3300035691 Ga0373931_0011793 Ga0373931_0011793_128_667 179
326 3300035692 Ga0373935_0072863 Ga0373935_0072863_640_1194 179
327 3300035695 Ga0373927_0338032 Ga0373927_0338032_207_761 179
328 3300035724 Ga0373933_0014104 Ga0373933_0014104_2179_2733 179
329 3300035725 Ga0373947_0852353 Ga0373947_0852353_58_597 179
330 3300036401 Ga0373937_0015816 Ga0373937_0015816_1170_1724 179
331 3300037068 Ga0373925_0049098 Ga0373925_0049098_747_1301 179
332 3300037312 Ga0395899_0012252 Ga0395899_0012252_5401_5949 179
333 3300037418 Ga0395900_0201832 Ga0395900_0201832_541_1089 179
334 3300037418 Ga0395900_0272983 Ga0395900_0272983_562_1110 179
335 3300037466 Ga0395898_0201793 Ga0395898_0201793_756_1304 179
336 3300037466 Ga0395898_0455085 Ga0395898_0455085_302_841 179
337 3300038443 Ga0395901_0634719 Ga0395901_0634719_64_603 179
338 3300038443 Ga0395901_0710824 Ga0395901_0710824_41_589 179
339 3300039447 Ga0436361_0841563 Ga0436361_0841563_2359_2913 179
340 3300042005 Ga0439448_0001809 Ga0439448_0001809_2795_3334 179
341 3300042008 Ga0439450_004186 Ga0439450_004186_719_1258 179
342 3300042144 Ga0450889_004365 Ga0450889_004365_174_713 179
343 3300042157 Ga0439458_0034276 Ga0439458_0034276_550_1089 179
344 3300042438 Ga0439459_0006217 Ga0439459_0006217_729_1268 179
345 3300042439 Ga0439464_0019320 Ga0439464_0019320_189_728 179
346 3300042876 Ga0451577_0019330 Ga0451577_0019330_5332_5871 179
347 3300042993 Ga0439440_0045336 Ga0439440_0045336_219_758 179
348 3300044673 Ga0453683_0620878 Ga0453683_0620878_110_649 179
349 3300044712 Ga0453684_0103159 Ga0453684_0103159_418_957 179
350 3300045049 Ga0466959_0093724 Ga0466959_0093724_821_1360 179
351 3300045051 Ga0451576_0017994 Ga0451576_0017994_5456_5995 179
352 3300045051 Ga0451576_0031917 Ga0451576_0031917_4929_5468 179
353 3300045051 Ga0451576_0051976 Ga0451576_0051976_1823_2362 179
354 3300045051 Ga0451576_0333654 Ga0451576_0333654_873_1412 179
355 3300045051 Ga0451576_0743057 Ga0451576_0743057_272_811 179
356 3300046462 Ga0495651_0014442 Ga0495651_0014442_3722_4276 179
357 3300046463 Ga0495653_0197680 Ga0495653_0197680_253_792 179
358 3300046472 Ga0495580_0369048 Ga0495580_0369048_11_550 179
359 3300046477 Ga0495664_0555593 Ga0495664_0555593_37_576 179
360 3300046514 Ga0495618_0158805 Ga0495618_0158805_472_1026 179
361 3300046516 Ga0495628_0002592 Ga0495628_0002592_5847_6386 179
362 3300046533 Ga0495640_0135895 Ga0495640_0135895_939_1493 179
363 3300046535 Ga0495586_0288129 Ga0495586_0288129_168_722 179
364 3300046559 Ga0495667_0345874 Ga0495667_0345874_210_749 179
365 3300046663 Ga0495635_0489579 Ga0495635_0489579_47_601 179
366 3300046675 Ga0495657_0088061 Ga0495657_0088061_772_1326 179
367 3300046678 Ga0495599_0088818 Ga0495599_0088818_261_815 179
368 3300046794 Ga0495589_0348009 Ga0495589_0348009_67_606 179
369 3300047322 Ga0495680_0082293 Ga0495680_0082293_1170_1724 179
370 3300047322 Ga0495680_0210794 Ga0495680_0210794_247_786 179
371 3300047444 Ga0495675_0287673 Ga0495675_0287673_402_956 179
372 3300047445 Ga0495677_0068479 Ga0495677_0068479_503_1042 179
373 3300047471 Ga0495684_0050189 Ga0495684_0050189_573_1112 179
374 3300047471 Ga0495684_0117350 Ga0495684_0117350_503_1057 179
375 3300048905 Ga0496102_1159349 Ga0496102_1159349_43_582 179
376 3300048906 Ga0496103_0218091 Ga0496103_0218091_597_1139 179
377 3300048906 Ga0496103_0223942 Ga0496103_0223942_572_1111 179
378 3300048909 Ga0496106_0304633 Ga0496106_0304633_513_1052 179
379 3300048911 Ga0496108_0383283 Ga0496108_0383283_67_606 179
380 3300048915 Ga0496112_0117159 Ga0496112_0117159_1369_1908 179
381 3300048917 Ga0496114_0020911 Ga0496114_0020911_1193_1732 179
382 3300048920 Ga0496117_0034031 Ga0496117_0034031_823_1365 179
383 3300048921 Ga0496118_0000435 Ga0496118_0000435_37387_37929 179
384 3300048921 Ga0496118_0006905 Ga0496118_0006905_7471_8013 179
385 3300049568 Ga0501031_0613871 Ga0501031_0613871_143_682 179
386 3300049570 Ga0501033_0061650 Ga0501033_0061650_502_1041 179
387 3300049570 Ga0501033_0231920 Ga0501033_0231920_609_1148 179
388 3300049570 Ga0501033_0341668 Ga0501033_0341668_154_693 179
389 3300049571 Ga0501034_0000120 Ga0501034_0000120_117132_117671 179
390 3300049572 Ga0501036_0004223 Ga0501036_0004223_4743_5282 179
391 3300049573 Ga0501037_0401731 Ga0501037_0401731_170_709 179
392 3300049574 Ga0501038_0228386 Ga0501038_0228386_376_915 179
393 3300049575 Ga0501039_0087002 Ga0501039_0087002_596_1135 179
394 3300049576 Ga0501040_0026145 Ga0501040_0026145_3304_3843 179
395 3300049576 Ga0501040_0035104 Ga0501040_0035104_47_586 179
396 3300049577 Ga0501041_0069737 Ga0501041_0069737_1606_2145 179
397 3300049577 Ga0501041_0202205 Ga0501041_0202205_91_630 179
398 3300049578 Ga0501042_0014830 Ga0501042_0014830_3212_3751 179
399 3300049579 Ga0501043_0002110 Ga0501043_0002110_6670_7209 179
400 3300049580 Ga0501046_0000111 Ga0501046_0000111_6911_7450 179
401 3300049580 Ga0501046_0001310 Ga0501046_0001310_20377_20916 179
402 3300049580 Ga0501046_0299416 Ga0501046_0299416_538_1077 179
403 3300049581 Ga0501047_0000009 Ga0501047_0000009_220889_221428 179
404 3300049581 Ga0501047_0033249 Ga0501047_0033249_4233_4772 179
405 3300049582 Ga0501048_0772468 Ga0501048_0772468_31_570 179
406 3300049584 Ga0501068_0012880 Ga0501068_0012880_505_1044 179
407 3300049584 Ga0501068_0154864 Ga0501068_0154864_608_1147 179
408 3300049584 Ga0501068_0672170 Ga0501068_0672170_94_633 179
409 3300049586 Ga0501070_0570277 Ga0501070_0570277_23_562 179
410 3300049588 Ga0501072_0000100 Ga0501072_0000100_6787_7326 179
411 3300049588 Ga0501072_0348755 Ga0501072_0348755_230_769 179
412 3300049588 Ga0501072_0500170 Ga0501072_0500170_50_589 179
413 3300049588 Ga0501072_0963351 Ga0501072_0963351_66_635 179
414 3300049589 Ga0501073_0005071 Ga0501073_0005071_5199_5738 179
415 3300049590 Ga0501074_0000690 Ga0501074_0000690_14568_15107 179
416 3300049590 Ga0501074_0019373 Ga0501074_0019373_256_795 179
417 3300049591 Ga0501075_0005797 Ga0501075_0005797_5431_5970 179
418 3300049591 Ga0501075_0048946 Ga0501075_0048946_2294_2833 179
419 3300049592 Ga0501076_0023360 Ga0501076_0023360_37_576 179
420 3300049592 Ga0501076_0165888 Ga0501076_0165888_782_1321 179
421 3300049593 Ga0501077_0004230 Ga0501077_0004230_3560_4099 179
422 3300049593 Ga0501077_0023141 Ga0501077_0023141_1104_1643 179
423 3300049593 Ga0501077_0333711 Ga0501077_0333711_257_796 179
424 3300049741 Ga0501079_0000167 Ga0501079_0000167_11980_12519 179
425 3300049741 Ga0501079_0009213 Ga0501079_0009213_4651_5190 179
426 3300049741 Ga0501079_0120373 Ga0501079_0120373_1359_1898 179
427 3300049742 Ga0501080_0001200 Ga0501080_0001200_11852_12391 179
428 3300049742 Ga0501080_0036091 Ga0501080_0036091_727_1266 179
429 3300049743 Ga0501081_0003920 Ga0501081_0003920_2340_2879 179
430 3300049743 Ga0501081_0008091 Ga0501081_0008091_4950_5489 179
431 3300049744 Ga0501083_0013818 Ga0501083_0013818_449_988 179
432 3300049744 Ga0501083_0035659 Ga0501083_0035659_1108_1647 179
433 3300049744 Ga0501083_0130604 Ga0501083_0130604_1018_1557 179
434 3300049822 Ga0501035_0127560 Ga0501035_0127560_1655_2194 179
435 3300049822 Ga0501035_0388899 Ga0501035_0388899_28_567 179
436 3300049823 Ga0501044_1052033 Ga0501044_1052033_110_649 179
437 3300049824 Ga0501045_0001431 Ga0501045_0001431_2251_2790 179
438 3300050489 nmdc:mga03683_76337_c1 nmdc:mga03683_76337_c1_881_1420 179
439 3300050490 nmdc:mga03n38_31019_c1 nmdc:mga03n38_31019_c1_1077_1616 179
440 3300050491 nmdc:mga00v17_8676_c1 nmdc:mga00v17_8676_c1_4034_4573 179
441 3300050493 nmdc:mga0k408_13095_c1 nmdc:mga0k408_13095_c1_281_820 179
442 3300050493 nmdc:mga0k408_3429_c1 nmdc:mga0k408_3429_c1_5387_5926 179
443 3300050494 nmdc:mga06z11_428_c1 nmdc:mga06z11_428_c1_2837_3376 179
444 3300050496 nmdc:mga07m45_17916_c1 nmdc:mga07m45_17916_c1_1054_1593 179
445 3300050507 nmdc:mga05p37_1194185_c1 nmdc:mga05p37_1194185_c1_33_572 179
446 3300050507 nmdc:mga05p37_618393_c1 nmdc:mga05p37_618393_c1_381_920 179
447 3300050508 nmdc:mga09592_27473_c1 nmdc:mga09592_27473_c1_3441_3980 179
448 3300050508 nmdc:mga09592_364404_c1 nmdc:mga09592_364404_c1_652_1191 179
449 3300050510 nmdc:mga06r32_781890_c1 nmdc:mga06r32_781890_c1_299_838 179
450 3300050511 nmdc:mga08y16_26_c1 nmdc:mga08y16_26_c1_209605_210144 179
451 3300050511 nmdc:mga08y16_453066_c1 nmdc:mga08y16_453066_c1_448_987 179
452 3300050511 nmdc:mga08y16_654_c1 nmdc:mga08y16_654_c1_21045_21584 179
453 3300050512 nmdc:mga0n895_2177_c1 nmdc:mga0n895_2177_c1_9889_10428 179
454 3300050512 nmdc:mga0n895_391108_c1 nmdc:mga0n895_391108_c1_12_551 179
455 3300050513 nmdc:mga0rr50_265684_c1 nmdc:mga0rr50_265684_c1_383_922 179
456 3300050513 nmdc:mga0rr50_8989_c1 nmdc:mga0rr50_8989_c1_5602_6141 179
457 3300050514 nmdc:mga08x19_62727_c1 nmdc:mga08x19_62727_c1_1002_1541 179
458 3300050515 nmdc:mga0a205_100895_c1 nmdc:mga0a205_100895_c1_515_1054 179
459 3300050515 nmdc:mga0a205_437481_c1 nmdc:mga0a205_437481_c1_123_662 179
460 3300053085 Ga0495619_0082753 Ga0495619_0082753_394_948 179
461 3300053130 Ga0500642_0026960 Ga0500642_0026960_632_1171 179
462 3300053151 Ga0500604_0153887 Ga0500604_0153887_90_629 179
463 3300054114 Ga0501084_0000006 Ga0501084_0000006_220889_221428 179
464 3300054114 Ga0501084_0014397 Ga0501084_0014397_2820_3359 179
465 3300054114 Ga0501084_0039803 Ga0501084_0039803_2451_2990 179
466 3300060353 Ga0501082_0001204 Ga0501082_0001204_3199_3738 179
467 3300060353 Ga0501082_0002810 Ga0501082_0002810_14629_15168 179
468 3300060353 Ga0501082_0437047 Ga0501082_0437047_268_807 179
469 3300061734 Ga0530510_0087791 Ga0530510_0087791_1318_1857 179
470 3300003203 JGI25406J46586_10060768 JGI25406J46586_100607682 180
471 3300005985 Ga0081539_10002700 Ga0081539_1000270014 180
472 3300031250 Ga0265331_10000002 Ga0265331_10000002400 180
473 3300031711 Ga0265314_10006841 Ga0265314_100068413 180
474 3300059421 Ga0590071_110180 Ga0590071_110180_11_553 180
475 iso_pu_bacteria 2894772417 2894774504 180
476 3300044765 Ga0466970_0080870 Ga0466970_0080870_525_1106 182
477 3300005435 Ga0070714_100416854 Ga0070714_1004168541 183
478 3300020076 Ga0206355_1107471 Ga0206355_11074711 183
479 3300020610 Ga0154015_1692643 Ga0154015_16926432 183
480 3300021384 Ga0213876_10376992 Ga0213876_103769921 183
481 3300025929 Ga0207664_10032126 Ga0207664_100321263 183
482 3300031251 Ga0265327_10000034 Ga0265327_10000034238 183
483 3300037853 Ga0436364_0027385 Ga0436364_0027385_271_858 183
484 3300044658 Ga0466972_0043091 Ga0466972_0043091_1025_1612 183
485 3300044683 Ga0466965_0014625 Ga0466965_0014625_2240_2827 183
486 3300044694 Ga0466963_0047382 Ga0466963_0047382_1725_2312 183
487 3300044735 Ga0466968_0001698 Ga0466968_0001698_7042_7629 183
488 3300044765 Ga0466970_0031269 Ga0466970_0031269_1545_2132 183
489 3300044842 Ga0466957_0051034 Ga0466957_0051034_906_1493 183
490 3300044901 Ga0466960_0037474 Ga0466960_0037474_886_1473 183
491 3300045049 Ga0466959_0097972 Ga0466959_0097972_725_1312 183
492 3300045836 Ga0466958_0009323 Ga0466958_0009323_1356_1943 183
493 3300045976 Ga0466967_0003987 Ga0466967_0003987_9232_9819 183
494 3300045976 Ga0466967_0015597 Ga0466967_0015597_623_1210 183
495 3300045976 Ga0466967_0023877 Ga0466967_0023877_3666_4253 183
496 3300048904 Ga0496101_0030315 Ga0496101_0030315_2836_3423 183
497 3300048915 Ga0496112_0029496 Ga0496112_0029496_4277_4864 183
498 3300048916 Ga0496113_0014623 Ga0496113_0014623_4732_5319 183
499 3300048925 Ga0496122_0068650 Ga0496122_0068650_1011_1598 183
500 3300048926 Ga0496123_0034157 Ga0496123_0034157_1581_2168 183
501 3300049568 Ga0501031_0354924 Ga0501031_0354924_56_643 183
502 3300049569 Ga0501032_0009488 Ga0501032_0009488_592_1179 183
503 3300049570 Ga0501033_0005242 Ga0501033_0005242_6852_7439 183
504 3300049571 Ga0501034_0015666 Ga0501034_0015666_3882_4469 183
505 3300049572 Ga0501036_0180767 Ga0501036_0180767_358_945 183
506 3300049573 Ga0501037_0029170 Ga0501037_0029170_29_616 183
507 3300049579 Ga0501043_0069587 Ga0501043_0069587_408_995 183
508 3300049580 Ga0501046_0011358 Ga0501046_0011358_6925_7512 183
509 3300049581 Ga0501047_0370681 Ga0501047_0370681_210_797 183
510 3300049582 Ga0501048_0019214 Ga0501048_0019214_3891_4478 183
511 3300049585 Ga0501069_0285871 Ga0501069_0285871_54_641 183
512 3300049586 Ga0501070_0006875 Ga0501070_0006875_690_1277 183
513 3300049822 Ga0501035_0002184 Ga0501035_0002184_10686_11273 183
514 3300049823 Ga0501044_0002158 Ga0501044_0002158_18977_19564 183
515 3300061719 Ga0466962_0044770 Ga0466962_0044770_335_922 183
516 3300001976 JGI24752J21851_1005792 JGI24752J21851_10057921 184
517 3300001991 JGI24743J22301_10001991 JGI24743J22301_100019913 184
518 3300002073 JGI24745J21846_1014103 JGI24745J21846_10141031 184
519 3300002074 JGI24748J21848_1016011 JGI24748J21848_10160111 184
520 3300002126 JGI24035J26624_1009783 JGI24035J26624_10097831 184
521 3300002239 JGI24034J26672_10011564 JGI24034J26672_100115642 184
522 3300002244 JGI24742J22300_10035873 JGI24742J22300_100358731 184
523 3300002459 JGI24751J29686_10005412 JGI24751J29686_100054123 184
524 3300003308 Ga0006777J48905_1011873 Ga0006777J48905_10118731 184
525 3300003544 Ga0007417J51691_1004037 Ga0007417J51691_10040371 184
526 3300003559 Ga0007427J51700_107763 Ga0007427J51700_1077631 184
527 3300003568 Ga0006781J51513_1013523 Ga0006781J51513_10135231 184
528 3300003575 Ga0007409J51694_1004929 Ga0007409J51694_10049291 184
529 3300003579 Ga0007429J51699_1008412 Ga0007429J51699_10084121 184
530 3300003611 Ga0007411J51799_103535 Ga0007411J51799_1035351 184
531 3300003613 Ga0007415J51800_105198 Ga0007415J51800_1051981 184
532 3300003659 JGI25404J52841_10009935 JGI25404J52841_100099352 184
533 3300003693 Ga0032354_1014034 Ga0032354_10140341 184
534 3300005289 Ga0065704_10260902 Ga0065704_102609022 184
535 3300005293 Ga0065715_10094138 Ga0065715_100941384 184
536 3300005295 Ga0065707_10307848 Ga0065707_103078482 184
537 3300005327 Ga0070658_10002993 Ga0070658_100029934 184
538 3300005328 Ga0070676_10000714 Ga0070676_1000071415 184
539 3300005329 Ga0070683_100001881 Ga0070683_10000188114 184
540 3300005329 Ga0070683_100462577 Ga0070683_1004625771 184
541 3300005330 Ga0070690_100000665 Ga0070690_1000006653 184
542 3300005331 Ga0070670_100131259 Ga0070670_1001312592 184
543 3300005333 Ga0070677_10000828 Ga0070677_100008287 184
544 3300005334 Ga0068869_100000053 Ga0068869_10000005338 184
545 3300005335 Ga0070666_10023498 Ga0070666_100234983 184
546 3300005338 Ga0068868_100001316 Ga0068868_10000131615 184
547 3300005339 Ga0070660_100000278 Ga0070660_10000027816 184
548 3300005340 Ga0070689_100001003 Ga0070689_10000100315 184
549 3300005341 Ga0070691_10082707 Ga0070691_100827072 184
550 3300005343 Ga0070687_100000039 Ga0070687_10000003939 184
551 3300005344 Ga0070661_100001794 Ga0070661_10000179416 184
552 3300005344 Ga0070661_100010106 Ga0070661_1000101062 184
553 3300005345 Ga0070692_10002540 Ga0070692_100025401 184
554 3300005347 Ga0070668_100000995 Ga0070668_1000009955 184
555 3300005353 Ga0070669_100004018 Ga0070669_1000040188 184
556 3300005354 Ga0070675_100006048 Ga0070675_1000060483 184
557 3300005355 Ga0070671_100000390 Ga0070671_10000039015 184
558 3300005356 Ga0070674_100000407 Ga0070674_1000004074 184
559 3300005364 Ga0070673_100000457 Ga0070673_1000004574 184
560 3300005365 Ga0070688_100000451 Ga0070688_1000004517 184
561 3300005366 Ga0070659_100000275 Ga0070659_1000002752 184
562 3300005367 Ga0070667_100003961 Ga0070667_1000039612 184
563 3300005438 Ga0070701_10003621 Ga0070701_100036215 184
564 3300005440 Ga0070705_100000576 Ga0070705_1000005762 184
565 3300005441 Ga0070700_100006035 Ga0070700_1000060352 184
566 3300005455 Ga0070663_100024038 Ga0070663_1000240383 184
567 3300005456 Ga0070678_100000580 Ga0070678_1000005805 184
568 3300005457 Ga0070662_100000608 Ga0070662_1000006087 184
569 3300005459 Ga0068867_100001364 Ga0068867_1000013642 184
570 3300005466 Ga0070685_10000029 Ga0070685_1000002916 184
571 3300005535 Ga0070684_100099850 Ga0070684_1000998502 184
572 3300005539 Ga0068853_100002097 Ga0068853_10000209715 184
573 3300005543 Ga0070672_100020815 Ga0070672_1000208152 184
574 3300005544 Ga0070686_100000652 Ga0070686_1000006522 184
575 3300005545 Ga0070695_100009034 Ga0070695_1000090342 184
576 3300005546 Ga0070696_100016537 Ga0070696_1000165374 184
577 3300005547 Ga0070693_100017499 Ga0070693_1000174992 184
578 3300005548 Ga0070665_100075382 Ga0070665_1000753824 184
579 3300005549 Ga0070704_100031769 Ga0070704_1000317692 184
580 3300005563 Ga0068855_100001417 Ga0068855_10000141714 184
581 3300005564 Ga0070664_100000413 Ga0070664_10000041312 184
582 3300005564 Ga0070664_100030855 Ga0070664_1000308554 184
583 3300005577 Ga0068857_100010610 Ga0068857_1000106108 184
584 3300005578 Ga0068854_100013498 Ga0068854_1000134984 184
585 3300005614 Ga0068856_100002325 Ga0068856_10000232520 184
586 3300005615 Ga0070702_100092842 Ga0070702_1000928423 184
587 3300005616 Ga0068852_100013975 Ga0068852_1000139754 184
588 3300005617 Ga0068859_100003079 Ga0068859_10000307915 184
589 3300005618 Ga0068864_100002813 Ga0068864_1000028133 184
590 3300005718 Ga0068866_10007525 Ga0068866_100075252 184
591 3300005719 Ga0068861_100000747 Ga0068861_10000074717 184
592 3300005834 Ga0068851_10002087 Ga0068851_100020877 184
593 3300005840 Ga0068870_10000020 Ga0068870_1000002046 184
594 3300005841 Ga0068863_100057242 Ga0068863_1000572421 184
595 3300005842 Ga0068858_100045581 Ga0068858_1000455812 184
596 3300005843 Ga0068860_100093648 Ga0068860_1000936482 184
597 3300005844 Ga0068862_100032939 Ga0068862_1000329392 184
598 3300005983 Ga0081540_1000073 Ga0081540_100007398 184
599 3300005983 Ga0081540_1000209 Ga0081540_100020944 184
600 3300005983 Ga0081540_1002268 Ga0081540_10022688 184
601 3300006237 Ga0097621_100000749 Ga0097621_1000007493 184
602 3300006358 Ga0068871_100001439 Ga0068871_10000143915 184
603 3300006881 Ga0068865_100001088 Ga0068865_10000108815 184
604 3300006931 Ga0097620_100003079 Ga0097620_10000307915 184
605 3300009093 Ga0105240_10030101 Ga0105240_100301017 184
606 3300009098 Ga0105245_10004584 Ga0105245_1000458412 184
607 3300009098 Ga0105245_10649407 Ga0105245_106494071 184
608 3300009101 Ga0105247_10000214 Ga0105247_1000021422 184
609 3300009148 Ga0105243_10002675 Ga0105243_100026755 184
610 3300009174 Ga0105241_10001059 Ga0105241_100010599 184
611 3300009176 Ga0105242_10002175 Ga0105242_100021754 184
612 3300009177 Ga0105248_10002337 Ga0105248_100023372 184
613 3300009545 Ga0105237_10000421 Ga0105237_1000042140 184
614 3300009551 Ga0105238_10002253 Ga0105238_1000225315 184
615 3300009553 Ga0105249_10003184 Ga0105249_1000318412 184
616 3300010375 Ga0105239_10004165 Ga0105239_100041654 184
617 3300011119 Ga0105246_10010489 Ga0105246_100104892 184
618 3300013100 Ga0157373_10107793 Ga0157373_101077932 184
619 3300013102 Ga0157371_10000366 Ga0157371_1000036641 184
620 3300013105 Ga0157369_10000489 Ga0157369_100004893 184
621 3300013296 Ga0157374_10023967 Ga0157374_100239673 184
622 3300013297 Ga0157378_10001507 Ga0157378_1000150716 184
623 3300013306 Ga0163162_10001347 Ga0163162_1000134720 184
624 3300013307 Ga0157372_10003591 Ga0157372_100035914 184
625 3300013308 Ga0157375_10002709 Ga0157375_1000270915 184
626 3300014325 Ga0163163_10015231 Ga0163163_100152318 184
627 3300014326 Ga0157380_10153882 Ga0157380_101538822 184
628 3300014497 Ga0182008_10227273 Ga0182008_102272732 184
629 3300014745 Ga0157377_10000764 Ga0157377_100007647 184
630 3300014968 Ga0157379_10000390 Ga0157379_1000039015 184
631 3300014969 Ga0157376_10000902 Ga0157376_100009025 184
632 3300017792 Ga0163161_10008932 Ga0163161_100089327 184
633 3300020076 Ga0206355_1701660 Ga0206355_17016601 184
634 3300020610 Ga0154015_1082936 Ga0154015_10829361 184
635 3300025315 Ga0207697_10000203 Ga0207697_100002032 184
636 3300025321 Ga0207656_10001939 Ga0207656_100019394 184
637 3300025893 Ga0207682_10000257 Ga0207682_100002575 184
638 3300025899 Ga0207642_10000606 Ga0207642_1000060612 184
639 3300025900 Ga0207710_10002096 Ga0207710_100020967 184
640 3300025901 Ga0207688_10003903 Ga0207688_100039037 184
641 3300025903 Ga0207680_10002283 Ga0207680_100022833 184
642 3300025904 Ga0207647_10000387 Ga0207647_1000038715 184
643 3300025907 Ga0207645_10000417 Ga0207645_1000041714 184
644 3300025908 Ga0207643_10000154 Ga0207643_1000015440 184
645 3300025909 Ga0207705_10007789 Ga0207705_100077898 184
646 3300025911 Ga0207654_10003639 Ga0207654_100036398 184
647 3300025913 Ga0207695_10112888 Ga0207695_101128881 184
648 3300025914 Ga0207671_10004205 Ga0207671_1000420514 184
649 3300025917 Ga0207660_10031723 Ga0207660_100317233 184
650 3300025918 Ga0207662_10000009 Ga0207662_100000093 184
651 3300025919 Ga0207657_10000042 Ga0207657_1000004296 184
652 3300025920 Ga0207649_10000987 Ga0207649_100009874 184
653 3300025920 Ga0207649_10002245 Ga0207649_100022453 184
654 3300025921 Ga0207652_10114107 Ga0207652_101141072 184
655 3300025923 Ga0207681_10002545 Ga0207681_1000254512 184
656 3300025925 Ga0207650_10001430 Ga0207650_100014302 184
657 3300025926 Ga0207659_10000098 Ga0207659_1000009840 184
658 3300025927 Ga0207687_10013393 Ga0207687_100133935 184
659 3300025931 Ga0207644_10002971 Ga0207644_100029718 184
660 3300025932 Ga0207690_10002397 Ga0207690_1000239711 184
661 3300025933 Ga0207706_10000046 Ga0207706_1000004696 184
662 3300025934 Ga0207686_10004103 Ga0207686_100041032 184
663 3300025935 Ga0207709_10009278 Ga0207709_100092782 184
664 3300025936 Ga0207670_10000320 Ga0207670_1000032026 184
665 3300025937 Ga0207669_10006867 Ga0207669_100068673 184
666 3300025938 Ga0207704_10001258 Ga0207704_100012582 184
667 3300025940 Ga0207691_10000766 Ga0207691_100007664 184
668 3300025941 Ga0207711_10001432 Ga0207711_1000143220 184
669 3300025942 Ga0207689_10000567 Ga0207689_1000056714 184
670 3300025944 Ga0207661_10011775 Ga0207661_100117754 184
671 3300025944 Ga0207661_10392588 Ga0207661_103925882 184
672 3300025945 Ga0207679_10000752 Ga0207679_100007527 184
673 3300025949 Ga0207667_10009926 Ga0207667_1000992611 184
674 3300025960 Ga0207651_10000279 Ga0207651_100002792 184
675 3300025961 Ga0207712_10001071 Ga0207712_100010714 184
676 3300025972 Ga0207668_10009462 Ga0207668_100094623 184
677 3300025981 Ga0207640_10003620 Ga0207640_100036204 184
678 3300025986 Ga0207658_10000501 Ga0207658_1000050114 184
679 3300026023 Ga0207677_10000380 Ga0207677_1000038016 184
680 3300026035 Ga0207703_10000628 Ga0207703_1000062820 184
681 3300026041 Ga0207639_10002863 Ga0207639_1000286311 184
682 3300026067 Ga0207678_10039049 Ga0207678_100390493 184
683 3300026075 Ga0207708_10034182 Ga0207708_100341822 184
684 3300026078 Ga0207702_10011537 Ga0207702_100115372 184
685 3300026088 Ga0207641_10001707 Ga0207641_100017077 184
686 3300026089 Ga0207648_10000811 Ga0207648_1000081120 184
687 3300026095 Ga0207676_10000688 Ga0207676_1000068814 184
688 3300026116 Ga0207674_10000038 Ga0207674_1000003860 184
689 3300026118 Ga0207675_100000023 Ga0207675_1000000235 184
690 3300026121 Ga0207683_10001637 Ga0207683_1000163720 184
691 3300026142 Ga0207698_10001393 Ga0207698_100013934 184
692 3300028379 Ga0268266_10002035 Ga0268266_100020354 184
693 3300028380 Ga0268265_10001348 Ga0268265_100013482 184
694 3300028381 Ga0268264_10000191 Ga0268264_1000019127 184
695 3300037068 Ga0373925_0181603 Ga0373925_0181603_966_1520 184
696 3300042005 Ga0439448_0043070 Ga0439448_0043070_100_654 184
697 3300042012 Ga0439455_0135580 Ga0439455_0135580_31_585 184
698 3300042876 Ga0451577_0207056 Ga0451577_0207056_71_625 184
699 3300044658 Ga0466972_0237069 Ga0466972_0237069_138_692 184
700 3300044712 Ga0453684_0868414 Ga0453684_0868414_259_813 184
701 3300045051 Ga0451576_0290384 Ga0451576_0290384_711_1265 184
702 3300048904 Ga0496101_0083421 Ga0496101_0083421_812_1366 184
703 3300048905 Ga0496102_0005889 Ga0496102_0005889_7868_8422 184
704 3300048906 Ga0496103_0028856 Ga0496103_0028856_1761_2315 184
705 3300048907 Ga0496104_0625191 Ga0496104_0625191_323_877 184
706 3300048908 Ga0496105_0741880 Ga0496105_0741880_67_621 184
707 3300048909 Ga0496106_0050970 Ga0496106_0050970_1189_1743 184
708 3300048910 Ga0496107_0010589 Ga0496107_0010589_1606_2160 184
709 3300048911 Ga0496108_0150013 Ga0496108_0150013_279_833 184
710 3300048912 Ga0496109_0018306 Ga0496109_0018306_451_1005 184
711 3300048914 Ga0496111_0034054 Ga0496111_0034054_2375_2929 184
712 3300048915 Ga0496112_0027679 Ga0496112_0027679_1377_1931 184
713 3300048917 Ga0496114_0349246 Ga0496114_0349246_558_1112 184
714 3300050512 nmdc:mga0n895_849977_c1 nmdc:mga0n895_849977_c1_146_700 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

38

172

0.98

PF08534

Redoxin

Redoxin

37

190

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xts-assembly2.cif.gz_T salmonella typhimurium ahpc t43a mutant 0.9385 4 162
3emp-assembly1.cif.gz_D-2 crystal structure of the s-acetanilide modified form of c165s ahpc 0.9319 4 161
4xs1-assembly1.cif.gz_D-2 salmonella typhimurium ahpc t43v mutant 0.9313 2 161
6e0f-assembly1.cif.gz_J mitochondrial peroxiredoxin from leishmania infantum in complex with unfolding client protein after heat stress 0.931 1 161
4ql7-assembly1.cif.gz_D-2 crystal structure of c-terminus truncated alkylhydroperoxide reductase subunit c (ahpc1-172) from e. coli 0.9279 1 160
ID Description Score Start End Superfamily
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9391 2 184 3.40.30.10
2bmxC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9345 1 160 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9292 2 184 3.40.30.10
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9189 1 174 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9114 1 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A521TV92-F1-model_v4 Peroxiredoxin 0.9908 1 176 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A4P5VZT6-F1-model_v4 Alkyl hydroperoxide reductase 0.9904 1 176 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A4Q6BRM0-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9884 1 176 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2B4R3Y6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) 0.9872 53 176 GO:0005829
GO:0006979
GO:0008379
GO:0018580
GO:0033554
GO:0042744
GO:0045454
AF-A0A651FDP7-F1-model_v4 Peroxiredoxin 0.9868 1 176 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
91.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map