F476819

General Info

Members Datasets Scaffolds Average Seq Length
712 423 604 206

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100001426|Ga0070665_1000014263
Length 238
Sequence MWTKPKCLAPSRSRVSGDRLNYRDISENHQKVNVLSKRLDSKHKIDRRLGVNLWGRAKSPINRREYGPGQHGQRRKKPSDYGTQLMAKQKLKGYYGNIGERQFRRYYDEASRRKGDTSENMIELLERRLDTIVYRMKFVPTVFAARQFVSHGHVKLNGKRVTIPSISVKDGDVIELRDKVKELAIVLIAVDSGERDVPDYIDVDHKAMKGTFVRGPKLPDVPYPVQMEPHLVVEFYSR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
12 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
13 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
14 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
15 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
16 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
17 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
18 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
19 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
20 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
21 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
22 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
23 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
24 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
25 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
26 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
27 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
28 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
29 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
30 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
31 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
32 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
33 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
34 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
35 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
36 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
37 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
38 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
39 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
40 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
41 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
42 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
43 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
44 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
45 2922368715
46 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
47 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
48 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
49 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
50 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
51 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
52 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
53 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
54 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
55 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
56 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
57 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
58 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
59 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
60 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
61 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
62 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
63 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
64 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
65 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
66 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
67 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
68 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
69 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
70 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
71 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
72 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
73 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
74 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
75 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
76 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
77 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
78 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
79 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
80 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
81 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
82 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
83 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
84 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
85 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
86 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
87 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
88 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
89 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
90 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
91 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
92 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
93 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
94 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
95 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
96 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
98 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
100 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
101 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
102 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
103 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
104 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
105 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
106 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
107 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
108 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
109 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
110 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
111 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
113 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
114 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
118 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
119 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
120 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
121 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
122 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
123 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
124 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
125 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
126 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
127 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
128 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
129 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
130 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
131 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
132 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
133 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
134 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
135 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
136 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
137 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
138 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
139 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
140 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
141 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
142 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
143 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
144 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
145 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
148 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
149 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
150 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
153 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
154 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
157 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
158 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
159 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
160 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
161 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
162 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
163 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
164 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
165 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
166 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
167 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
168 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
169 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
170 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
171 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
172 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
174 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
175 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
176 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
177 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
178 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
179 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
180 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
181 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
182 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
183 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
184 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
185 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
186 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
187 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
188 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
189 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
190 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
191 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
192 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
193 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
194 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
195 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
196 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
197 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
198 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
199 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
200 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
201 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
207 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
208 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
211 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
212 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
213 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
214 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
215 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
216 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
269 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
270 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
272 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
273 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
276 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
277 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
278 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
279 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
280 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
283 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
284 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
285 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
286 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
289 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
290 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
291 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
292 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
293 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
313 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
314 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
333 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
346 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
347 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
393 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
394 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
399 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
410 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
411 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
412 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
413 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
414 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
415 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
416 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
417 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
418 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
419 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
420 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
421 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
422 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
423 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.32
Metatranscriptomes 5.63
Isolates 15.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 12.22
Rhizoplane 0.84
Rhizosphere 75.56
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10089789 3300001989 Bacteria 936
2 JGI25159J45721_1028911 3300002987 Bacteria 920
3 Ga0006759J45824_1013627 3300003163 Bacteria 718
4 JGI25151J46595_10000321 3300003187 Bacteria 51966
5 JGI25406J46586_10075867 3300003203 Bacteria 1042
6 JGI25153J46596_10026799 3300003215 Bacteria 2033
7 rootH1_10196287 3300003316 Bacteria 1109
8 rootL2_10030863 3300003322 Bacteria 3651
9 JGI25160J50197_1009503 3300003354 Bacteria 3600
10 Ga0007417J51691_1007909 3300003544 Bacteria 729
11 Ga0007427J51700_106633 3300003559 Bacteria 733
12 Ga0006781J51513_1006864 3300003568 Bacteria 729
13 Ga0007410J51695_1007683 3300003574 Bacteria 728
14 Ga0007409J51694_1009683 3300003575 Bacteria 729
15 Ga0007416J51690_1010630 3300003577 Bacteria 727
16 Ga0007429J51699_1006425 3300003579 Bacteria 736
17 Ga0007429J51699_1016869 3300003579 Bacteria 725
18 Ga0007411J51799_108223 3300003611 Bacteria 729
19 Ga0032354_1003564 3300003693 Bacteria 729
20 Ga0006780_1000822 3300003735 Bacteria 729
21 Ga0058859_11729389 3300004798 Bacteria 678
22 Ga0058863_11741356 3300004799 Bacteria 751
23 Ga0058861_11962574 3300004800 Bacteria 774
24 Ga0058862_12787350 3300004803 Bacteria 845
25 Ga0070658_10005063 3300005327 Bacteria 10729
26 Ga0070670_100223883 3300005331 Bacteria 1637
27 Ga0070670_100444683 3300005331 Bacteria 1148
28 Ga0070680_100006823 3300005336 Bacteria 8702
29 Ga0070680_100231599 3300005336 Bacteria 1560
30 Ga0070680_100236729 3300005336 Bacteria 1543
31 Ga0070680_100504805 3300005336 Bacteria 1035
32 Ga0068868_100057272 3300005338 Bacteria 3079
33 Ga0070660_100173845 3300005339 Bacteria 1741
34 Ga0070691_10074318 3300005341 Bacteria 1654
35 Ga0070661_100049069 3300005344 Bacteria 3091
36 Ga0070661_100658782 3300005344 Bacteria 850
37 Ga0070671_100058811 3300005355 Bacteria 3199
38 Ga0070671_100139744 3300005355 Bacteria 2044
39 Ga0070674_100014625 3300005356 Bacteria 4883
40 Ga0070688_100203439 3300005365 Bacteria 1386
41 Ga0070709_10083542 3300005434 Bacteria 2089
42 Ga0070709_10585260 3300005434 Unclassified 858
43 Ga0070714_100000109 3300005435 Bacteria 68971
44 Ga0070714_100053722 3300005435 Bacteria 3440
45 Ga0070714_100125190 3300005435 Bacteria 2291
46 Ga0070714_100204564 3300005435 Bacteria 1807
47 Ga0070714_100881694 3300005435 Bacteria 868
48 Ga0070714_100900979 3300005435 Bacteria 859
49 Ga0070713_100003647 3300005436 Bacteria 10188
50 Ga0070713_100009862 3300005436 Bacteria 6869
51 Ga0070713_100081654 3300005436 Bacteria 2759
52 Ga0070713_100864901 3300005436 Bacteria 868
53 Ga0070713_101150857 3300005436 Bacteria 750
54 Ga0070713_101218906 3300005436 Bacteria 728
55 Ga0070710_10012410 3300005437 Bacteria 4231
56 Ga0070710_10018319 3300005437 Bacteria 3601
57 Ga0070710_10065125 3300005437 Bacteria 2087
58 Ga0070710_10313858 3300005437 Bacteria 1027
59 Ga0070711_100008458 3300005439 Bacteria 6303
60 Ga0070711_100026740 3300005439 Bacteria 3784
61 Ga0070711_100129600 3300005439 Bacteria 1877
62 Ga0070711_100440784 3300005439 Bacteria 1065
63 Ga0070700_100060273 3300005441 Bacteria 2391
64 Ga0070708_100045787 3300005445 Bacteria 3857
65 Ga0070708_100333786 3300005445 Bacteria 1429
66 Ga0070708_100400331 3300005445 Bacteria 1294
67 Ga0070708_101069620 3300005445 Bacteria 756
68 Ga0070678_100009064 3300005456 Bacteria 5999
69 Ga0070678_100222884 3300005456 Bacteria 1568
70 Ga0070681_10009482 3300005458 Bacteria 9580
71 Ga0070681_10010966 3300005458 Bacteria 8962
72 Ga0070681_10038254 3300005458 Bacteria 4810
73 Ga0070681_10082512 3300005458 Bacteria 3170
74 Ga0070681_10218318 3300005458 Bacteria 1822
75 Ga0070681_10364739 3300005458 Bacteria 1355
76 Ga0070681_10603751 3300005458 Bacteria 1012
77 Ga0070706_100428236 3300005467 Bacteria 1231
78 Ga0070706_101025644 3300005467 Bacteria 760
79 Ga0070707_100067654 3300005468 Bacteria 3437
80 Ga0070698_100009525 3300005471 Bacteria 10401
81 Ga0070698_100009857 3300005471 Bacteria 10211
82 Ga0070698_100066659 3300005471 Bacteria 3622
83 Ga0070698_100142108 3300005471 Bacteria 2351
84 Ga0070699_100033732 3300005518 Bacteria 4423
85 Ga0070699_100293855 3300005518 Bacteria 1457
86 Ga0070679_100001570 3300005530 Bacteria 20460
87 Ga0070679_100046569 3300005530 Bacteria 4322
88 Ga0070679_100714999 3300005530 Bacteria 944
89 Ga0070684_100015453 3300005535 Bacteria 6217
90 Ga0070684_100629529 3300005535 Bacteria 998
91 Ga0070697_100145510 3300005536 Bacteria 1995
92 Ga0070697_100208960 3300005536 Bacteria 1661
93 Ga0070697_100356560 3300005536 Bacteria 1264
94 Ga0068853_100027384 3300005539 Bacteria 4789
95 Ga0068853_100027444 3300005539 Bacteria 4783
96 Ga0068853_100484974 3300005539 Bacteria 1166
97 Ga0070693_100655141 3300005547 Bacteria 764
98 Ga0070665_100001426 3300005548 Bacteria 28036
99 Ga0070665_100669652 3300005548 Bacteria 1051
100 Ga0070665_100863405 3300005548 Bacteria 918
101 Ga0068855_100055194 3300005563 Bacteria 4667
102 Ga0068855_100235756 3300005563 Bacteria 2046
103 Ga0068855_100290054 3300005563 Unclassified 1814
104 Ga0070664_100063094 3300005564 Bacteria 3159
105 Ga0068857_100024941 3300005577 Bacteria 5267
106 Ga0068857_100285705 3300005577 Bacteria 1518
107 Ga0068857_100816329 3300005577 Bacteria 891
108 Ga0068854_100089788 3300005578 Bacteria 2284
109 Ga0068856_100048767 3300005614 Bacteria 4174
110 Ga0068856_100051884 3300005614 Bacteria 4044
111 Ga0068856_100118153 3300005614 Bacteria 2652
112 Ga0068856_100404474 3300005614 Bacteria 1385
113 Ga0068856_100588586 3300005614 Bacteria 1134
114 Ga0068852_100048736 3300005616 Bacteria 3621
115 Ga0068859_101207513 3300005617 Bacteria 833
116 Ga0068851_10277963 3300005834 Bacteria 957
117 Ga0068870_10289542 3300005840 Bacteria 1030
118 Ga0068860_100080670 3300005843 Bacteria 3094
119 Ga0081455_10000434 3300005937 Bacteria 54939
120 Ga0081455_10008590 3300005937 Bacteria 10600
121 Ga0081455_10183324 3300005937 Bacteria 1583
122 Ga0081455_10392483 3300005937 Bacteria 966
123 Ga0081538_10076130 3300005981 Bacteria 1816
124 Ga0081540_1042357 3300005983 Bacteria 2349
125 Ga0081540_1149827 3300005983 Bacteria 922
126 Ga0081539_10013066 3300005985 Bacteria 6298
127 Ga0070717_10000675 3300006028 Bacteria 21977
128 Ga0070717_10090048 3300006028 Bacteria 2588
129 Ga0070717_10233523 3300006028 Bacteria 1620
130 Ga0070717_10776108 3300006028 Bacteria 871
131 Ga0075365_10083846 3300006038 Bacteria 2162
132 Ga0070715_10267458 3300006163 Bacteria 901
133 Ga0070716_100102764 3300006173 Bacteria 1756
134 Ga0070712_100028391 3300006175 Bacteria 3742
135 Ga0070712_100064734 3300006175 Bacteria 2593
136 Ga0070712_100163788 3300006175 Bacteria 1719
137 Ga0070712_100440277 3300006175 Bacteria 1083
138 Ga0075362_10002476 3300006177 Bacteria 6211
139 Ga0075362_10037714 3300006177 Bacteria 2120
140 Ga0075366_10006532 3300006195 Bacteria 6394
141 Ga0075370_10139193 3300006353 Bacteria 1418
142 Ga0068871_100556839 3300006358 Bacteria 1039
143 Ga0075431_100458226 3300006847 Bacteria 1270
144 Ga0075434_100303580 3300006871 Bacteria 1617
145 Ga0075434_100320767 3300006871 Bacteria 1570
146 Ga0075436_100190084 3300006914 Bacteria 1452
147 Ga0097620_101207258 3300006931 Bacteria 833
148 Ga0075435_100095352 3300007076 Bacteria 2460
149 Ga0099794_10080472 3300007265 Bacteria 1606
150 Ga0099794_10250257 3300007265 Bacteria 914
151 Ga0099795_10039719 3300007788 Bacteria 1667
152 Ga0099795_10043886 3300007788 Bacteria 1601
153 Ga0099795_10308681 3300007788 Bacteria 698
154 Ga0105240_10000330 3300009093 Bacteria 89049
155 Ga0105240_10000580 3300009093 Bacteria 67901
156 Ga0105240_10014265 3300009093 Bacteria 10855
157 Ga0105240_10090761 3300009093 Bacteria 3733
158 Ga0105240_10213313 3300009093 Bacteria 2254
159 Ga0105240_10224624 3300009093 Bacteria 2186
160 Ga0105240_10456714 3300009093 Bacteria 1428
161 Ga0105240_10565073 3300009093 Bacteria 1257
162 Ga0105240_10668720 3300009093 Bacteria 1136
163 Ga0111539_10497407 3300009094 Bacteria 1420
164 Ga0105245_10066311 3300009098 Bacteria 3267
165 Ga0114129_10798305 3300009147 Bacteria 1204
166 Ga0105243_10847438 3300009148 Bacteria 905
167 Ga0105241_10413912 3300009174 Bacteria 1185
168 Ga0105242_10270422 3300009176 Bacteria 1539
169 Ga0105248_10137227 3300009177 Bacteria 2759
170 Ga0105237_10105821 3300009545 Bacteria 2805
171 Ga0105238_10132022 3300009551 Bacteria 2475
172 Ga0105238_10787665 3300009551 Bacteria 966
173 Ga0105249_10391980 3300009553 Bacteria 1417
174 Ga0105033_104574 3300009986 Bacteria 1178
175 Ga0099796_10018908 3300010159 Bacteria 2079
176 Ga0105239_10148242 3300010375 Bacteria 2618
177 Ga0105239_10588478 3300010375 Bacteria 1269
178 Ga0157371_10070102 3300013102 Bacteria 2482
179 Ga0157371_10213281 3300013102 Bacteria 1386
180 Ga0157370_10005028 3300013104 Bacteria 14935
181 Ga0157370_10019229 3300013104 Bacteria 6860
182 Ga0157370_10025363 3300013104 Bacteria 5869
183 Ga0157370_10075051 3300013104 Bacteria 3189
184 Ga0157369_10160168 3300013105 Bacteria 2375
185 Ga0157374_10040559 3300013296 Bacteria 4288
186 Ga0157374_10544380 3300013296 Bacteria 1168
187 Ga0157374_10653097 3300013296 Bacteria 1064
188 Ga0157378_10218204 3300013297 Bacteria 1812
189 Ga0157378_11217626 3300013297 Bacteria 793
190 Ga0157372_11118657 3300013307 Bacteria 911
191 Ga0163163_10088190 3300014325 Bacteria 3114
192 Ga0163163_10132205 3300014325 Bacteria 2536
193 Ga0163163_10366989 3300014325 Bacteria 1497
194 Ga0163163_10403293 3300014325 Bacteria 1425
195 Ga0182008_10005670 3300014497 Bacteria 7071
196 Ga0182008_10062439 3300014497 Bacteria 1836
197 Ga0182008_10073565 3300014497 Bacteria 1681
198 Ga0157377_10368228 3300014745 Bacteria 969
199 Ga0157376_10023876 3300014969 Bacteria 4794
200 Ga0157376_10193645 3300014969 Bacteria 1866
201 Ga0163161_10962790 3300017792 Bacteria 727
202 Ga0184597_126673 3300019162 Bacteria 864
203 Ga0184595_115712 3300019166 Bacteria 768
204 Ga0184598_112434 3300019182 Bacteria 795
205 Ga0184599_106266 3300019188 Bacteria 742
206 Ga0197907_10436073 3300020069 Bacteria 1273
207 Ga0206356_11602332 3300020070 Bacteria 787
208 Ga0206355_1429787 3300020076 Bacteria 754
209 Ga0206351_10868433 3300020077 Bacteria 706
210 Ga0206352_11164371 3300020078 Bacteria 747
211 Ga0213873_10022034 3300021358 Bacteria 1505
212 Ga0213872_10000696 3300021361 Bacteria 25247
213 Ga0213872_10063159 3300021361 Bacteria 1674
214 Ga0213872_10132681 3300021361 Bacteria 1096
215 Ga0213876_10024314 3300021384 Bacteria 3197
216 Ga0213875_10000081 3300021388 Bacteria 114181
217 Ga0213875_10002212 3300021388 Bacteria 11841
218 Ga0213875_10003351 3300021388 Bacteria 9140
219 Ga0213875_10017999 3300021388 Bacteria 3409
220 Ga0213875_10082814 3300021388 Bacteria 1497
221 Ga0213871_10002467 3300021441 Bacteria 3406
222 Ga0213871_10010292 3300021441 Bacteria 2118
223 Ga0213871_10098501 3300021441 Bacteria 854
224 Ga0224712_10296943 3300022467 Bacteria 755
225 Ga0247552_101207 3300023536 Bacteria 755
226 Ga0247555_101092 3300023539 Bacteria 801
227 Ga0247554_100379 3300023547 Bacteria 1225
228 Ga0247550_100572 3300023660 Bacteria 987
229 Ga0209025_1000224 3300025294 Bacteria 133328
230 Ga0209758_1001111 3300025297 Bacteria 34637
231 Ga0207692_10049055 3300025898 Bacteria 2129
232 Ga0207692_10108437 3300025898 Bacteria 1536
233 Ga0207692_10112568 3300025898 Bacteria 1511
234 Ga0207680_10270975 3300025903 Bacteria 1177
235 Ga0207685_10311713 3300025905 Bacteria 782
236 Ga0207699_10005358 3300025906 Bacteria 6149
237 Ga0207699_10111722 3300025906 Bacteria 1752
238 Ga0207699_10264784 3300025906 Bacteria 1189
239 Ga0207705_10037180 3300025909 Bacteria 3483
240 Ga0207684_10098817 3300025910 Bacteria 2493
241 Ga0207707_10002418 3300025912 Bacteria 16797
242 Ga0207707_10010162 3300025912 Bacteria 8167
243 Ga0207707_10021504 3300025912 Bacteria 5639
244 Ga0207707_10331316 3300025912 Bacteria 1313
245 Ga0207695_10000690 3300025913 Bacteria 66191
246 Ga0207695_10002225 3300025913 Bacteria 29133
247 Ga0207695_10265920 3300025913 Bacteria 1611
248 Ga0207695_10292078 3300025913 Bacteria 1522
249 Ga0207671_10133171 3300025914 Bacteria 1909
250 Ga0207693_10001564 3300025915 Bacteria 20202
251 Ga0207693_10004020 3300025915 Bacteria 12497
252 Ga0207693_10071776 3300025915 Bacteria 2710
253 Ga0207693_10087373 3300025915 Bacteria 2443
254 Ga0207693_10121789 3300025915 Bacteria 2049
255 Ga0207693_10442644 3300025915 Bacteria 1016
256 Ga0207663_10185316 3300025916 Bacteria 1490
257 Ga0207663_10261053 3300025916 Bacteria 1279
258 Ga0207663_10282525 3300025916 Bacteria 1233
259 Ga0207663_10559096 3300025916 Bacteria 895
260 Ga0207660_10029298 3300025917 Bacteria 3774
261 Ga0207660_10122502 3300025917 Bacteria 1971
262 Ga0207660_10841770 3300025917 Bacteria 749
263 Ga0207662_10315116 3300025918 Bacteria 1043
264 Ga0207662_10329006 3300025918 Bacteria 1022
265 Ga0207657_10060068 3300025919 Bacteria 3263
266 Ga0207652_10010284 3300025921 Bacteria 7531
267 Ga0207652_10045957 3300025921 Bacteria 3724
268 Ga0207652_10163196 3300025921 Bacteria 1997
269 Ga0207646_10130656 3300025922 Bacteria 2260
270 Ga0207646_10169845 3300025922 Bacteria 1969
271 Ga0207681_10093653 3300025923 Bacteria 2151
272 Ga0207694_10001133 3300025924 Bacteria 23069
273 Ga0207650_10294643 3300025925 Bacteria 1324
274 Ga0207687_10628459 3300025927 Bacteria 907
275 Ga0207700_10193917 3300025928 Bacteria 1708
276 Ga0207700_10416491 3300025928 Bacteria 1179
277 Ga0207700_10530834 3300025928 Bacteria 1043
278 Ga0207700_10795096 3300025928 Bacteria 846
279 Ga0207700_10864868 3300025928 Bacteria 809
280 Ga0207700_11098278 3300025928 Bacteria 711
281 Ga0207664_10000469 3300025929 Bacteria 28522
282 Ga0207664_10075846 3300025929 Bacteria 2720
283 Ga0207664_10150290 3300025929 Bacteria 1978
284 Ga0207664_10267068 3300025929 Bacteria 1498
285 Ga0207664_10271330 3300025929 Bacteria 1486
286 Ga0207664_10368301 3300025929 Bacteria 1274
287 Ga0207664_10406261 3300025929 Bacteria 1212
288 Ga0207664_10556154 3300025929 Bacteria 1030
289 Ga0207664_10969780 3300025929 Bacteria 762
290 Ga0207644_10085096 3300025931 Bacteria 2345
291 Ga0207644_10200692 3300025931 Bacteria 1573
292 Ga0207644_10379240 3300025931 Bacteria 1153
293 Ga0207686_10535078 3300025934 Bacteria 914
294 Ga0207670_10149495 3300025936 Bacteria 1731
295 Ga0207669_10261132 3300025937 Bacteria 1295
296 Ga0207665_10255896 3300025939 Bacteria 1295
297 Ga0207691_10199553 3300025940 Bacteria 1742
298 Ga0207661_10052671 3300025944 Bacteria 3252
299 Ga0207661_11349310 3300025944 Bacteria 655
300 Ga0207679_10017685 3300025945 Bacteria 4760
301 Ga0207679_11211304 3300025945 Bacteria 693
302 Ga0207667_10007312 3300025949 Bacteria 13301
303 Ga0207667_10065952 3300025949 Bacteria 3775
304 Ga0207640_10057329 3300025981 Bacteria 2561
305 Ga0207640_10070109 3300025981 Bacteria 2356
306 Ga0207677_10050579 3300026023 Bacteria 2812
307 Ga0207703_10233530 3300026035 Bacteria 1650
308 Ga0207639_10009123 3300026041 Bacteria 6836
309 Ga0207678_10793541 3300026067 Bacteria 836
310 Ga0207702_10067990 3300026078 Bacteria 3060
311 Ga0207702_10092366 3300026078 Bacteria 2652
312 Ga0207702_10139820 3300026078 Bacteria 2189
313 Ga0207702_10948179 3300026078 Bacteria 853
314 Ga0207648_10444482 3300026089 Bacteria 1180
315 Ga0207676_10306403 3300026095 Bacteria 1452
316 Ga0207674_10269548 3300026116 Bacteria 1650
317 Ga0207674_10373325 3300026116 Bacteria 1378
318 Ga0207675_100896267 3300026118 Bacteria 903
319 Ga0207683_10016904 3300026121 Bacteria 6208
320 Ga0209179_1012847 3300027512 Bacteria 1512
321 Ga0209179_1014909 3300027512 Bacteria 1435
322 Ga0209179_1044509 3300027512 Bacteria 940
323 Ga0209588_1067866 3300027671 Bacteria 1152
324 Ga0268264_10056033 3300028381 Bacteria 3294
325 Ga0265338_10030246 3300028800 Bacteria 5343
326 Ga0265338_10068686 3300028800 Bacteria 3051
327 Ga0265338_10153257 3300028800 Bacteria 1788
328 Ga0310982_135131 3300029283 Bacteria 726
329 Ga0310981_1078795 3300029285 Bacteria 1326
330 Ga0265769_102505 3300030888 Bacteria 969
331 Ga0265332_10042540 3300031238 Bacteria 1964
332 Ga0265320_10145120 3300031240 Bacteria 1073
333 Ga0265331_10030442 3300031250 Bacteria 2687
334 Ga0265327_10001626 3300031251 Bacteria 27106
335 Ga0265327_10007634 3300031251 Bacteria 8288
336 Ga0265316_10181079 3300031344 Bacteria 1569
337 Ga0307408_100975967 3300031548 Bacteria 780
338 Ga0265313_10004920 3300031595 Bacteria 10009
339 Ga0265313_10183153 3300031595 Bacteria 879
340 Ga0265313_10246670 3300031595 Bacteria 729
341 Ga0265314_10017169 3300031711 Bacteria 5687
342 Ga0265314_10038253 3300031711 Bacteria 3469
343 Ga0265314_10041957 3300031711 Bacteria 3269
344 Ga0265314_10058218 3300031711 Bacteria 2649
345 Ga0307406_10238069 3300031901 Bacteria 1364
346 Ga0307407_10077620 3300031903 Bacteria 1998
347 Ga0307409_100511303 3300031995 Bacteria 1172
348 Ga0373948_0068046 3300034817 Bacteria 794
349 Ga0373929_0017915 3300035085 Bacteria 1403
350 Ga0373934_0115189 3300035086 Bacteria 1092
351 Ga0373944_0041225 3300035089 Bacteria 1428
352 Ga0373923_0015841 3300035111 Bacteria 2853
353 Ga0373923_0195262 3300035111 Bacteria 934
354 Ga0373936_0177722 3300035113 Bacteria 933
355 Ga0373945_0122282 3300035116 Bacteria 1036
356 Ga0373945_0188062 3300035116 Bacteria 853
357 Ga0373953_0003261 3300035117 Bacteria 5032
358 Ga0373953_0008351 3300035117 Bacteria 3514
359 Ga0373954_0053017 3300035118 Bacteria 1906
360 Ga0373954_0135544 3300035118 Bacteria 1200
361 Ga0373956_0101827 3300035119 Bacteria 1333
362 Ga0373956_0122694 3300035119 Bacteria 1214
363 Ga0373943_0011117 3300035170 Bacteria 4046
364 Ga0373943_0199520 3300035170 Bacteria 1107
365 Ga0373943_0432294 3300035170 Bacteria 763
366 Ga0373946_0016224 3300035171 Bacteria 2836
367 Ga0373955_0024645 3300035172 Bacteria 3079
368 Ga0373955_0072968 3300035172 Bacteria 1923
369 Ga0373955_0251431 3300035172 Bacteria 1060
370 Ga0373961_0150318 3300035241 Bacteria 793
371 Ga0373935_0122256 3300035692 Bacteria 1741
372 Ga0373935_0147915 3300035692 Bacteria 1592
373 Ga0373935_0233176 3300035692 Bacteria 1282
374 Ga0373935_0670760 3300035692 Bacteria 761
375 Ga0373927_0034688 3300035695 Bacteria 3281
376 Ga0373927_0084876 3300035695 Bacteria 2054
377 Ga0373927_0088890 3300035695 Bacteria 2006
378 Ga0373927_0145574 3300035695 Bacteria 1551
379 Ga0373933_0004435 3300035724 Bacteria 7702
380 Ga0373933_0116798 3300035724 Bacteria 1668
381 Ga0373933_0158524 3300035724 Bacteria 1436
382 Ga0373933_0194417 3300035724 Bacteria 1297
383 Ga0373947_0027624 3300035725 Bacteria 3322
384 Ga0373947_0081675 3300035725 Bacteria 2002
385 Ga0373947_0140667 3300035725 Bacteria 1548
386 Ga0373947_0241326 3300035725 Bacteria 1192
387 Ga0373947_0459410 3300035725 Bacteria 863
388 Ga0373937_0002465 3300036401 Bacteria 15386
389 Ga0373937_0017368 3300036401 Bacteria 6408
390 Ga0373937_0018071 3300036401 Bacteria 6289
391 Ga0373937_0037918 3300036401 Bacteria 4392
392 Ga0373937_0258096 3300036401 Bacteria 1643
393 Ga0373925_0080723 3300037068 Bacteria 2472
394 Ga0373925_0081164 3300037068 Bacteria 2466
395 Ga0373925_0189682 3300037068 Bacteria 1630
396 Ga0373925_0245844 3300037068 Bacteria 1434
397 Ga0373925_0538401 3300037068 Bacteria 960
398 Ga0373925_0706536 3300037068 Bacteria 831
399 Ga0395899_0007141 3300037312 Bacteria 8643
400 Ga0395900_0007046 3300037418 Bacteria 11641
401 Ga0395900_0050126 3300037418 Bacteria 4300
402 Ga0395900_0066219 3300037418 Bacteria 3713
403 Ga0395900_0200017 3300037418 Bacteria 2022
404 Ga0395898_0004350 3300037466 Bacteria 15504
405 Ga0395898_0004896 3300037466 Bacteria 14540
406 Ga0395898_0042229 3300037466 Bacteria 4500
407 Ga0395898_0514369 3300037466 Bacteria 1138
408 Ga0395905_0015055 3300037471 Bacteria 7369
409 Ga0395905_0548964 3300037471 Bacteria 1057
410 Ga0436364_0102143 3300037853 Bacteria 3594
411 Ga0436364_0143195 3300037853 Bacteria 55817
412 Ga0436364_0196111 3300037853 Bacteria 1134
413 Ga0436364_0207976 3300037853 Bacteria 3452
414 Ga0436364_0593151 3300037853 Bacteria 810
415 Ga0436364_0848167 3300037853 Bacteria 2108
416 Ga0436364_1003761 3300037853 Bacteria 814
417 Ga0436364_1069888 3300037853 Bacteria 65342
418 Ga0436364_1335623 3300037853 Bacteria 3916
419 Ga0395901_0001851 3300038443 Bacteria 21879
420 Ga0395901_0011526 3300038443 Bacteria 8957
421 Ga0395901_0072152 3300038443 Bacteria 3598
422 Ga0395901_0763822 3300038443 Bacteria 959
423 Ga0436365_0160653 3300039437 Bacteria 1222
424 Ga0436365_0406357 3300039437 Bacteria 797
425 Ga0436365_0473729 3300039437 Bacteria 2146
426 Ga0436365_1267353 3300039437 Bacteria 2831
427 Ga0436365_1510338 3300039437 Bacteria 7371
428 Ga0436365_1540036 3300039437 Bacteria 5164
429 Ga0436365_1789092 3300039437 Bacteria 909
430 Ga0436365_1835715 3300039437 Bacteria 1694
431 Ga0436360_0050291 3300039438 Bacteria 1063
432 Ga0436360_0399866 3300039438 Bacteria 6042
433 Ga0436360_0429557 3300039438 Bacteria 8132
434 Ga0436360_0490313 3300039438 Bacteria 2736
435 Ga0436360_0517823 3300039438 Bacteria 1527
436 Ga0436360_0561465 3300039438 Bacteria 3508
437 Ga0436360_0660398 3300039438 Bacteria 2397
438 Ga0436360_0759298 3300039438 Bacteria 854
439 Ga0436360_1064075 3300039438 Bacteria 967
440 Ga0436360_1222696 3300039438 Bacteria 846
441 Ga0436360_1254791 3300039438 Bacteria 675
442 Ga0436361_0085302 3300039447 Bacteria 5482
443 Ga0436361_0210296 3300039447 Bacteria 952
444 Ga0436361_0221120 3300039447 Bacteria 24197
445 Ga0436361_0450680 3300039447 Bacteria 4330
446 Ga0436361_0602217 3300039447 Bacteria 2355
447 Ga0436361_0694107 3300039447 Bacteria 1264
448 Ga0436361_0862442 3300039447 Bacteria 965
449 Ga0436361_0972347 3300039447 Bacteria 4631
450 Ga0436361_0999687 3300039447 Bacteria 1843
451 Ga0436363_0060299 3300039450 Bacteria 1981
452 Ga0436363_0523610 3300039450 Bacteria 1582
453 Ga0436363_0592968 3300039450 Bacteria 2562
454 Ga0436363_0933867 3300039450 Bacteria 1271
455 Ga0436363_1453647 3300039450 Bacteria 2026
456 Ga0436362_0289387 3300039453 Bacteria 1236
457 Ga0436362_0411021 3300039453 Bacteria 885
458 Ga0436362_0604955 3300039453 Bacteria 6949
459 Ga0436362_0630243 3300039453 Unclassified 1614
460 Ga0436362_0787739 3300039453 Bacteria 1108
461 Ga0436362_0993979 3300039453 Bacteria 7857
462 Ga0436362_1076558 3300039453 Bacteria 736
463 Ga0436362_1141189 3300039453 Bacteria 864
464 Ga0436362_1288810 3300039453 Bacteria 911
465 Ga0451800_0474877 3300041459 Bacteria 1440
466 Ga0439431_0073355 3300041997 Bacteria 915
467 Ga0466963_0396486 3300044694 Bacteria 973
468 Ga0466964_0015509 3300044706 Bacteria 2901
469 Ga0453684_0000062 3300044712 Bacteria 487590
470 Ga0453684_0000071 3300044712 Bacteria 448904
471 Ga0453684_0004682 3300044712 Bacteria 28347
472 Ga0453684_0601082 3300044712 Bacteria 1206
473 Ga0466957_0028639 3300044842 Bacteria 3317
474 Ga0466960_0075572 3300044901 Bacteria 1686
475 Ga0451576_0001200 3300045051 Bacteria 46344
476 Ga0451576_1122117 3300045051 Bacteria 823
477 Ga0466958_0219404 3300045836 Bacteria 1213
478 Ga0466958_0690280 3300045836 Bacteria 665
479 Ga0466967_0236979 3300045976 Bacteria 1739
480 Ga0466967_0461375 3300045976 Bacteria 1243
481 Ga0495592_0062600 3300046454 Bacteria 2731
482 Ga0495592_0172972 3300046454 Bacteria 1477
483 Ga0495651_0025838 3300046462 Bacteria 4572
484 Ga0495651_0077719 3300046462 Bacteria 2512
485 Ga0495653_0125725 3300046463 Bacteria 1821
486 Ga0495580_0145982 3300046472 Bacteria 1640
487 Ga0495639_0032987 3300046475 Bacteria 2311
488 Ga0495662_0035977 3300046476 Bacteria 2390
489 Ga0495664_0015798 3300046477 Bacteria 4296
490 Ga0495606_0406273 3300046507 Bacteria 708
491 Ga0495608_0014438 3300046511 Bacteria 5479
492 Ga0495608_0029236 3300046511 Bacteria 3740
493 Ga0495610_0161327 3300046512 Bacteria 947
494 Ga0495618_0198464 3300046514 Bacteria 1270
495 Ga0495628_0085120 3300046516 Bacteria 2453
496 Ga0495630_0200753 3300046517 Bacteria 1522
497 Ga0495630_0215096 3300046517 Bacteria 1467
498 Ga0495643_0210664 3300046522 Bacteria 928
499 Ga0495652_0096204 3300046529 Bacteria 2412
500 Ga0495640_0108697 3300046533 Bacteria 1814
501 Ga0495640_0372564 3300046533 Bacteria 879
502 Ga0495586_0518176 3300046535 Bacteria 688
503 Ga0495587_0001558 3300046536 Bacteria 15259
504 Ga0495587_0207877 3300046536 Bacteria 1106
505 Ga0495645_0016793 3300046543 Bacteria 5238
506 Ga0495667_0002486 3300046559 Bacteria 12315
507 Ga0495667_0011953 3300046559 Bacteria 5883
508 Ga0495667_0047410 3300046559 Bacteria 2840
509 Ga0495667_0205908 3300046559 Bacteria 1258
510 Ga0495634_0225703 3300046642 Bacteria 1154
511 Ga0495634_0334740 3300046642 Bacteria 909
512 Ga0495635_0355139 3300046663 Bacteria 977
513 Ga0495657_0046345 3300046675 Bacteria 2944
514 Ga0495657_0060463 3300046675 Bacteria 2510
515 Ga0495599_0026360 3300046678 Bacteria 3642
516 Ga0495623_0079667 3300046679 Bacteria 2029
517 Ga0495604_0060961 3300047317 Bacteria 2887
518 Ga0495674_0250619 3300047319 Bacteria 1457
519 Ga0495674_0379077 3300047319 Bacteria 1145
520 Ga0495680_0155702 3300047322 Bacteria 1663
521 Ga0495680_0250047 3300047322 Bacteria 1257
522 Ga0495675_0004906 3300047444 Bacteria 8146
523 Ga0495675_0058436 3300047444 Bacteria 2445
524 Ga0495684_0163908 3300047471 Bacteria 1657
525 Ga0495684_0275376 3300047471 Bacteria 1216
526 Ga0495602_0001212 3300048088 Bacteria 25377
527 Ga0496110_0623990 3300048913 Bacteria 977
528 Ga0496111_0055749 3300048914 Bacteria 2859
529 Ga0496112_0032394 3300048915 Bacteria 5075
530 Ga0496112_0417860 3300048915 Bacteria 1280
531 Ga0496113_0864091 3300048916 Bacteria 717
532 Ga0496121_0455049 3300048924 Bacteria 824
533 Ga0496122_0023070 3300048925 Bacteria 5504
534 Ga0496126_0013350 3300048929 Bacteria 8363
535 Ga0495682_0091435 3300049460 Bacteria 1093
536 Ga0501314_017178 3300049530 Bacteria 727
537 Ga0501034_0004819 3300049571 Bacteria 14909
538 Ga0501034_0016727 3300049571 Bacteria 7520
539 Ga0501037_0186539 3300049573 Bacteria 1470
540 Ga0501039_0565176 3300049575 Bacteria 892
541 Ga0501043_0224253 3300049579 Bacteria 1453
542 Ga0501046_0060888 3300049580 Bacteria 2953
543 Ga0501047_0041380 3300049581 Bacteria 4453
544 Ga0501047_0054183 3300049581 Bacteria 3879
545 Ga0501047_0142342 3300049581 Bacteria 2276
546 Ga0501047_0217249 3300049581 Bacteria 1769
547 Ga0501068_0385104 3300049584 Bacteria 903
548 Ga0501069_0152429 3300049585 Bacteria 1329
549 Ga0501069_0256089 3300049585 Bacteria 1021
550 Ga0501070_0056424 3300049586 Bacteria 3256
551 Ga0501070_0119097 3300049586 Bacteria 2182
552 Ga0501070_0293642 3300049586 Bacteria 1325
553 Ga0501071_0578014 3300049587 Bacteria 863
554 Ga0501072_0424530 3300049588 Bacteria 1054
555 Ga0501074_0243881 3300049590 Bacteria 1278
556 Ga0501076_0017711 3300049592 Bacteria 5417
557 Ga0501079_0085561 3300049741 Bacteria 2440
558 Ga0501080_0088499 3300049742 Bacteria 2877
559 Ga0501080_0263175 3300049742 Bacteria 1571
560 Ga0501083_0042062 3300049744 Bacteria 3098
561 Ga0501083_0598187 3300049744 Bacteria 718
562 Ga0501035_0081967 3300049822 Bacteria 2847
563 Ga0501044_0033540 3300049823 Bacteria 5395
564 Ga0501044_0080571 3300049823 Bacteria 3298
565 Ga0501044_0115392 3300049823 Bacteria 2691
566 Ga0501045_0050250 3300049824 Bacteria 3042
567 nmdc:mga03683_21383_c1 3300050489 Bacteria 2493
568 nmdc:mga03683_27988_c1 3300050489 Bacteria 2238
569 nmdc:mga0k408_80035_c1 3300050493 Bacteria 1912
570 nmdc:mga04h51_181829_c1 3300050495 Bacteria 819
571 nmdc:mga08y16_531320_c1 3300050511 Bacteria 1192
572 nmdc:mga0n895_207979_c1 3300050512 Bacteria 1987
573 nmdc:mga0sz30_253691_c1 3300050516 Bacteria 783
574 Ga0495601_0019087 3300053077 Bacteria 4178
575 Ga0495601_0100751 3300053077 Bacteria 1865
576 Ga0495601_0120318 3300053077 Bacteria 1705
577 Ga0495601_0127333 3300053077 Bacteria 1657
578 Ga0495612_0000161 3300053078 Bacteria 28312
579 Ga0495595_0019772 3300053084 Bacteria 2925
580 Ga0495595_0029837 3300053084 Bacteria 2443
581 Ga0495619_0006176 3300053085 Bacteria 7592
582 Ga0495619_0083855 3300053085 Bacteria 2150
583 Ga0495619_0167133 3300053085 Bacteria 1520
584 Ga0500647_0091502 3300053091 Bacteria 1456
585 Ga0500583_0211399 3300053092 Bacteria 963
586 Ga0500641_0002314 3300053096 Bacteria 6750
587 Ga0500595_004428 3300053119 Bacteria 6310
588 Ga0500588_0138756 3300053146 Bacteria 872
589 Ga0500616_0003157 3300053153 Bacteria 12855
590 Ga0500616_0070085 3300053153 Bacteria 1791
591 Ga0500636_0205418 3300053177 Bacteria 1038
592 Ga0500637_0100230 3300053178 Bacteria 1680
593 Ga0500645_089423 3300053730 Bacteria 874
594 Ga0500552_000088 3300053733 Bacteria 7487
595 Ga0501084_0213033 3300054114 Bacteria 1630
596 Ga0501084_0452219 3300054114 Bacteria 1086
597 Ga0587091_057063 3300059511 Bacteria 819
598 Ga0587101_037436 3300059623 Bacteria 786
599 Ga0587100_011214 3300059648 Bacteria 768
600 Ga0587107_033646 3300059652 Bacteria 794
601 Ga0587110_021183 3300059654 Bacteria 738
602 Ga0587110_021273 3300059654 Bacteria 737
603 Ga0501082_0017161 3300060353 Bacteria 6236
604 Ga0501082_0753626 3300060353 Bacteria 852

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10213281 Ga0157371_102132812 193
2 3300021388 Ga0213875_10002212 Ga0213875_100022122 194
3 3300037853 Ga0436364_1069888 Ga0436364_1069888_53834_54448 194
4 3300059654 Ga0587110_021273 Ga0587110_021273_117_704 195
5 3300026089 Ga0207648_10444482 Ga0207648_104444822 200
6 3300059654 Ga0587110_021183 Ga0587110_021183_113_715 200
7 iso_pu_bacteria 2507262055 2507510078 200
8 iso_pu_bacteria 2508501042 2508697982 200
9 iso_pu_bacteria 2511231221 2512034206 200
10 iso_pu_bacteria 2513237094 2513643609 200
11 iso_pu_bacteria 2513237102 2513706052 200
12 iso_pu_bacteria 2513237139 2513878069 200
13 iso_pu_bacteria 2513237161 2514012634 200
14 iso_pu_bacteria 2515154112 2515629416 200
15 iso_pu_bacteria 2524023250 2524613567 200
16 iso_pu_bacteria 2528768022 2528849652 200
17 iso_pu_bacteria 2617270735 2617353024 200
18 iso_pu_bacteria 2802429603 2805920029 200
19 iso_pu_bacteria 2821443989 2821450438 200
20 iso_pu_bacteria 2824617872 2824622760 200
21 iso_pu_bacteria 2824626560 2824632407 200
22 iso_pu_bacteria 2824635225 2824640426 200
23 iso_pu_bacteria 2824644064 2824647415 200
24 iso_pu_bacteria 2824661429 2824668738 200
25 iso_pu_bacteria 2824671348 2824674291 200
26 iso_pu_bacteria 2824687955 2824690913 200
27 iso_pu_bacteria 2824696289 2824698511 200
28 iso_pu_bacteria 2824714736 2824720393 200
29 iso_pu_bacteria 2824723954 2824728694 200
30 iso_pu_bacteria 2824773399 2824778226 200
31 iso_pu_bacteria 2838122688 2838127480 200
32 iso_pu_bacteria 2841941048 2841941567 200
33 iso_pu_bacteria 2841949485 2841952417 200
34 iso_pu_bacteria 2841966195 2841967711 200
35 iso_pu_bacteria 2841974524 2841982123 200
36 iso_pu_bacteria 2841983080 2841986441 200
37 iso_pu_bacteria 2842333319 2842333561 200
38 iso_pu_bacteria 2844533157 2844534507 200
39 iso_pu_bacteria 2847939898 2847945078 200
40 iso_pu_bacteria 2849076700 2849080736 200
41 iso_pu_bacteria 2874590934 2874593280 200
42 iso_pu_bacteria 2874628541 2874636095 200
43 iso_pu_bacteria 2874645413 2874652945 200
44 iso_pu_bacteria 2876771140 2876773320 200
45 iso_pu_bacteria 2876818435 2876821273 200
46 iso_pu_bacteria 2879074833 2879077236 200
47 iso_pu_bacteria 2879099564 2879107680 200
48 iso_pu_bacteria 2879127579 2879130207 200
49 iso_pu_bacteria 2879142872 2879146722 200
50 iso_pu_bacteria 2885409591 2885410166 200
51 iso_pu_bacteria 2922368715 2922375555 200
52 iso_pu_bacteria 2929615660 2929616293 200
53 iso_pu_bacteria 2929624759 2929625037 200
54 iso_pu_bacteria 2932784394 2932787043 200
55 iso_pu_bacteria 2932794094 2932797273 200
56 iso_pu_bacteria 2932801729 2932804842 200
57 iso_pu_bacteria 2932809354 2932811240 200
58 iso_pu_bacteria 2932818245 2932819887 200
59 iso_pu_bacteria 2932828146 2932832368 200
60 iso_pu_bacteria 2933577622 2933578423 200
61 iso_pu_bacteria 2935608549 2935611017 200
62 iso_pu_bacteria 2935616580 2935619077 200
63 iso_pu_bacteria 2935638405 2935643105 200
64 iso_pu_bacteria 2935648319 2935648448 200
65 iso_pu_bacteria 2935656913 2935657564 200
66 iso_pu_bacteria 2935665750 2935669732 200
67 iso_pu_bacteria 2935675223 2935677128 200
68 iso_pu_bacteria 2935684952 2935693163 200
69 iso_pu_bacteria 2935694250 2935695343 200
70 iso_pu_bacteria 2935703347 2935709548 200
71 iso_pu_bacteria 2935713505 2935719771 200
72 iso_pu_bacteria 2935722832 2935729462 200
73 iso_pu_bacteria 2935732158 2935739654 200
74 iso_pu_bacteria 2935741537 2935748692 200
75 iso_pu_bacteria 2935750917 2935756721 200
76 iso_pu_bacteria 2935760218 2935761294 200
77 iso_pu_bacteria 2935801545 2935807253 200
78 iso_pu_bacteria 2935810662 2935812390 200
79 iso_pu_bacteria 2935819856 2935820502 200
80 iso_pu_bacteria 2935827899 2935832750 200
81 iso_pu_bacteria 2935837841 2935839170 200
82 iso_pu_bacteria 2935847175 2935849489 200
83 iso_pu_bacteria 2935855204 2935857442 200
84 iso_pu_bacteria 2935864058 2935864972 200
85 iso_pu_bacteria 2935873716 2935876750 200
86 iso_pu_bacteria 2935883170 2935884922 200
87 iso_pu_bacteria 2935975950 2935979181 200
88 iso_pu_bacteria 2935984226 2935987807 200
89 iso_pu_bacteria 2935992306 2935999637 200
90 iso_pu_bacteria 2936002035 2936008341 200
91 iso_pu_bacteria 2936011229 2936011358 200
92 iso_pu_bacteria 2936019824 2936019953 200
93 iso_pu_bacteria 2936028420 2936028549 200
94 iso_pu_bacteria 2936037263 2936038983 200
95 iso_pu_bacteria 2936046547 2936046676 200
96 iso_pu_bacteria 2936055302 2936062369 200
97 iso_pu_bacteria 2940556831 2940562635 200
98 iso_pu_bacteria 2941538514 2941539860 200
99 iso_pu_bacteria 3005506211 3005508792 200
100 iso_pu_bacteria 8016511872 8016515165 200
101 iso_pu_bacteria 8016630954 8016632637 200
102 iso_pu_bacteria 8017057580 8017061288 200
103 iso_pu_bacteria 8019576017 8019580760 200
104 iso_pu_bacteria 8019586578 8019588491 200
105 iso_pu_bacteria 8019597564 8019602845 200
106 iso_pu_bacteria 8019608314 8019615711 200
107 iso_pu_bacteria 8019619141 8019626459 200
108 iso_pu_bacteria 8019629233 8019636034 200
109 iso_pu_bacteria 8019638758 8019643630 200
110 iso_pu_bacteria 8019659431 8019663797 200
111 iso_pu_bacteria 8019668869 8019673430 200
112 iso_pu_bacteria 8019678201 8019682699 200
113 iso_pu_bacteria 8054002106 8054004314 200
114 iso_pu_bacteria 8055742211 8055747939 200
115 3300039437 Ga0436365_0160653 Ga0436365_0160653_70_678 202
116 3300003316 rootH1_10196287 rootH1_101962872 203
117 3300001989 JGI24739J22299_10089789 JGI24739J22299_100897891 204
118 3300002987 JGI25159J45721_1028911 JGI25159J45721_10289111 204
119 3300003163 Ga0006759J45824_1013627 Ga0006759J45824_10136271 204
120 3300003187 JGI25151J46595_10000321 JGI25151J46595_100003216 204
121 3300003203 JGI25406J46586_10075867 JGI25406J46586_100758671 204
122 3300003215 JGI25153J46596_10026799 JGI25153J46596_100267992 204
123 3300003322 rootL2_10030863 rootL2_100308634 204
124 3300003354 JGI25160J50197_1009503 JGI25160J50197_10095032 204
125 3300003544 Ga0007417J51691_1007909 Ga0007417J51691_10079091 204
126 3300003559 Ga0007427J51700_106633 Ga0007427J51700_1066331 204
127 3300003568 Ga0006781J51513_1006864 Ga0006781J51513_10068641 204
128 3300003574 Ga0007410J51695_1007683 Ga0007410J51695_10076831 204
129 3300003575 Ga0007409J51694_1009683 Ga0007409J51694_10096831 204
130 3300003577 Ga0007416J51690_1010630 Ga0007416J51690_10106301 204
131 3300003579 Ga0007429J51699_1006425 Ga0007429J51699_10064251 204
132 3300003579 Ga0007429J51699_1016869 Ga0007429J51699_10168691 204
133 3300003611 Ga0007411J51799_108223 Ga0007411J51799_1082231 204
134 3300003693 Ga0032354_1003564 Ga0032354_10035641 204
135 3300003735 Ga0006780_1000822 Ga0006780_10008221 204
136 3300004798 Ga0058859_11729389 Ga0058859_117293891 204
137 3300004799 Ga0058863_11741356 Ga0058863_117413561 204
138 3300004800 Ga0058861_11962574 Ga0058861_119625741 204
139 3300004803 Ga0058862_12787350 Ga0058862_127873501 204
140 3300005327 Ga0070658_10005063 Ga0070658_100050635 204
141 3300005331 Ga0070670_100223883 Ga0070670_1002238832 204
142 3300005331 Ga0070670_100444683 Ga0070670_1004446831 204
143 3300005336 Ga0070680_100006823 Ga0070680_1000068232 204
144 3300005336 Ga0070680_100231599 Ga0070680_1002315991 204
145 3300005336 Ga0070680_100236729 Ga0070680_1002367291 204
146 3300005336 Ga0070680_100504805 Ga0070680_1005048051 204
147 3300005338 Ga0068868_100057272 Ga0068868_1000572721 204
148 3300005339 Ga0070660_100173845 Ga0070660_1001738452 204
149 3300005341 Ga0070691_10074318 Ga0070691_100743182 204
150 3300005344 Ga0070661_100049069 Ga0070661_1000490693 204
151 3300005344 Ga0070661_100658782 Ga0070661_1006587821 204
152 3300005355 Ga0070671_100058811 Ga0070671_1000588112 204
153 3300005355 Ga0070671_100139744 Ga0070671_1001397442 204
154 3300005356 Ga0070674_100014625 Ga0070674_1000146252 204
155 3300005365 Ga0070688_100203439 Ga0070688_1002034392 204
156 3300005434 Ga0070709_10083542 Ga0070709_100835422 204
157 3300005434 Ga0070709_10585260 Ga0070709_105852602 204
158 3300005435 Ga0070714_100000109 Ga0070714_10000010936 204
159 3300005435 Ga0070714_100053722 Ga0070714_1000537221 204
160 3300005435 Ga0070714_100125190 Ga0070714_1001251902 204
161 3300005435 Ga0070714_100204564 Ga0070714_1002045644 204
162 3300005435 Ga0070714_100881694 Ga0070714_1008816941 204
163 3300005435 Ga0070714_100900979 Ga0070714_1009009791 204
164 3300005436 Ga0070713_100003647 Ga0070713_10000364712 204
165 3300005436 Ga0070713_100009862 Ga0070713_1000098628 204
166 3300005436 Ga0070713_100081654 Ga0070713_1000816543 204
167 3300005436 Ga0070713_100864901 Ga0070713_1008649012 204
168 3300005436 Ga0070713_101150857 Ga0070713_1011508571 204
169 3300005436 Ga0070713_101218906 Ga0070713_1012189061 204
170 3300005437 Ga0070710_10012410 Ga0070710_100124104 204
171 3300005437 Ga0070710_10018319 Ga0070710_100183194 204
172 3300005437 Ga0070710_10065125 Ga0070710_100651251 204
173 3300005437 Ga0070710_10313858 Ga0070710_103138581 204
174 3300005439 Ga0070711_100008458 Ga0070711_1000084583 204
175 3300005439 Ga0070711_100026740 Ga0070711_1000267406 204
176 3300005439 Ga0070711_100129600 Ga0070711_1001296002 204
177 3300005439 Ga0070711_100440784 Ga0070711_1004407841 204
178 3300005441 Ga0070700_100060273 Ga0070700_1000602732 204
179 3300005445 Ga0070708_100045787 Ga0070708_1000457873 204
180 3300005445 Ga0070708_100333786 Ga0070708_1003337861 204
181 3300005445 Ga0070708_100400331 Ga0070708_1004003312 204
182 3300005445 Ga0070708_101069620 Ga0070708_1010696201 204
183 3300005456 Ga0070678_100009064 Ga0070678_1000090644 204
184 3300005456 Ga0070678_100222884 Ga0070678_1002228843 204
185 3300005458 Ga0070681_10009482 Ga0070681_100094824 204
186 3300005458 Ga0070681_10010966 Ga0070681_100109664 204
187 3300005458 Ga0070681_10038254 Ga0070681_100382545 204
188 3300005458 Ga0070681_10082512 Ga0070681_100825122 204
189 3300005458 Ga0070681_10218318 Ga0070681_102183182 204
190 3300005458 Ga0070681_10364739 Ga0070681_103647391 204
191 3300005458 Ga0070681_10603751 Ga0070681_106037512 204
192 3300005467 Ga0070706_100428236 Ga0070706_1004282362 204
193 3300005467 Ga0070706_101025644 Ga0070706_1010256441 204
194 3300005468 Ga0070707_100067654 Ga0070707_1000676542 204
195 3300005471 Ga0070698_100009525 Ga0070698_1000095254 204
196 3300005471 Ga0070698_100009857 Ga0070698_1000098572 204
197 3300005471 Ga0070698_100066659 Ga0070698_1000666593 204
198 3300005471 Ga0070698_100142108 Ga0070698_1001421082 204
199 3300005518 Ga0070699_100033732 Ga0070699_1000337323 204
200 3300005518 Ga0070699_100293855 Ga0070699_1002938552 204
201 3300005530 Ga0070679_100001570 Ga0070679_10000157016 204
202 3300005530 Ga0070679_100046569 Ga0070679_1000465695 204
203 3300005530 Ga0070679_100714999 Ga0070679_1007149991 204
204 3300005535 Ga0070684_100015453 Ga0070684_1000154533 204
205 3300005535 Ga0070684_100629529 Ga0070684_1006295292 204
206 3300005536 Ga0070697_100145510 Ga0070697_1001455102 204
207 3300005536 Ga0070697_100208960 Ga0070697_1002089602 204
208 3300005536 Ga0070697_100356560 Ga0070697_1003565601 204
209 3300005539 Ga0068853_100027384 Ga0068853_1000273843 204
210 3300005539 Ga0068853_100027444 Ga0068853_1000274443 204
211 3300005539 Ga0068853_100484974 Ga0068853_1004849741 204
212 3300005547 Ga0070693_100655141 Ga0070693_1006551411 204
213 3300005548 Ga0070665_100001426 Ga0070665_1000014263 204
214 3300005548 Ga0070665_100669652 Ga0070665_1006696522 204
215 3300005548 Ga0070665_100863405 Ga0070665_1008634051 204
216 3300005563 Ga0068855_100055194 Ga0068855_1000551945 204
217 3300005563 Ga0068855_100235756 Ga0068855_1002357563 204
218 3300005563 Ga0068855_100290054 Ga0068855_1002900542 204
219 3300005564 Ga0070664_100063094 Ga0070664_1000630944 204
220 3300005577 Ga0068857_100024941 Ga0068857_1000249415 204
221 3300005577 Ga0068857_100285705 Ga0068857_1002857052 204
222 3300005577 Ga0068857_100816329 Ga0068857_1008163291 204
223 3300005578 Ga0068854_100089788 Ga0068854_1000897882 204
224 3300005614 Ga0068856_100048767 Ga0068856_1000487672 204
225 3300005614 Ga0068856_100051884 Ga0068856_1000518843 204
226 3300005614 Ga0068856_100118153 Ga0068856_1001181532 204
227 3300005614 Ga0068856_100404474 Ga0068856_1004044742 204
228 3300005614 Ga0068856_100588586 Ga0068856_1005885861 204
229 3300005616 Ga0068852_100048736 Ga0068852_1000487363 204
230 3300005617 Ga0068859_101207513 Ga0068859_1012075131 204
231 3300005834 Ga0068851_10277963 Ga0068851_102779631 204
232 3300005840 Ga0068870_10289542 Ga0068870_102895421 204
233 3300005843 Ga0068860_100080670 Ga0068860_1000806702 204
234 3300005937 Ga0081455_10000434 Ga0081455_100004349 204
235 3300005937 Ga0081455_10008590 Ga0081455_1000859010 204
236 3300005937 Ga0081455_10183324 Ga0081455_101833242 204
237 3300005937 Ga0081455_10392483 Ga0081455_103924832 204
238 3300005981 Ga0081538_10076130 Ga0081538_100761302 204
239 3300005983 Ga0081540_1042357 Ga0081540_10423571 204
240 3300005983 Ga0081540_1149827 Ga0081540_11498271 204
241 3300005985 Ga0081539_10013066 Ga0081539_100130664 204
242 3300006028 Ga0070717_10000675 Ga0070717_1000067516 204
243 3300006028 Ga0070717_10090048 Ga0070717_100900483 204
244 3300006028 Ga0070717_10233523 Ga0070717_102335233 204
245 3300006028 Ga0070717_10776108 Ga0070717_107761081 204
246 3300006038 Ga0075365_10083846 Ga0075365_100838463 204
247 3300006163 Ga0070715_10267458 Ga0070715_102674581 204
248 3300006173 Ga0070716_100102764 Ga0070716_1001027642 204
249 3300006175 Ga0070712_100028391 Ga0070712_1000283916 204
250 3300006175 Ga0070712_100064734 Ga0070712_1000647341 204
251 3300006175 Ga0070712_100163788 Ga0070712_1001637882 204
252 3300006175 Ga0070712_100440277 Ga0070712_1004402772 204
253 3300006177 Ga0075362_10002476 Ga0075362_100024762 204
254 3300006177 Ga0075362_10037714 Ga0075362_100377142 204
255 3300006195 Ga0075366_10006532 Ga0075366_100065322 204
256 3300006353 Ga0075370_10139193 Ga0075370_101391932 204
257 3300006358 Ga0068871_100556839 Ga0068871_1005568392 204
258 3300006847 Ga0075431_100458226 Ga0075431_1004582262 204
259 3300006871 Ga0075434_100303580 Ga0075434_1003035802 204
260 3300006871 Ga0075434_100320767 Ga0075434_1003207672 204
261 3300006914 Ga0075436_100190084 Ga0075436_1001900842 204
262 3300006931 Ga0097620_101207258 Ga0097620_1012072581 204
263 3300007076 Ga0075435_100095352 Ga0075435_1000953522 204
264 3300007265 Ga0099794_10080472 Ga0099794_100804721 204
265 3300007265 Ga0099794_10250257 Ga0099794_102502571 204
266 3300007788 Ga0099795_10039719 Ga0099795_100397192 204
267 3300007788 Ga0099795_10043886 Ga0099795_100438862 204
268 3300007788 Ga0099795_10308681 Ga0099795_103086811 204
269 3300009093 Ga0105240_10000330 Ga0105240_1000033047 204
270 3300009093 Ga0105240_10000580 Ga0105240_1000058073 204
271 3300009093 Ga0105240_10014265 Ga0105240_1001426510 204
272 3300009093 Ga0105240_10090761 Ga0105240_100907615 204
273 3300009093 Ga0105240_10213313 Ga0105240_102133133 204
274 3300009093 Ga0105240_10224624 Ga0105240_102246242 204
275 3300009093 Ga0105240_10456714 Ga0105240_104567142 204
276 3300009093 Ga0105240_10565073 Ga0105240_105650732 204
277 3300009093 Ga0105240_10668720 Ga0105240_106687202 204
278 3300009094 Ga0111539_10497407 Ga0111539_104974072 204
279 3300009098 Ga0105245_10066311 Ga0105245_100663113 204
280 3300009147 Ga0114129_10798305 Ga0114129_107983052 204
281 3300009148 Ga0105243_10847438 Ga0105243_108474381 204
282 3300009174 Ga0105241_10413912 Ga0105241_104139121 204
283 3300009176 Ga0105242_10270422 Ga0105242_102704221 204
284 3300009177 Ga0105248_10137227 Ga0105248_101372272 204
285 3300009545 Ga0105237_10105821 Ga0105237_101058213 204
286 3300009551 Ga0105238_10132022 Ga0105238_101320222 204
287 3300009551 Ga0105238_10787665 Ga0105238_107876651 204
288 3300009553 Ga0105249_10391980 Ga0105249_103919802 204
289 3300009986 Ga0105033_104574 Ga0105033_1045743 204
290 3300010159 Ga0099796_10018908 Ga0099796_100189082 204
291 3300010375 Ga0105239_10148242 Ga0105239_101482421 204
292 3300010375 Ga0105239_10588478 Ga0105239_105884781 204
293 3300013102 Ga0157371_10070102 Ga0157371_100701023 204
294 3300013104 Ga0157370_10005028 Ga0157370_100050286 204
295 3300013104 Ga0157370_10019229 Ga0157370_100192296 204
296 3300013104 Ga0157370_10025363 Ga0157370_100253633 204
297 3300013104 Ga0157370_10075051 Ga0157370_100750512 204
298 3300013105 Ga0157369_10160168 Ga0157369_101601683 204
299 3300013296 Ga0157374_10040559 Ga0157374_100405592 204
300 3300013296 Ga0157374_10544380 Ga0157374_105443801 204
301 3300013296 Ga0157374_10653097 Ga0157374_106530972 204
302 3300013297 Ga0157378_10218204 Ga0157378_102182042 204
303 3300013297 Ga0157378_11217626 Ga0157378_112176261 204
304 3300013307 Ga0157372_11118657 Ga0157372_111186572 204
305 3300014325 Ga0163163_10088190 Ga0163163_100881903 204
306 3300014325 Ga0163163_10132205 Ga0163163_101322053 204
307 3300014325 Ga0163163_10366989 Ga0163163_103669893 204
308 3300014325 Ga0163163_10403293 Ga0163163_104032933 204
309 3300014497 Ga0182008_10005670 Ga0182008_100056707 204
310 3300014497 Ga0182008_10062439 Ga0182008_100624392 204
311 3300014497 Ga0182008_10073565 Ga0182008_100735652 204
312 3300014745 Ga0157377_10368228 Ga0157377_103682281 204
313 3300014969 Ga0157376_10023876 Ga0157376_100238764 204
314 3300014969 Ga0157376_10193645 Ga0157376_101936452 204
315 3300017792 Ga0163161_10962790 Ga0163161_109627901 204
316 3300019162 Ga0184597_126673 Ga0184597_1266731 204
317 3300019166 Ga0184595_115712 Ga0184595_1157121 204
318 3300019182 Ga0184598_112434 Ga0184598_1124341 204
319 3300019188 Ga0184599_106266 Ga0184599_1062661 204
320 3300020069 Ga0197907_10436073 Ga0197907_104360732 204
321 3300020070 Ga0206356_11602332 Ga0206356_116023322 204
322 3300020076 Ga0206355_1429787 Ga0206355_14297871 204
323 3300020077 Ga0206351_10868433 Ga0206351_108684331 204
324 3300020078 Ga0206352_11164371 Ga0206352_111643711 204
325 3300021358 Ga0213873_10022034 Ga0213873_100220342 204
326 3300021361 Ga0213872_10000696 Ga0213872_100006963 204
327 3300021361 Ga0213872_10063159 Ga0213872_100631592 204
328 3300021361 Ga0213872_10132681 Ga0213872_101326811 204
329 3300021384 Ga0213876_10024314 Ga0213876_100243143 204
330 3300021388 Ga0213875_10000081 Ga0213875_1000008193 204
331 3300021388 Ga0213875_10003351 Ga0213875_100033518 204
332 3300021388 Ga0213875_10017999 Ga0213875_100179993 204
333 3300021388 Ga0213875_10082814 Ga0213875_100828141 204
334 3300021441 Ga0213871_10002467 Ga0213871_100024672 204
335 3300021441 Ga0213871_10010292 Ga0213871_100102922 204
336 3300021441 Ga0213871_10098501 Ga0213871_100985011 204
337 3300022467 Ga0224712_10296943 Ga0224712_102969431 204
338 3300023536 Ga0247552_101207 Ga0247552_1012071 204
339 3300023539 Ga0247555_101092 Ga0247555_1010921 204
340 3300023547 Ga0247554_100379 Ga0247554_1003792 204
341 3300023660 Ga0247550_100572 Ga0247550_1005722 204
342 3300025294 Ga0209025_1000224 Ga0209025_100022472 204
343 3300025297 Ga0209758_1001111 Ga0209758_10011113 204
344 3300025898 Ga0207692_10049055 Ga0207692_100490552 204
345 3300025898 Ga0207692_10108437 Ga0207692_101084371 204
346 3300025898 Ga0207692_10112568 Ga0207692_101125683 204
347 3300025903 Ga0207680_10270975 Ga0207680_102709752 204
348 3300025905 Ga0207685_10311713 Ga0207685_103117131 204
349 3300025906 Ga0207699_10005358 Ga0207699_100053585 204
350 3300025906 Ga0207699_10111722 Ga0207699_101117222 204
351 3300025906 Ga0207699_10264784 Ga0207699_102647842 204
352 3300025909 Ga0207705_10037180 Ga0207705_100371802 204
353 3300025910 Ga0207684_10098817 Ga0207684_100988172 204
354 3300025912 Ga0207707_10002418 Ga0207707_100024188 204
355 3300025912 Ga0207707_10010162 Ga0207707_100101623 204
356 3300025912 Ga0207707_10021504 Ga0207707_100215043 204
357 3300025912 Ga0207707_10331316 Ga0207707_103313161 204
358 3300025913 Ga0207695_10000690 Ga0207695_1000069010 204
359 3300025913 Ga0207695_10002225 Ga0207695_1000222510 204
360 3300025913 Ga0207695_10265920 Ga0207695_102659201 204
361 3300025913 Ga0207695_10292078 Ga0207695_102920781 204
362 3300025914 Ga0207671_10133171 Ga0207671_101331713 204
363 3300025915 Ga0207693_10001564 Ga0207693_100015647 204
364 3300025915 Ga0207693_10004020 Ga0207693_1000402013 204
365 3300025915 Ga0207693_10071776 Ga0207693_100717762 204
366 3300025915 Ga0207693_10087373 Ga0207693_100873732 204
367 3300025915 Ga0207693_10121789 Ga0207693_101217893 204
368 3300025915 Ga0207693_10442644 Ga0207693_104426442 204
369 3300025916 Ga0207663_10185316 Ga0207663_101853162 204
370 3300025916 Ga0207663_10261053 Ga0207663_102610531 204
371 3300025916 Ga0207663_10282525 Ga0207663_102825251 204
372 3300025916 Ga0207663_10559096 Ga0207663_105590962 204
373 3300025917 Ga0207660_10029298 Ga0207660_100292981 204
374 3300025917 Ga0207660_10122502 Ga0207660_101225022 204
375 3300025917 Ga0207660_10841770 Ga0207660_108417701 204
376 3300025918 Ga0207662_10315116 Ga0207662_103151161 204
377 3300025918 Ga0207662_10329006 Ga0207662_103290062 204
378 3300025919 Ga0207657_10060068 Ga0207657_100600682 204
379 3300025921 Ga0207652_10010284 Ga0207652_100102847 204
380 3300025921 Ga0207652_10045957 Ga0207652_100459571 204
381 3300025921 Ga0207652_10163196 Ga0207652_101631962 204
382 3300025922 Ga0207646_10130656 Ga0207646_101306562 204
383 3300025922 Ga0207646_10169845 Ga0207646_101698452 204
384 3300025923 Ga0207681_10093653 Ga0207681_100936532 204
385 3300025924 Ga0207694_10001133 Ga0207694_1000113316 204
386 3300025925 Ga0207650_10294643 Ga0207650_102946432 204
387 3300025927 Ga0207687_10628459 Ga0207687_106284592 204
388 3300025928 Ga0207700_10193917 Ga0207700_101939173 204
389 3300025928 Ga0207700_10416491 Ga0207700_104164912 204
390 3300025928 Ga0207700_10530834 Ga0207700_105308342 204
391 3300025928 Ga0207700_10795096 Ga0207700_107950961 204
392 3300025928 Ga0207700_10864868 Ga0207700_108648681 204
393 3300025928 Ga0207700_11098278 Ga0207700_110982781 204
394 3300025929 Ga0207664_10000469 Ga0207664_1000046916 204
395 3300025929 Ga0207664_10075846 Ga0207664_100758465 204
396 3300025929 Ga0207664_10150290 Ga0207664_101502902 204
397 3300025929 Ga0207664_10267068 Ga0207664_102670682 204
398 3300025929 Ga0207664_10271330 Ga0207664_102713302 204
399 3300025929 Ga0207664_10368301 Ga0207664_103683012 204
400 3300025929 Ga0207664_10406261 Ga0207664_104062612 204
401 3300025929 Ga0207664_10556154 Ga0207664_105561541 204
402 3300025929 Ga0207664_10969780 Ga0207664_109697801 204
403 3300025931 Ga0207644_10085096 Ga0207644_100850963 204
404 3300025931 Ga0207644_10200692 Ga0207644_102006922 204
405 3300025931 Ga0207644_10379240 Ga0207644_103792402 204
406 3300025934 Ga0207686_10535078 Ga0207686_105350782 204
407 3300025936 Ga0207670_10149495 Ga0207670_101494953 204
408 3300025937 Ga0207669_10261132 Ga0207669_102611322 204
409 3300025939 Ga0207665_10255896 Ga0207665_102558963 204
410 3300025940 Ga0207691_10199553 Ga0207691_101995531 204
411 3300025944 Ga0207661_10052671 Ga0207661_100526714 204
412 3300025944 Ga0207661_11349310 Ga0207661_113493101 204
413 3300025945 Ga0207679_10017685 Ga0207679_100176853 204
414 3300025945 Ga0207679_11211304 Ga0207679_112113041 204
415 3300025949 Ga0207667_10007312 Ga0207667_100073122 204
416 3300025949 Ga0207667_10065952 Ga0207667_100659526 204
417 3300025981 Ga0207640_10057329 Ga0207640_100573293 204
418 3300025981 Ga0207640_10070109 Ga0207640_100701092 204
419 3300026023 Ga0207677_10050579 Ga0207677_100505793 204
420 3300026035 Ga0207703_10233530 Ga0207703_102335303 204
421 3300026041 Ga0207639_10009123 Ga0207639_100091234 204
422 3300026067 Ga0207678_10793541 Ga0207678_107935411 204
423 3300026078 Ga0207702_10067990 Ga0207702_100679904 204
424 3300026078 Ga0207702_10092366 Ga0207702_100923662 204
425 3300026078 Ga0207702_10139820 Ga0207702_101398202 204
426 3300026078 Ga0207702_10948179 Ga0207702_109481791 204
427 3300026095 Ga0207676_10306403 Ga0207676_103064031 204
428 3300026116 Ga0207674_10269548 Ga0207674_102695481 204
429 3300026116 Ga0207674_10373325 Ga0207674_103733251 204
430 3300026118 Ga0207675_100896267 Ga0207675_1008962671 204
431 3300026121 Ga0207683_10016904 Ga0207683_100169044 204
432 3300027512 Ga0209179_1012847 Ga0209179_10128472 204
433 3300027512 Ga0209179_1014909 Ga0209179_10149092 204
434 3300027512 Ga0209179_1044509 Ga0209179_10445091 204
435 3300027671 Ga0209588_1067866 Ga0209588_10678661 204
436 3300028381 Ga0268264_10056033 Ga0268264_100560334 204
437 3300028800 Ga0265338_10030246 Ga0265338_100302464 204
438 3300028800 Ga0265338_10068686 Ga0265338_100686864 204
439 3300028800 Ga0265338_10153257 Ga0265338_101532571 204
440 3300029283 Ga0310982_135131 Ga0310982_1351311 204
441 3300029285 Ga0310981_1078795 Ga0310981_10787952 204
442 3300030888 Ga0265769_102505 Ga0265769_1025052 204
443 3300031238 Ga0265332_10042540 Ga0265332_100425402 204
444 3300031240 Ga0265320_10145120 Ga0265320_101451202 204
445 3300031250 Ga0265331_10030442 Ga0265331_100304423 204
446 3300031251 Ga0265327_10001626 Ga0265327_1000162620 204
447 3300031251 Ga0265327_10007634 Ga0265327_100076341 204
448 3300031344 Ga0265316_10181079 Ga0265316_101810792 204
449 3300031548 Ga0307408_100975967 Ga0307408_1009759671 204
450 3300031595 Ga0265313_10004920 Ga0265313_100049203 204
451 3300031595 Ga0265313_10183153 Ga0265313_101831531 204
452 3300031595 Ga0265313_10246670 Ga0265313_102466701 204
453 3300031711 Ga0265314_10017169 Ga0265314_100171692 204
454 3300031711 Ga0265314_10038253 Ga0265314_100382534 204
455 3300031711 Ga0265314_10041957 Ga0265314_100419575 204
456 3300031711 Ga0265314_10058218 Ga0265314_100582184 204
457 3300031901 Ga0307406_10238069 Ga0307406_102380692 204
458 3300031903 Ga0307407_10077620 Ga0307407_100776202 204
459 3300031995 Ga0307409_100511303 Ga0307409_1005113032 204
460 3300034817 Ga0373948_0068046 Ga0373948_0068046_150_764 204
461 3300035085 Ga0373929_0017915 Ga0373929_0017915_188_847 204
462 3300035086 Ga0373934_0115189 Ga0373934_0115189_459_1073 204
463 3300035089 Ga0373944_0041225 Ga0373944_0041225_662_1276 204
464 3300035111 Ga0373923_0015841 Ga0373923_0015841_800_1414 204
465 3300035111 Ga0373923_0195262 Ga0373923_0195262_105_719 204
466 3300035113 Ga0373936_0177722 Ga0373936_0177722_33_647 204
467 3300035116 Ga0373945_0122282 Ga0373945_0122282_128_742 204
468 3300035116 Ga0373945_0188062 Ga0373945_0188062_101_715 204
469 3300035117 Ga0373953_0003261 Ga0373953_0003261_272_886 204
470 3300035117 Ga0373953_0008351 Ga0373953_0008351_2074_2691 204
471 3300035118 Ga0373954_0053017 Ga0373954_0053017_1224_1841 204
472 3300035118 Ga0373954_0135544 Ga0373954_0135544_254_868 204
473 3300035119 Ga0373956_0101827 Ga0373956_0101827_68_685 204
474 3300035119 Ga0373956_0122694 Ga0373956_0122694_46_660 204
475 3300035170 Ga0373943_0011117 Ga0373943_0011117_323_937 204
476 3300035170 Ga0373943_0199520 Ga0373943_0199520_435_1049 204
477 3300035170 Ga0373943_0432294 Ga0373943_0432294_121_735 204
478 3300035171 Ga0373946_0016224 Ga0373946_0016224_604_1218 204
479 3300035172 Ga0373955_0024645 Ga0373955_0024645_799_1413 204
480 3300035172 Ga0373955_0072968 Ga0373955_0072968_1286_1903 204
481 3300035172 Ga0373955_0251431 Ga0373955_0251431_67_681 204
482 3300035241 Ga0373961_0150318 Ga0373961_0150318_21_635 204
483 3300035692 Ga0373935_0122256 Ga0373935_0122256_41_655 204
484 3300035692 Ga0373935_0147915 Ga0373935_0147915_462_1076 204
485 3300035692 Ga0373935_0233176 Ga0373935_0233176_324_983 204
486 3300035692 Ga0373935_0670760 Ga0373935_0670760_84_701 204
487 3300035695 Ga0373927_0034688 Ga0373927_0034688_2137_2751 204
488 3300035695 Ga0373927_0084876 Ga0373927_0084876_357_971 204
489 3300035695 Ga0373927_0088890 Ga0373927_0088890_10_624 204
490 3300035695 Ga0373927_0145574 Ga0373927_0145574_180_794 204
491 3300035724 Ga0373933_0004435 Ga0373933_0004435_4038_4652 204
492 3300035724 Ga0373933_0116798 Ga0373933_0116798_731_1345 204
493 3300035724 Ga0373933_0158524 Ga0373933_0158524_139_753 204
494 3300035724 Ga0373933_0194417 Ga0373933_0194417_234_848 204
495 3300035725 Ga0373947_0027624 Ga0373947_0027624_58_672 204
496 3300035725 Ga0373947_0081675 Ga0373947_0081675_1022_1636 204
497 3300035725 Ga0373947_0140667 Ga0373947_0140667_580_1194 204
498 3300035725 Ga0373947_0241326 Ga0373947_0241326_482_1096 204
499 3300035725 Ga0373947_0459410 Ga0373947_0459410_139_753 204
500 3300036401 Ga0373937_0002465 Ga0373937_0002465_528_1142 204
501 3300036401 Ga0373937_0017368 Ga0373937_0017368_5032_5646 204
502 3300036401 Ga0373937_0018071 Ga0373937_0018071_762_1379 204
503 3300036401 Ga0373937_0037918 Ga0373937_0037918_618_1277 204
504 3300036401 Ga0373937_0258096 Ga0373937_0258096_175_789 204
505 3300037068 Ga0373925_0080723 Ga0373925_0080723_1148_1762 204
506 3300037068 Ga0373925_0081164 Ga0373925_0081164_1309_1923 204
507 3300037068 Ga0373925_0189682 Ga0373925_0189682_152_766 204
508 3300037068 Ga0373925_0245844 Ga0373925_0245844_517_1176 204
509 3300037068 Ga0373925_0538401 Ga0373925_0538401_71_685 204
510 3300037068 Ga0373925_0706536 Ga0373925_0706536_87_701 204
511 3300037312 Ga0395899_0007141 Ga0395899_0007141_7625_8239 204
512 3300037418 Ga0395900_0007046 Ga0395900_0007046_4979_5644 204
513 3300037418 Ga0395900_0050126 Ga0395900_0050126_1772_2437 204
514 3300037418 Ga0395900_0066219 Ga0395900_0066219_1746_2360 204
515 3300037418 Ga0395900_0200017 Ga0395900_0200017_1034_1648 204
516 3300037466 Ga0395898_0004350 Ga0395898_0004350_874_1488 204
517 3300037466 Ga0395898_0004896 Ga0395898_0004896_12557_13222 204
518 3300037466 Ga0395898_0042229 Ga0395898_0042229_1987_2601 204
519 3300037466 Ga0395898_0514369 Ga0395898_0514369_102_716 204
520 3300037471 Ga0395905_0015055 Ga0395905_0015055_1384_1998 204
521 3300037471 Ga0395905_0548964 Ga0395905_0548964_109_774 204
522 3300037853 Ga0436364_0102143 Ga0436364_0102143_979_1593 204
523 3300037853 Ga0436364_0143195 Ga0436364_0143195_4015_4629 204
524 3300037853 Ga0436364_0196111 Ga0436364_0196111_341_955 204
525 3300037853 Ga0436364_0207976 Ga0436364_0207976_1666_2280 204
526 3300037853 Ga0436364_0593151 Ga0436364_0593151_76_690 204
527 3300037853 Ga0436364_0848167 Ga0436364_0848167_1303_1917 204
528 3300037853 Ga0436364_1003761 Ga0436364_1003761_72_689 204
529 3300037853 Ga0436364_1335623 Ga0436364_1335623_56_670 204
530 3300038443 Ga0395901_0001851 Ga0395901_0001851_7757_8371 204
531 3300038443 Ga0395901_0011526 Ga0395901_0011526_4784_5449 204
532 3300038443 Ga0395901_0072152 Ga0395901_0072152_1765_2430 204
533 3300038443 Ga0395901_0763822 Ga0395901_0763822_230_925 204
534 3300039437 Ga0436365_0406357 Ga0436365_0406357_65_679 204
535 3300039437 Ga0436365_0473729 Ga0436365_0473729_944_1558 204
536 3300039437 Ga0436365_1267353 Ga0436365_1267353_283_900 204
537 3300039437 Ga0436365_1510338 Ga0436365_1510338_6528_7142 204
538 3300039437 Ga0436365_1540036 Ga0436365_1540036_63_677 204
539 3300039437 Ga0436365_1789092 Ga0436365_1789092_87_701 204
540 3300039437 Ga0436365_1835715 Ga0436365_1835715_773_1390 204
541 3300039438 Ga0436360_0050291 Ga0436360_0050291_225_839 204
542 3300039438 Ga0436360_0399866 Ga0436360_0399866_412_1170 204
543 3300039438 Ga0436360_0429557 Ga0436360_0429557_5194_5808 204
544 3300039438 Ga0436360_0490313 Ga0436360_0490313_1524_2138 204
545 3300039438 Ga0436360_0517823 Ga0436360_0517823_119_736 204
546 3300039438 Ga0436360_0561465 Ga0436360_0561465_2163_2777 204
547 3300039438 Ga0436360_0660398 Ga0436360_0660398_59_673 204
548 3300039438 Ga0436360_0759298 Ga0436360_0759298_52_666 204
549 3300039438 Ga0436360_1064075 Ga0436360_1064075_60_677 204
550 3300039438 Ga0436360_1222696 Ga0436360_1222696_152_769 204
551 3300039438 Ga0436360_1254791 Ga0436360_1254791_28_642 204
552 3300039447 Ga0436361_0085302 Ga0436361_0085302_956_1570 204
553 3300039447 Ga0436361_0210296 Ga0436361_0210296_289_903 204
554 3300039447 Ga0436361_0221120 Ga0436361_0221120_109_723 204
555 3300039447 Ga0436361_0450680 Ga0436361_0450680_913_1527 204
556 3300039447 Ga0436361_0602217 Ga0436361_0602217_756_1427 204
557 3300039447 Ga0436361_0694107 Ga0436361_0694107_99_713 204
558 3300039447 Ga0436361_0862442 Ga0436361_0862442_253_870 204
559 3300039447 Ga0436361_0972347 Ga0436361_0972347_3713_4327 204
560 3300039447 Ga0436361_0999687 Ga0436361_0999687_674_1291 204
561 3300039450 Ga0436363_0060299 Ga0436363_0060299_1029_1643 204
562 3300039450 Ga0436363_0523610 Ga0436363_0523610_477_1094 204
563 3300039450 Ga0436363_0592968 Ga0436363_0592968_166_780 204
564 3300039450 Ga0436363_0933867 Ga0436363_0933867_469_1086 204
565 3300039450 Ga0436363_1453647 Ga0436363_1453647_547_1164 204
566 3300039453 Ga0436362_0289387 Ga0436362_0289387_258_875 204
567 3300039453 Ga0436362_0411021 Ga0436362_0411021_25_642 204
568 3300039453 Ga0436362_0604955 Ga0436362_0604955_4699_5316 204
569 3300039453 Ga0436362_0630243 Ga0436362_0630243_233_850 204
570 3300039453 Ga0436362_0787739 Ga0436362_0787739_291_908 204
571 3300039453 Ga0436362_0993979 Ga0436362_0993979_4050_4742 204
572 3300039453 Ga0436362_1076558 Ga0436362_1076558_101_715 204
573 3300039453 Ga0436362_1141189 Ga0436362_1141189_212_826 204
574 3300039453 Ga0436362_1288810 Ga0436362_1288810_141_755 204
575 3300041459 Ga0451800_0474877 Ga0451800_0474877_230_844 204
576 3300041997 Ga0439431_0073355 Ga0439431_0073355_242_856 204
577 3300044694 Ga0466963_0396486 Ga0466963_0396486_67_681 204
578 3300044706 Ga0466964_0015509 Ga0466964_0015509_1839_2453 204
579 3300044712 Ga0453684_0000062 Ga0453684_0000062_309997_310611 204
580 3300044712 Ga0453684_0000071 Ga0453684_0000071_206073_206687 204
581 3300044712 Ga0453684_0004682 Ga0453684_0004682_14945_15559 204
582 3300044712 Ga0453684_0601082 Ga0453684_0601082_467_1081 204
583 3300044842 Ga0466957_0028639 Ga0466957_0028639_1108_1722 204
584 3300044901 Ga0466960_0075572 Ga0466960_0075572_565_1179 204
585 3300045051 Ga0451576_0001200 Ga0451576_0001200_35511_36125 204
586 3300045051 Ga0451576_1122117 Ga0451576_1122117_140_754 204
587 3300045836 Ga0466958_0219404 Ga0466958_0219404_501_1115 204
588 3300045836 Ga0466958_0690280 Ga0466958_0690280_16_630 204
589 3300045976 Ga0466967_0236979 Ga0466967_0236979_1033_1647 204
590 3300045976 Ga0466967_0461375 Ga0466967_0461375_150_764 204
591 3300046454 Ga0495592_0062600 Ga0495592_0062600_2009_2668 204
592 3300046454 Ga0495592_0172972 Ga0495592_0172972_159_773 204
593 3300046462 Ga0495651_0025838 Ga0495651_0025838_3799_4413 204
594 3300046462 Ga0495651_0077719 Ga0495651_0077719_1649_2263 204
595 3300046463 Ga0495653_0125725 Ga0495653_0125725_796_1410 204
596 3300046472 Ga0495580_0145982 Ga0495580_0145982_189_803 204
597 3300046475 Ga0495639_0032987 Ga0495639_0032987_785_1444 204
598 3300046476 Ga0495662_0035977 Ga0495662_0035977_966_1625 204
599 3300046477 Ga0495664_0015798 Ga0495664_0015798_2879_3493 204
600 3300046507 Ga0495606_0406273 Ga0495606_0406273_65_682 204
601 3300046511 Ga0495608_0014438 Ga0495608_0014438_2015_2629 204
602 3300046511 Ga0495608_0029236 Ga0495608_0029236_553_1167 204
603 3300046512 Ga0495610_0161327 Ga0495610_0161327_160_774 204
604 3300046514 Ga0495618_0198464 Ga0495618_0198464_201_860 204
605 3300046516 Ga0495628_0085120 Ga0495628_0085120_1768_2382 204
606 3300046517 Ga0495630_0200753 Ga0495630_0200753_391_1005 204
607 3300046517 Ga0495630_0215096 Ga0495630_0215096_712_1371 204
608 3300046522 Ga0495643_0210664 Ga0495643_0210664_167_781 204
609 3300046529 Ga0495652_0096204 Ga0495652_0096204_1564_2178 204
610 3300046533 Ga0495640_0108697 Ga0495640_0108697_554_1168 204
611 3300046533 Ga0495640_0372564 Ga0495640_0372564_124_738 204
612 3300046535 Ga0495586_0518176 Ga0495586_0518176_45_659 204
613 3300046536 Ga0495587_0001558 Ga0495587_0001558_1063_1677 204
614 3300046536 Ga0495587_0207877 Ga0495587_0207877_49_663 204
615 3300046543 Ga0495645_0016793 Ga0495645_0016793_529_1143 204
616 3300046559 Ga0495667_0002486 Ga0495667_0002486_2095_2709 204
617 3300046559 Ga0495667_0011953 Ga0495667_0011953_519_1178 204
618 3300046559 Ga0495667_0047410 Ga0495667_0047410_1574_2188 204
619 3300046559 Ga0495667_0205908 Ga0495667_0205908_264_881 204
620 3300046642 Ga0495634_0225703 Ga0495634_0225703_323_982 204
621 3300046642 Ga0495634_0334740 Ga0495634_0334740_257_871 204
622 3300046663 Ga0495635_0355139 Ga0495635_0355139_174_833 204
623 3300046675 Ga0495657_0046345 Ga0495657_0046345_1797_2411 204
624 3300046675 Ga0495657_0060463 Ga0495657_0060463_1495_2109 204
625 3300046678 Ga0495599_0026360 Ga0495599_0026360_2758_3372 204
626 3300046679 Ga0495623_0079667 Ga0495623_0079667_655_1269 204
627 3300047317 Ga0495604_0060961 Ga0495604_0060961_837_1451 204
628 3300047319 Ga0495674_0250619 Ga0495674_0250619_792_1406 204
629 3300047319 Ga0495674_0379077 Ga0495674_0379077_52_666 204
630 3300047322 Ga0495680_0155702 Ga0495680_0155702_415_1029 204
631 3300047322 Ga0495680_0250047 Ga0495680_0250047_144_758 204
632 3300047444 Ga0495675_0004906 Ga0495675_0004906_2409_3023 204
633 3300047444 Ga0495675_0058436 Ga0495675_0058436_1773_2387 204
634 3300047471 Ga0495684_0163908 Ga0495684_0163908_204_821 204
635 3300047471 Ga0495684_0275376 Ga0495684_0275376_187_846 204
636 3300048088 Ga0495602_0001212 Ga0495602_0001212_58_672 204
637 3300048913 Ga0496110_0623990 Ga0496110_0623990_207_866 204
638 3300048914 Ga0496111_0055749 Ga0496111_0055749_1302_1916 204
639 3300048915 Ga0496112_0032394 Ga0496112_0032394_2346_2960 204
640 3300048915 Ga0496112_0417860 Ga0496112_0417860_495_1154 204
641 3300048916 Ga0496113_0864091 Ga0496113_0864091_14_628 204
642 3300048924 Ga0496121_0455049 Ga0496121_0455049_27_641 204
643 3300048925 Ga0496122_0023070 Ga0496122_0023070_2613_3227 204
644 3300048929 Ga0496126_0013350 Ga0496126_0013350_4955_5569 204
645 3300049460 Ga0495682_0091435 Ga0495682_0091435_115_729 204
646 3300049530 Ga0501314_017178 Ga0501314_017178_29_697 204
647 3300049571 Ga0501034_0004819 Ga0501034_0004819_11163_11777 204
648 3300049571 Ga0501034_0016727 Ga0501034_0016727_3194_3808 204
649 3300049573 Ga0501037_0186539 Ga0501037_0186539_707_1321 204
650 3300049575 Ga0501039_0565176 Ga0501039_0565176_258_872 204
651 3300049579 Ga0501043_0224253 Ga0501043_0224253_695_1309 204
652 3300049580 Ga0501046_0060888 Ga0501046_0060888_205_819 204
653 3300049581 Ga0501047_0041380 Ga0501047_0041380_959_1573 204
654 3300049581 Ga0501047_0054183 Ga0501047_0054183_921_1535 204
655 3300049581 Ga0501047_0142342 Ga0501047_0142342_1589_2206 204
656 3300049581 Ga0501047_0217249 Ga0501047_0217249_62_676 204
657 3300049584 Ga0501068_0385104 Ga0501068_0385104_105_719 204
658 3300049585 Ga0501069_0152429 Ga0501069_0152429_197_811 204
659 3300049585 Ga0501069_0256089 Ga0501069_0256089_319_933 204
660 3300049586 Ga0501070_0056424 Ga0501070_0056424_2364_2978 204
661 3300049586 Ga0501070_0119097 Ga0501070_0119097_303_917 204
662 3300049586 Ga0501070_0293642 Ga0501070_0293642_301_915 204
663 3300049587 Ga0501071_0578014 Ga0501071_0578014_217_831 204
664 3300049588 Ga0501072_0424530 Ga0501072_0424530_85_699 204
665 3300049590 Ga0501074_0243881 Ga0501074_0243881_642_1256 204
666 3300049592 Ga0501076_0017711 Ga0501076_0017711_2433_3047 204
667 3300049741 Ga0501079_0085561 Ga0501079_0085561_31_645 204
668 3300049742 Ga0501080_0088499 Ga0501080_0088499_1913_2527 204
669 3300049742 Ga0501080_0263175 Ga0501080_0263175_921_1535 204
670 3300049744 Ga0501083_0042062 Ga0501083_0042062_878_1492 204
671 3300049744 Ga0501083_0598187 Ga0501083_0598187_53_667 204
672 3300049822 Ga0501035_0081967 Ga0501035_0081967_896_1510 204
673 3300049823 Ga0501044_0033540 Ga0501044_0033540_1350_1964 204
674 3300049823 Ga0501044_0080571 Ga0501044_0080571_157_771 204
675 3300049823 Ga0501044_0115392 Ga0501044_0115392_1218_1832 204
676 3300049824 Ga0501045_0050250 Ga0501045_0050250_602_1216 204
677 3300050489 nmdc:mga03683_21383_c1 nmdc:mga03683_21383_c1_839_1453 204
678 3300050489 nmdc:mga03683_27988_c1 nmdc:mga03683_27988_c1_1605_2219 204
679 3300050493 nmdc:mga0k408_80035_c1 nmdc:mga0k408_80035_c1_99_713 204
680 3300050495 nmdc:mga04h51_181829_c1 nmdc:mga04h51_181829_c1_87_713 204
681 3300050511 nmdc:mga08y16_531320_c1 nmdc:mga08y16_531320_c1_350_964 204
682 3300050512 nmdc:mga0n895_207979_c1 nmdc:mga0n895_207979_c1_694_1353 204
683 3300050516 nmdc:mga0sz30_253691_c1 nmdc:mga0sz30_253691_c1_135_767 204
684 3300053077 Ga0495601_0019087 Ga0495601_0019087_686_1300 204
685 3300053077 Ga0495601_0100751 Ga0495601_0100751_452_1111 204
686 3300053077 Ga0495601_0120318 Ga0495601_0120318_695_1309 204
687 3300053077 Ga0495601_0127333 Ga0495601_0127333_639_1256 204
688 3300053078 Ga0495612_0000161 Ga0495612_0000161_24685_25299 204
689 3300053084 Ga0495595_0019772 Ga0495595_0019772_411_1070 204
690 3300053084 Ga0495595_0029837 Ga0495595_0029837_1761_2375 204
691 3300053085 Ga0495619_0006176 Ga0495619_0006176_5638_6297 204
692 3300053085 Ga0495619_0083855 Ga0495619_0083855_555_1169 204
693 3300053085 Ga0495619_0167133 Ga0495619_0167133_545_1162 204
694 3300053091 Ga0500647_0091502 Ga0500647_0091502_189_833 204
695 3300053092 Ga0500583_0211399 Ga0500583_0211399_314_940 204
696 3300053096 Ga0500641_0002314 Ga0500641_0002314_2996_3610 204
697 3300053119 Ga0500595_004428 Ga0500595_004428_4496_5212 204
698 3300053146 Ga0500588_0138756 Ga0500588_0138756_26_640 204
699 3300053153 Ga0500616_0003157 Ga0500616_0003157_4524_5138 204
700 3300053153 Ga0500616_0070085 Ga0500616_0070085_1150_1764 204
701 3300053177 Ga0500636_0205418 Ga0500636_0205418_28_645 204
702 3300053178 Ga0500637_0100230 Ga0500637_0100230_760_1374 204
703 3300053730 Ga0500645_089423 Ga0500645_089423_43_657 204
704 3300053733 Ga0500552_000088 Ga0500552_000088_2567_3181 204
705 3300054114 Ga0501084_0213033 Ga0501084_0213033_968_1582 204
706 3300054114 Ga0501084_0452219 Ga0501084_0452219_270_884 204
707 3300059511 Ga0587091_057063 Ga0587091_057063_179_793 204
708 3300059623 Ga0587101_037436 Ga0587101_037436_102_716 204
709 3300059648 Ga0587100_011214 Ga0587100_011214_119_733 204
710 3300059652 Ga0587107_033646 Ga0587107_033646_14_628 204
711 3300060353 Ga0501082_0017161 Ga0501082_0017161_2799_3413 204
712 3300060353 Ga0501082_0753626 Ga0501082_0753626_103_717 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

127

174

0.99

PF00163

Ribosomal_S4

Ribosomal protein S4/S9 N-terminal domain

37

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9752 49 149
6vwl-assembly1.cif.gz_c 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9518 45 202
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9495 42 204
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9437 42 204
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9384 49 149
ID Description Score Start End Superfamily
af_A0A0P0Y445_123_179_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.992 93 135 3.10.290.10
af_Q4DSJ7_105_180_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9897 92 135 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9818 93 135 3.10.290.10
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9749 93 135 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9725 92 142 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A6A5LBZ0-F1-model_v4 deleted 0.9993 45 203
AF-A0A1E4F994-F1-model_v4 Small ribosomal subunit protein uS4 (30S ribosomal protein S4) 0.9974 53 204 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A848SWC6-F1-model_v4 Small ribosomal subunit protein uS4 (30S ribosomal protein S4) 0.9938 51 203 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A3B8QXB5-F1-model_v4 30S ribosomal protein S4 0.9931 70 203 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-A0A0F3QSG6-F1-model_v4 deleted 0.9913 43 204

Feature Viewer

pLDDT pTM Quality
83.46 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map