F476819
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 423 | 604 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100001426|Ga0070665_1000014263 |
| Length | 238 |
| Sequence | MWTKPKCLAPSRSRVSGDRLNYRDISENHQKVNVLSKRLDSKHKIDRRLGVNLWGRAKSPINRREYGPGQHGQRRKKPSDYGTQLMAKQKLKGYYGNIGERQFRRYYDEASRRKGDTSENMIELLERRLDTIVYRMKFVPTVFAARQFVSHGHVKLNGKRVTIPSISVKDGDVIELRDKVKELAIVLIAVDSGERDVPDYIDVDHKAMKGTFVRGPKLPDVPYPVQMEPHLVVEFYSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 9 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 12 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 13 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 14 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 15 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 16 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 17 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 18 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 19 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 20 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 21 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 22 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 23 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 24 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 25 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 26 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 27 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 28 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 29 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 30 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 31 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 32 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 33 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 34 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 35 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 36 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 37 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 38 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 39 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 40 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 41 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 42 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 43 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 44 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 45 | 2922368715 | |||
| 46 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 47 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 48 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 49 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 50 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 51 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 52 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 53 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 54 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 55 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 56 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 57 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 58 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 59 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 60 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 61 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 62 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 63 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 64 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 65 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 66 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 67 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 68 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 69 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 70 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 71 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 72 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 73 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 74 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 75 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 76 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 77 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 78 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 79 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 80 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 81 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 82 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 83 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 84 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 85 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 86 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 87 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 88 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 89 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 90 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 91 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 92 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 93 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 94 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 95 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 96 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 97 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 98 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 100 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 101 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 102 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 103 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 104 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 105 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 106 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 107 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 108 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 109 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 110 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 111 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 113 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 114 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 121 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 127 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 136 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 141 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 142 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 144 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 147 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 149 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 150 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 151 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 152 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 153 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 154 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 155 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 156 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 157 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 158 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 159 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 160 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 162 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 166 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 167 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 168 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 169 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 170 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 171 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 172 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 174 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 175 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 176 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 188 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 189 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 198 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300019162 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 206 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 207 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 208 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 211 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 212 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 213 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 214 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 215 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 216 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 269 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 270 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 276 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 277 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 278 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 280 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 281 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 282 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 293 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 310 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 311 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 312 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 313 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 315 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 316 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 319 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 393 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 394 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 397 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 400 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 401 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 402 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 410 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 411 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 412 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 413 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 414 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 415 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 416 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 417 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 418 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 419 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 420 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 421 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 422 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 423 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.32 |
| Metatranscriptomes | 5.63 |
| Isolates | 15.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.79 |
| Nodule | 12.22 |
| Rhizoplane | 0.84 |
| Rhizosphere | 75.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10089789 | 3300001989 | Bacteria | 936 |
| 2 | JGI25159J45721_1028911 | 3300002987 | Bacteria | 920 |
| 3 | Ga0006759J45824_1013627 | 3300003163 | Bacteria | 718 |
| 4 | JGI25151J46595_10000321 | 3300003187 | Bacteria | 51966 |
| 5 | JGI25406J46586_10075867 | 3300003203 | Bacteria | 1042 |
| 6 | JGI25153J46596_10026799 | 3300003215 | Bacteria | 2033 |
| 7 | rootH1_10196287 | 3300003316 | Bacteria | 1109 |
| 8 | rootL2_10030863 | 3300003322 | Bacteria | 3651 |
| 9 | JGI25160J50197_1009503 | 3300003354 | Bacteria | 3600 |
| 10 | Ga0007417J51691_1007909 | 3300003544 | Bacteria | 729 |
| 11 | Ga0007427J51700_106633 | 3300003559 | Bacteria | 733 |
| 12 | Ga0006781J51513_1006864 | 3300003568 | Bacteria | 729 |
| 13 | Ga0007410J51695_1007683 | 3300003574 | Bacteria | 728 |
| 14 | Ga0007409J51694_1009683 | 3300003575 | Bacteria | 729 |
| 15 | Ga0007416J51690_1010630 | 3300003577 | Bacteria | 727 |
| 16 | Ga0007429J51699_1006425 | 3300003579 | Bacteria | 736 |
| 17 | Ga0007429J51699_1016869 | 3300003579 | Bacteria | 725 |
| 18 | Ga0007411J51799_108223 | 3300003611 | Bacteria | 729 |
| 19 | Ga0032354_1003564 | 3300003693 | Bacteria | 729 |
| 20 | Ga0006780_1000822 | 3300003735 | Bacteria | 729 |
| 21 | Ga0058859_11729389 | 3300004798 | Bacteria | 678 |
| 22 | Ga0058863_11741356 | 3300004799 | Bacteria | 751 |
| 23 | Ga0058861_11962574 | 3300004800 | Bacteria | 774 |
| 24 | Ga0058862_12787350 | 3300004803 | Bacteria | 845 |
| 25 | Ga0070658_10005063 | 3300005327 | Bacteria | 10729 |
| 26 | Ga0070670_100223883 | 3300005331 | Bacteria | 1637 |
| 27 | Ga0070670_100444683 | 3300005331 | Bacteria | 1148 |
| 28 | Ga0070680_100006823 | 3300005336 | Bacteria | 8702 |
| 29 | Ga0070680_100231599 | 3300005336 | Bacteria | 1560 |
| 30 | Ga0070680_100236729 | 3300005336 | Bacteria | 1543 |
| 31 | Ga0070680_100504805 | 3300005336 | Bacteria | 1035 |
| 32 | Ga0068868_100057272 | 3300005338 | Bacteria | 3079 |
| 33 | Ga0070660_100173845 | 3300005339 | Bacteria | 1741 |
| 34 | Ga0070691_10074318 | 3300005341 | Bacteria | 1654 |
| 35 | Ga0070661_100049069 | 3300005344 | Bacteria | 3091 |
| 36 | Ga0070661_100658782 | 3300005344 | Bacteria | 850 |
| 37 | Ga0070671_100058811 | 3300005355 | Bacteria | 3199 |
| 38 | Ga0070671_100139744 | 3300005355 | Bacteria | 2044 |
| 39 | Ga0070674_100014625 | 3300005356 | Bacteria | 4883 |
| 40 | Ga0070688_100203439 | 3300005365 | Bacteria | 1386 |
| 41 | Ga0070709_10083542 | 3300005434 | Bacteria | 2089 |
| 42 | Ga0070709_10585260 | 3300005434 | Unclassified | 858 |
| 43 | Ga0070714_100000109 | 3300005435 | Bacteria | 68971 |
| 44 | Ga0070714_100053722 | 3300005435 | Bacteria | 3440 |
| 45 | Ga0070714_100125190 | 3300005435 | Bacteria | 2291 |
| 46 | Ga0070714_100204564 | 3300005435 | Bacteria | 1807 |
| 47 | Ga0070714_100881694 | 3300005435 | Bacteria | 868 |
| 48 | Ga0070714_100900979 | 3300005435 | Bacteria | 859 |
| 49 | Ga0070713_100003647 | 3300005436 | Bacteria | 10188 |
| 50 | Ga0070713_100009862 | 3300005436 | Bacteria | 6869 |
| 51 | Ga0070713_100081654 | 3300005436 | Bacteria | 2759 |
| 52 | Ga0070713_100864901 | 3300005436 | Bacteria | 868 |
| 53 | Ga0070713_101150857 | 3300005436 | Bacteria | 750 |
| 54 | Ga0070713_101218906 | 3300005436 | Bacteria | 728 |
| 55 | Ga0070710_10012410 | 3300005437 | Bacteria | 4231 |
| 56 | Ga0070710_10018319 | 3300005437 | Bacteria | 3601 |
| 57 | Ga0070710_10065125 | 3300005437 | Bacteria | 2087 |
| 58 | Ga0070710_10313858 | 3300005437 | Bacteria | 1027 |
| 59 | Ga0070711_100008458 | 3300005439 | Bacteria | 6303 |
| 60 | Ga0070711_100026740 | 3300005439 | Bacteria | 3784 |
| 61 | Ga0070711_100129600 | 3300005439 | Bacteria | 1877 |
| 62 | Ga0070711_100440784 | 3300005439 | Bacteria | 1065 |
| 63 | Ga0070700_100060273 | 3300005441 | Bacteria | 2391 |
| 64 | Ga0070708_100045787 | 3300005445 | Bacteria | 3857 |
| 65 | Ga0070708_100333786 | 3300005445 | Bacteria | 1429 |
| 66 | Ga0070708_100400331 | 3300005445 | Bacteria | 1294 |
| 67 | Ga0070708_101069620 | 3300005445 | Bacteria | 756 |
| 68 | Ga0070678_100009064 | 3300005456 | Bacteria | 5999 |
| 69 | Ga0070678_100222884 | 3300005456 | Bacteria | 1568 |
| 70 | Ga0070681_10009482 | 3300005458 | Bacteria | 9580 |
| 71 | Ga0070681_10010966 | 3300005458 | Bacteria | 8962 |
| 72 | Ga0070681_10038254 | 3300005458 | Bacteria | 4810 |
| 73 | Ga0070681_10082512 | 3300005458 | Bacteria | 3170 |
| 74 | Ga0070681_10218318 | 3300005458 | Bacteria | 1822 |
| 75 | Ga0070681_10364739 | 3300005458 | Bacteria | 1355 |
| 76 | Ga0070681_10603751 | 3300005458 | Bacteria | 1012 |
| 77 | Ga0070706_100428236 | 3300005467 | Bacteria | 1231 |
| 78 | Ga0070706_101025644 | 3300005467 | Bacteria | 760 |
| 79 | Ga0070707_100067654 | 3300005468 | Bacteria | 3437 |
| 80 | Ga0070698_100009525 | 3300005471 | Bacteria | 10401 |
| 81 | Ga0070698_100009857 | 3300005471 | Bacteria | 10211 |
| 82 | Ga0070698_100066659 | 3300005471 | Bacteria | 3622 |
| 83 | Ga0070698_100142108 | 3300005471 | Bacteria | 2351 |
| 84 | Ga0070699_100033732 | 3300005518 | Bacteria | 4423 |
| 85 | Ga0070699_100293855 | 3300005518 | Bacteria | 1457 |
| 86 | Ga0070679_100001570 | 3300005530 | Bacteria | 20460 |
| 87 | Ga0070679_100046569 | 3300005530 | Bacteria | 4322 |
| 88 | Ga0070679_100714999 | 3300005530 | Bacteria | 944 |
| 89 | Ga0070684_100015453 | 3300005535 | Bacteria | 6217 |
| 90 | Ga0070684_100629529 | 3300005535 | Bacteria | 998 |
| 91 | Ga0070697_100145510 | 3300005536 | Bacteria | 1995 |
| 92 | Ga0070697_100208960 | 3300005536 | Bacteria | 1661 |
| 93 | Ga0070697_100356560 | 3300005536 | Bacteria | 1264 |
| 94 | Ga0068853_100027384 | 3300005539 | Bacteria | 4789 |
| 95 | Ga0068853_100027444 | 3300005539 | Bacteria | 4783 |
| 96 | Ga0068853_100484974 | 3300005539 | Bacteria | 1166 |
| 97 | Ga0070693_100655141 | 3300005547 | Bacteria | 764 |
| 98 | Ga0070665_100001426 | 3300005548 | Bacteria | 28036 |
| 99 | Ga0070665_100669652 | 3300005548 | Bacteria | 1051 |
| 100 | Ga0070665_100863405 | 3300005548 | Bacteria | 918 |
| 101 | Ga0068855_100055194 | 3300005563 | Bacteria | 4667 |
| 102 | Ga0068855_100235756 | 3300005563 | Bacteria | 2046 |
| 103 | Ga0068855_100290054 | 3300005563 | Unclassified | 1814 |
| 104 | Ga0070664_100063094 | 3300005564 | Bacteria | 3159 |
| 105 | Ga0068857_100024941 | 3300005577 | Bacteria | 5267 |
| 106 | Ga0068857_100285705 | 3300005577 | Bacteria | 1518 |
| 107 | Ga0068857_100816329 | 3300005577 | Bacteria | 891 |
| 108 | Ga0068854_100089788 | 3300005578 | Bacteria | 2284 |
| 109 | Ga0068856_100048767 | 3300005614 | Bacteria | 4174 |
| 110 | Ga0068856_100051884 | 3300005614 | Bacteria | 4044 |
| 111 | Ga0068856_100118153 | 3300005614 | Bacteria | 2652 |
| 112 | Ga0068856_100404474 | 3300005614 | Bacteria | 1385 |
| 113 | Ga0068856_100588586 | 3300005614 | Bacteria | 1134 |
| 114 | Ga0068852_100048736 | 3300005616 | Bacteria | 3621 |
| 115 | Ga0068859_101207513 | 3300005617 | Bacteria | 833 |
| 116 | Ga0068851_10277963 | 3300005834 | Bacteria | 957 |
| 117 | Ga0068870_10289542 | 3300005840 | Bacteria | 1030 |
| 118 | Ga0068860_100080670 | 3300005843 | Bacteria | 3094 |
| 119 | Ga0081455_10000434 | 3300005937 | Bacteria | 54939 |
| 120 | Ga0081455_10008590 | 3300005937 | Bacteria | 10600 |
| 121 | Ga0081455_10183324 | 3300005937 | Bacteria | 1583 |
| 122 | Ga0081455_10392483 | 3300005937 | Bacteria | 966 |
| 123 | Ga0081538_10076130 | 3300005981 | Bacteria | 1816 |
| 124 | Ga0081540_1042357 | 3300005983 | Bacteria | 2349 |
| 125 | Ga0081540_1149827 | 3300005983 | Bacteria | 922 |
| 126 | Ga0081539_10013066 | 3300005985 | Bacteria | 6298 |
| 127 | Ga0070717_10000675 | 3300006028 | Bacteria | 21977 |
| 128 | Ga0070717_10090048 | 3300006028 | Bacteria | 2588 |
| 129 | Ga0070717_10233523 | 3300006028 | Bacteria | 1620 |
| 130 | Ga0070717_10776108 | 3300006028 | Bacteria | 871 |
| 131 | Ga0075365_10083846 | 3300006038 | Bacteria | 2162 |
| 132 | Ga0070715_10267458 | 3300006163 | Bacteria | 901 |
| 133 | Ga0070716_100102764 | 3300006173 | Bacteria | 1756 |
| 134 | Ga0070712_100028391 | 3300006175 | Bacteria | 3742 |
| 135 | Ga0070712_100064734 | 3300006175 | Bacteria | 2593 |
| 136 | Ga0070712_100163788 | 3300006175 | Bacteria | 1719 |
| 137 | Ga0070712_100440277 | 3300006175 | Bacteria | 1083 |
| 138 | Ga0075362_10002476 | 3300006177 | Bacteria | 6211 |
| 139 | Ga0075362_10037714 | 3300006177 | Bacteria | 2120 |
| 140 | Ga0075366_10006532 | 3300006195 | Bacteria | 6394 |
| 141 | Ga0075370_10139193 | 3300006353 | Bacteria | 1418 |
| 142 | Ga0068871_100556839 | 3300006358 | Bacteria | 1039 |
| 143 | Ga0075431_100458226 | 3300006847 | Bacteria | 1270 |
| 144 | Ga0075434_100303580 | 3300006871 | Bacteria | 1617 |
| 145 | Ga0075434_100320767 | 3300006871 | Bacteria | 1570 |
| 146 | Ga0075436_100190084 | 3300006914 | Bacteria | 1452 |
| 147 | Ga0097620_101207258 | 3300006931 | Bacteria | 833 |
| 148 | Ga0075435_100095352 | 3300007076 | Bacteria | 2460 |
| 149 | Ga0099794_10080472 | 3300007265 | Bacteria | 1606 |
| 150 | Ga0099794_10250257 | 3300007265 | Bacteria | 914 |
| 151 | Ga0099795_10039719 | 3300007788 | Bacteria | 1667 |
| 152 | Ga0099795_10043886 | 3300007788 | Bacteria | 1601 |
| 153 | Ga0099795_10308681 | 3300007788 | Bacteria | 698 |
| 154 | Ga0105240_10000330 | 3300009093 | Bacteria | 89049 |
| 155 | Ga0105240_10000580 | 3300009093 | Bacteria | 67901 |
| 156 | Ga0105240_10014265 | 3300009093 | Bacteria | 10855 |
| 157 | Ga0105240_10090761 | 3300009093 | Bacteria | 3733 |
| 158 | Ga0105240_10213313 | 3300009093 | Bacteria | 2254 |
| 159 | Ga0105240_10224624 | 3300009093 | Bacteria | 2186 |
| 160 | Ga0105240_10456714 | 3300009093 | Bacteria | 1428 |
| 161 | Ga0105240_10565073 | 3300009093 | Bacteria | 1257 |
| 162 | Ga0105240_10668720 | 3300009093 | Bacteria | 1136 |
| 163 | Ga0111539_10497407 | 3300009094 | Bacteria | 1420 |
| 164 | Ga0105245_10066311 | 3300009098 | Bacteria | 3267 |
| 165 | Ga0114129_10798305 | 3300009147 | Bacteria | 1204 |
| 166 | Ga0105243_10847438 | 3300009148 | Bacteria | 905 |
| 167 | Ga0105241_10413912 | 3300009174 | Bacteria | 1185 |
| 168 | Ga0105242_10270422 | 3300009176 | Bacteria | 1539 |
| 169 | Ga0105248_10137227 | 3300009177 | Bacteria | 2759 |
| 170 | Ga0105237_10105821 | 3300009545 | Bacteria | 2805 |
| 171 | Ga0105238_10132022 | 3300009551 | Bacteria | 2475 |
| 172 | Ga0105238_10787665 | 3300009551 | Bacteria | 966 |
| 173 | Ga0105249_10391980 | 3300009553 | Bacteria | 1417 |
| 174 | Ga0105033_104574 | 3300009986 | Bacteria | 1178 |
| 175 | Ga0099796_10018908 | 3300010159 | Bacteria | 2079 |
| 176 | Ga0105239_10148242 | 3300010375 | Bacteria | 2618 |
| 177 | Ga0105239_10588478 | 3300010375 | Bacteria | 1269 |
| 178 | Ga0157371_10070102 | 3300013102 | Bacteria | 2482 |
| 179 | Ga0157371_10213281 | 3300013102 | Bacteria | 1386 |
| 180 | Ga0157370_10005028 | 3300013104 | Bacteria | 14935 |
| 181 | Ga0157370_10019229 | 3300013104 | Bacteria | 6860 |
| 182 | Ga0157370_10025363 | 3300013104 | Bacteria | 5869 |
| 183 | Ga0157370_10075051 | 3300013104 | Bacteria | 3189 |
| 184 | Ga0157369_10160168 | 3300013105 | Bacteria | 2375 |
| 185 | Ga0157374_10040559 | 3300013296 | Bacteria | 4288 |
| 186 | Ga0157374_10544380 | 3300013296 | Bacteria | 1168 |
| 187 | Ga0157374_10653097 | 3300013296 | Bacteria | 1064 |
| 188 | Ga0157378_10218204 | 3300013297 | Bacteria | 1812 |
| 189 | Ga0157378_11217626 | 3300013297 | Bacteria | 793 |
| 190 | Ga0157372_11118657 | 3300013307 | Bacteria | 911 |
| 191 | Ga0163163_10088190 | 3300014325 | Bacteria | 3114 |
| 192 | Ga0163163_10132205 | 3300014325 | Bacteria | 2536 |
| 193 | Ga0163163_10366989 | 3300014325 | Bacteria | 1497 |
| 194 | Ga0163163_10403293 | 3300014325 | Bacteria | 1425 |
| 195 | Ga0182008_10005670 | 3300014497 | Bacteria | 7071 |
| 196 | Ga0182008_10062439 | 3300014497 | Bacteria | 1836 |
| 197 | Ga0182008_10073565 | 3300014497 | Bacteria | 1681 |
| 198 | Ga0157377_10368228 | 3300014745 | Bacteria | 969 |
| 199 | Ga0157376_10023876 | 3300014969 | Bacteria | 4794 |
| 200 | Ga0157376_10193645 | 3300014969 | Bacteria | 1866 |
| 201 | Ga0163161_10962790 | 3300017792 | Bacteria | 727 |
| 202 | Ga0184597_126673 | 3300019162 | Bacteria | 864 |
| 203 | Ga0184595_115712 | 3300019166 | Bacteria | 768 |
| 204 | Ga0184598_112434 | 3300019182 | Bacteria | 795 |
| 205 | Ga0184599_106266 | 3300019188 | Bacteria | 742 |
| 206 | Ga0197907_10436073 | 3300020069 | Bacteria | 1273 |
| 207 | Ga0206356_11602332 | 3300020070 | Bacteria | 787 |
| 208 | Ga0206355_1429787 | 3300020076 | Bacteria | 754 |
| 209 | Ga0206351_10868433 | 3300020077 | Bacteria | 706 |
| 210 | Ga0206352_11164371 | 3300020078 | Bacteria | 747 |
| 211 | Ga0213873_10022034 | 3300021358 | Bacteria | 1505 |
| 212 | Ga0213872_10000696 | 3300021361 | Bacteria | 25247 |
| 213 | Ga0213872_10063159 | 3300021361 | Bacteria | 1674 |
| 214 | Ga0213872_10132681 | 3300021361 | Bacteria | 1096 |
| 215 | Ga0213876_10024314 | 3300021384 | Bacteria | 3197 |
| 216 | Ga0213875_10000081 | 3300021388 | Bacteria | 114181 |
| 217 | Ga0213875_10002212 | 3300021388 | Bacteria | 11841 |
| 218 | Ga0213875_10003351 | 3300021388 | Bacteria | 9140 |
| 219 | Ga0213875_10017999 | 3300021388 | Bacteria | 3409 |
| 220 | Ga0213875_10082814 | 3300021388 | Bacteria | 1497 |
| 221 | Ga0213871_10002467 | 3300021441 | Bacteria | 3406 |
| 222 | Ga0213871_10010292 | 3300021441 | Bacteria | 2118 |
| 223 | Ga0213871_10098501 | 3300021441 | Bacteria | 854 |
| 224 | Ga0224712_10296943 | 3300022467 | Bacteria | 755 |
| 225 | Ga0247552_101207 | 3300023536 | Bacteria | 755 |
| 226 | Ga0247555_101092 | 3300023539 | Bacteria | 801 |
| 227 | Ga0247554_100379 | 3300023547 | Bacteria | 1225 |
| 228 | Ga0247550_100572 | 3300023660 | Bacteria | 987 |
| 229 | Ga0209025_1000224 | 3300025294 | Bacteria | 133328 |
| 230 | Ga0209758_1001111 | 3300025297 | Bacteria | 34637 |
| 231 | Ga0207692_10049055 | 3300025898 | Bacteria | 2129 |
| 232 | Ga0207692_10108437 | 3300025898 | Bacteria | 1536 |
| 233 | Ga0207692_10112568 | 3300025898 | Bacteria | 1511 |
| 234 | Ga0207680_10270975 | 3300025903 | Bacteria | 1177 |
| 235 | Ga0207685_10311713 | 3300025905 | Bacteria | 782 |
| 236 | Ga0207699_10005358 | 3300025906 | Bacteria | 6149 |
| 237 | Ga0207699_10111722 | 3300025906 | Bacteria | 1752 |
| 238 | Ga0207699_10264784 | 3300025906 | Bacteria | 1189 |
| 239 | Ga0207705_10037180 | 3300025909 | Bacteria | 3483 |
| 240 | Ga0207684_10098817 | 3300025910 | Bacteria | 2493 |
| 241 | Ga0207707_10002418 | 3300025912 | Bacteria | 16797 |
| 242 | Ga0207707_10010162 | 3300025912 | Bacteria | 8167 |
| 243 | Ga0207707_10021504 | 3300025912 | Bacteria | 5639 |
| 244 | Ga0207707_10331316 | 3300025912 | Bacteria | 1313 |
| 245 | Ga0207695_10000690 | 3300025913 | Bacteria | 66191 |
| 246 | Ga0207695_10002225 | 3300025913 | Bacteria | 29133 |
| 247 | Ga0207695_10265920 | 3300025913 | Bacteria | 1611 |
| 248 | Ga0207695_10292078 | 3300025913 | Bacteria | 1522 |
| 249 | Ga0207671_10133171 | 3300025914 | Bacteria | 1909 |
| 250 | Ga0207693_10001564 | 3300025915 | Bacteria | 20202 |
| 251 | Ga0207693_10004020 | 3300025915 | Bacteria | 12497 |
| 252 | Ga0207693_10071776 | 3300025915 | Bacteria | 2710 |
| 253 | Ga0207693_10087373 | 3300025915 | Bacteria | 2443 |
| 254 | Ga0207693_10121789 | 3300025915 | Bacteria | 2049 |
| 255 | Ga0207693_10442644 | 3300025915 | Bacteria | 1016 |
| 256 | Ga0207663_10185316 | 3300025916 | Bacteria | 1490 |
| 257 | Ga0207663_10261053 | 3300025916 | Bacteria | 1279 |
| 258 | Ga0207663_10282525 | 3300025916 | Bacteria | 1233 |
| 259 | Ga0207663_10559096 | 3300025916 | Bacteria | 895 |
| 260 | Ga0207660_10029298 | 3300025917 | Bacteria | 3774 |
| 261 | Ga0207660_10122502 | 3300025917 | Bacteria | 1971 |
| 262 | Ga0207660_10841770 | 3300025917 | Bacteria | 749 |
| 263 | Ga0207662_10315116 | 3300025918 | Bacteria | 1043 |
| 264 | Ga0207662_10329006 | 3300025918 | Bacteria | 1022 |
| 265 | Ga0207657_10060068 | 3300025919 | Bacteria | 3263 |
| 266 | Ga0207652_10010284 | 3300025921 | Bacteria | 7531 |
| 267 | Ga0207652_10045957 | 3300025921 | Bacteria | 3724 |
| 268 | Ga0207652_10163196 | 3300025921 | Bacteria | 1997 |
| 269 | Ga0207646_10130656 | 3300025922 | Bacteria | 2260 |
| 270 | Ga0207646_10169845 | 3300025922 | Bacteria | 1969 |
| 271 | Ga0207681_10093653 | 3300025923 | Bacteria | 2151 |
| 272 | Ga0207694_10001133 | 3300025924 | Bacteria | 23069 |
| 273 | Ga0207650_10294643 | 3300025925 | Bacteria | 1324 |
| 274 | Ga0207687_10628459 | 3300025927 | Bacteria | 907 |
| 275 | Ga0207700_10193917 | 3300025928 | Bacteria | 1708 |
| 276 | Ga0207700_10416491 | 3300025928 | Bacteria | 1179 |
| 277 | Ga0207700_10530834 | 3300025928 | Bacteria | 1043 |
| 278 | Ga0207700_10795096 | 3300025928 | Bacteria | 846 |
| 279 | Ga0207700_10864868 | 3300025928 | Bacteria | 809 |
| 280 | Ga0207700_11098278 | 3300025928 | Bacteria | 711 |
| 281 | Ga0207664_10000469 | 3300025929 | Bacteria | 28522 |
| 282 | Ga0207664_10075846 | 3300025929 | Bacteria | 2720 |
| 283 | Ga0207664_10150290 | 3300025929 | Bacteria | 1978 |
| 284 | Ga0207664_10267068 | 3300025929 | Bacteria | 1498 |
| 285 | Ga0207664_10271330 | 3300025929 | Bacteria | 1486 |
| 286 | Ga0207664_10368301 | 3300025929 | Bacteria | 1274 |
| 287 | Ga0207664_10406261 | 3300025929 | Bacteria | 1212 |
| 288 | Ga0207664_10556154 | 3300025929 | Bacteria | 1030 |
| 289 | Ga0207664_10969780 | 3300025929 | Bacteria | 762 |
| 290 | Ga0207644_10085096 | 3300025931 | Bacteria | 2345 |
| 291 | Ga0207644_10200692 | 3300025931 | Bacteria | 1573 |
| 292 | Ga0207644_10379240 | 3300025931 | Bacteria | 1153 |
| 293 | Ga0207686_10535078 | 3300025934 | Bacteria | 914 |
| 294 | Ga0207670_10149495 | 3300025936 | Bacteria | 1731 |
| 295 | Ga0207669_10261132 | 3300025937 | Bacteria | 1295 |
| 296 | Ga0207665_10255896 | 3300025939 | Bacteria | 1295 |
| 297 | Ga0207691_10199553 | 3300025940 | Bacteria | 1742 |
| 298 | Ga0207661_10052671 | 3300025944 | Bacteria | 3252 |
| 299 | Ga0207661_11349310 | 3300025944 | Bacteria | 655 |
| 300 | Ga0207679_10017685 | 3300025945 | Bacteria | 4760 |
| 301 | Ga0207679_11211304 | 3300025945 | Bacteria | 693 |
| 302 | Ga0207667_10007312 | 3300025949 | Bacteria | 13301 |
| 303 | Ga0207667_10065952 | 3300025949 | Bacteria | 3775 |
| 304 | Ga0207640_10057329 | 3300025981 | Bacteria | 2561 |
| 305 | Ga0207640_10070109 | 3300025981 | Bacteria | 2356 |
| 306 | Ga0207677_10050579 | 3300026023 | Bacteria | 2812 |
| 307 | Ga0207703_10233530 | 3300026035 | Bacteria | 1650 |
| 308 | Ga0207639_10009123 | 3300026041 | Bacteria | 6836 |
| 309 | Ga0207678_10793541 | 3300026067 | Bacteria | 836 |
| 310 | Ga0207702_10067990 | 3300026078 | Bacteria | 3060 |
| 311 | Ga0207702_10092366 | 3300026078 | Bacteria | 2652 |
| 312 | Ga0207702_10139820 | 3300026078 | Bacteria | 2189 |
| 313 | Ga0207702_10948179 | 3300026078 | Bacteria | 853 |
| 314 | Ga0207648_10444482 | 3300026089 | Bacteria | 1180 |
| 315 | Ga0207676_10306403 | 3300026095 | Bacteria | 1452 |
| 316 | Ga0207674_10269548 | 3300026116 | Bacteria | 1650 |
| 317 | Ga0207674_10373325 | 3300026116 | Bacteria | 1378 |
| 318 | Ga0207675_100896267 | 3300026118 | Bacteria | 903 |
| 319 | Ga0207683_10016904 | 3300026121 | Bacteria | 6208 |
| 320 | Ga0209179_1012847 | 3300027512 | Bacteria | 1512 |
| 321 | Ga0209179_1014909 | 3300027512 | Bacteria | 1435 |
| 322 | Ga0209179_1044509 | 3300027512 | Bacteria | 940 |
| 323 | Ga0209588_1067866 | 3300027671 | Bacteria | 1152 |
| 324 | Ga0268264_10056033 | 3300028381 | Bacteria | 3294 |
| 325 | Ga0265338_10030246 | 3300028800 | Bacteria | 5343 |
| 326 | Ga0265338_10068686 | 3300028800 | Bacteria | 3051 |
| 327 | Ga0265338_10153257 | 3300028800 | Bacteria | 1788 |
| 328 | Ga0310982_135131 | 3300029283 | Bacteria | 726 |
| 329 | Ga0310981_1078795 | 3300029285 | Bacteria | 1326 |
| 330 | Ga0265769_102505 | 3300030888 | Bacteria | 969 |
| 331 | Ga0265332_10042540 | 3300031238 | Bacteria | 1964 |
| 332 | Ga0265320_10145120 | 3300031240 | Bacteria | 1073 |
| 333 | Ga0265331_10030442 | 3300031250 | Bacteria | 2687 |
| 334 | Ga0265327_10001626 | 3300031251 | Bacteria | 27106 |
| 335 | Ga0265327_10007634 | 3300031251 | Bacteria | 8288 |
| 336 | Ga0265316_10181079 | 3300031344 | Bacteria | 1569 |
| 337 | Ga0307408_100975967 | 3300031548 | Bacteria | 780 |
| 338 | Ga0265313_10004920 | 3300031595 | Bacteria | 10009 |
| 339 | Ga0265313_10183153 | 3300031595 | Bacteria | 879 |
| 340 | Ga0265313_10246670 | 3300031595 | Bacteria | 729 |
| 341 | Ga0265314_10017169 | 3300031711 | Bacteria | 5687 |
| 342 | Ga0265314_10038253 | 3300031711 | Bacteria | 3469 |
| 343 | Ga0265314_10041957 | 3300031711 | Bacteria | 3269 |
| 344 | Ga0265314_10058218 | 3300031711 | Bacteria | 2649 |
| 345 | Ga0307406_10238069 | 3300031901 | Bacteria | 1364 |
| 346 | Ga0307407_10077620 | 3300031903 | Bacteria | 1998 |
| 347 | Ga0307409_100511303 | 3300031995 | Bacteria | 1172 |
| 348 | Ga0373948_0068046 | 3300034817 | Bacteria | 794 |
| 349 | Ga0373929_0017915 | 3300035085 | Bacteria | 1403 |
| 350 | Ga0373934_0115189 | 3300035086 | Bacteria | 1092 |
| 351 | Ga0373944_0041225 | 3300035089 | Bacteria | 1428 |
| 352 | Ga0373923_0015841 | 3300035111 | Bacteria | 2853 |
| 353 | Ga0373923_0195262 | 3300035111 | Bacteria | 934 |
| 354 | Ga0373936_0177722 | 3300035113 | Bacteria | 933 |
| 355 | Ga0373945_0122282 | 3300035116 | Bacteria | 1036 |
| 356 | Ga0373945_0188062 | 3300035116 | Bacteria | 853 |
| 357 | Ga0373953_0003261 | 3300035117 | Bacteria | 5032 |
| 358 | Ga0373953_0008351 | 3300035117 | Bacteria | 3514 |
| 359 | Ga0373954_0053017 | 3300035118 | Bacteria | 1906 |
| 360 | Ga0373954_0135544 | 3300035118 | Bacteria | 1200 |
| 361 | Ga0373956_0101827 | 3300035119 | Bacteria | 1333 |
| 362 | Ga0373956_0122694 | 3300035119 | Bacteria | 1214 |
| 363 | Ga0373943_0011117 | 3300035170 | Bacteria | 4046 |
| 364 | Ga0373943_0199520 | 3300035170 | Bacteria | 1107 |
| 365 | Ga0373943_0432294 | 3300035170 | Bacteria | 763 |
| 366 | Ga0373946_0016224 | 3300035171 | Bacteria | 2836 |
| 367 | Ga0373955_0024645 | 3300035172 | Bacteria | 3079 |
| 368 | Ga0373955_0072968 | 3300035172 | Bacteria | 1923 |
| 369 | Ga0373955_0251431 | 3300035172 | Bacteria | 1060 |
| 370 | Ga0373961_0150318 | 3300035241 | Bacteria | 793 |
| 371 | Ga0373935_0122256 | 3300035692 | Bacteria | 1741 |
| 372 | Ga0373935_0147915 | 3300035692 | Bacteria | 1592 |
| 373 | Ga0373935_0233176 | 3300035692 | Bacteria | 1282 |
| 374 | Ga0373935_0670760 | 3300035692 | Bacteria | 761 |
| 375 | Ga0373927_0034688 | 3300035695 | Bacteria | 3281 |
| 376 | Ga0373927_0084876 | 3300035695 | Bacteria | 2054 |
| 377 | Ga0373927_0088890 | 3300035695 | Bacteria | 2006 |
| 378 | Ga0373927_0145574 | 3300035695 | Bacteria | 1551 |
| 379 | Ga0373933_0004435 | 3300035724 | Bacteria | 7702 |
| 380 | Ga0373933_0116798 | 3300035724 | Bacteria | 1668 |
| 381 | Ga0373933_0158524 | 3300035724 | Bacteria | 1436 |
| 382 | Ga0373933_0194417 | 3300035724 | Bacteria | 1297 |
| 383 | Ga0373947_0027624 | 3300035725 | Bacteria | 3322 |
| 384 | Ga0373947_0081675 | 3300035725 | Bacteria | 2002 |
| 385 | Ga0373947_0140667 | 3300035725 | Bacteria | 1548 |
| 386 | Ga0373947_0241326 | 3300035725 | Bacteria | 1192 |
| 387 | Ga0373947_0459410 | 3300035725 | Bacteria | 863 |
| 388 | Ga0373937_0002465 | 3300036401 | Bacteria | 15386 |
| 389 | Ga0373937_0017368 | 3300036401 | Bacteria | 6408 |
| 390 | Ga0373937_0018071 | 3300036401 | Bacteria | 6289 |
| 391 | Ga0373937_0037918 | 3300036401 | Bacteria | 4392 |
| 392 | Ga0373937_0258096 | 3300036401 | Bacteria | 1643 |
| 393 | Ga0373925_0080723 | 3300037068 | Bacteria | 2472 |
| 394 | Ga0373925_0081164 | 3300037068 | Bacteria | 2466 |
| 395 | Ga0373925_0189682 | 3300037068 | Bacteria | 1630 |
| 396 | Ga0373925_0245844 | 3300037068 | Bacteria | 1434 |
| 397 | Ga0373925_0538401 | 3300037068 | Bacteria | 960 |
| 398 | Ga0373925_0706536 | 3300037068 | Bacteria | 831 |
| 399 | Ga0395899_0007141 | 3300037312 | Bacteria | 8643 |
| 400 | Ga0395900_0007046 | 3300037418 | Bacteria | 11641 |
| 401 | Ga0395900_0050126 | 3300037418 | Bacteria | 4300 |
| 402 | Ga0395900_0066219 | 3300037418 | Bacteria | 3713 |
| 403 | Ga0395900_0200017 | 3300037418 | Bacteria | 2022 |
| 404 | Ga0395898_0004350 | 3300037466 | Bacteria | 15504 |
| 405 | Ga0395898_0004896 | 3300037466 | Bacteria | 14540 |
| 406 | Ga0395898_0042229 | 3300037466 | Bacteria | 4500 |
| 407 | Ga0395898_0514369 | 3300037466 | Bacteria | 1138 |
| 408 | Ga0395905_0015055 | 3300037471 | Bacteria | 7369 |
| 409 | Ga0395905_0548964 | 3300037471 | Bacteria | 1057 |
| 410 | Ga0436364_0102143 | 3300037853 | Bacteria | 3594 |
| 411 | Ga0436364_0143195 | 3300037853 | Bacteria | 55817 |
| 412 | Ga0436364_0196111 | 3300037853 | Bacteria | 1134 |
| 413 | Ga0436364_0207976 | 3300037853 | Bacteria | 3452 |
| 414 | Ga0436364_0593151 | 3300037853 | Bacteria | 810 |
| 415 | Ga0436364_0848167 | 3300037853 | Bacteria | 2108 |
| 416 | Ga0436364_1003761 | 3300037853 | Bacteria | 814 |
| 417 | Ga0436364_1069888 | 3300037853 | Bacteria | 65342 |
| 418 | Ga0436364_1335623 | 3300037853 | Bacteria | 3916 |
| 419 | Ga0395901_0001851 | 3300038443 | Bacteria | 21879 |
| 420 | Ga0395901_0011526 | 3300038443 | Bacteria | 8957 |
| 421 | Ga0395901_0072152 | 3300038443 | Bacteria | 3598 |
| 422 | Ga0395901_0763822 | 3300038443 | Bacteria | 959 |
| 423 | Ga0436365_0160653 | 3300039437 | Bacteria | 1222 |
| 424 | Ga0436365_0406357 | 3300039437 | Bacteria | 797 |
| 425 | Ga0436365_0473729 | 3300039437 | Bacteria | 2146 |
| 426 | Ga0436365_1267353 | 3300039437 | Bacteria | 2831 |
| 427 | Ga0436365_1510338 | 3300039437 | Bacteria | 7371 |
| 428 | Ga0436365_1540036 | 3300039437 | Bacteria | 5164 |
| 429 | Ga0436365_1789092 | 3300039437 | Bacteria | 909 |
| 430 | Ga0436365_1835715 | 3300039437 | Bacteria | 1694 |
| 431 | Ga0436360_0050291 | 3300039438 | Bacteria | 1063 |
| 432 | Ga0436360_0399866 | 3300039438 | Bacteria | 6042 |
| 433 | Ga0436360_0429557 | 3300039438 | Bacteria | 8132 |
| 434 | Ga0436360_0490313 | 3300039438 | Bacteria | 2736 |
| 435 | Ga0436360_0517823 | 3300039438 | Bacteria | 1527 |
| 436 | Ga0436360_0561465 | 3300039438 | Bacteria | 3508 |
| 437 | Ga0436360_0660398 | 3300039438 | Bacteria | 2397 |
| 438 | Ga0436360_0759298 | 3300039438 | Bacteria | 854 |
| 439 | Ga0436360_1064075 | 3300039438 | Bacteria | 967 |
| 440 | Ga0436360_1222696 | 3300039438 | Bacteria | 846 |
| 441 | Ga0436360_1254791 | 3300039438 | Bacteria | 675 |
| 442 | Ga0436361_0085302 | 3300039447 | Bacteria | 5482 |
| 443 | Ga0436361_0210296 | 3300039447 | Bacteria | 952 |
| 444 | Ga0436361_0221120 | 3300039447 | Bacteria | 24197 |
| 445 | Ga0436361_0450680 | 3300039447 | Bacteria | 4330 |
| 446 | Ga0436361_0602217 | 3300039447 | Bacteria | 2355 |
| 447 | Ga0436361_0694107 | 3300039447 | Bacteria | 1264 |
| 448 | Ga0436361_0862442 | 3300039447 | Bacteria | 965 |
| 449 | Ga0436361_0972347 | 3300039447 | Bacteria | 4631 |
| 450 | Ga0436361_0999687 | 3300039447 | Bacteria | 1843 |
| 451 | Ga0436363_0060299 | 3300039450 | Bacteria | 1981 |
| 452 | Ga0436363_0523610 | 3300039450 | Bacteria | 1582 |
| 453 | Ga0436363_0592968 | 3300039450 | Bacteria | 2562 |
| 454 | Ga0436363_0933867 | 3300039450 | Bacteria | 1271 |
| 455 | Ga0436363_1453647 | 3300039450 | Bacteria | 2026 |
| 456 | Ga0436362_0289387 | 3300039453 | Bacteria | 1236 |
| 457 | Ga0436362_0411021 | 3300039453 | Bacteria | 885 |
| 458 | Ga0436362_0604955 | 3300039453 | Bacteria | 6949 |
| 459 | Ga0436362_0630243 | 3300039453 | Unclassified | 1614 |
| 460 | Ga0436362_0787739 | 3300039453 | Bacteria | 1108 |
| 461 | Ga0436362_0993979 | 3300039453 | Bacteria | 7857 |
| 462 | Ga0436362_1076558 | 3300039453 | Bacteria | 736 |
| 463 | Ga0436362_1141189 | 3300039453 | Bacteria | 864 |
| 464 | Ga0436362_1288810 | 3300039453 | Bacteria | 911 |
| 465 | Ga0451800_0474877 | 3300041459 | Bacteria | 1440 |
| 466 | Ga0439431_0073355 | 3300041997 | Bacteria | 915 |
| 467 | Ga0466963_0396486 | 3300044694 | Bacteria | 973 |
| 468 | Ga0466964_0015509 | 3300044706 | Bacteria | 2901 |
| 469 | Ga0453684_0000062 | 3300044712 | Bacteria | 487590 |
| 470 | Ga0453684_0000071 | 3300044712 | Bacteria | 448904 |
| 471 | Ga0453684_0004682 | 3300044712 | Bacteria | 28347 |
| 472 | Ga0453684_0601082 | 3300044712 | Bacteria | 1206 |
| 473 | Ga0466957_0028639 | 3300044842 | Bacteria | 3317 |
| 474 | Ga0466960_0075572 | 3300044901 | Bacteria | 1686 |
| 475 | Ga0451576_0001200 | 3300045051 | Bacteria | 46344 |
| 476 | Ga0451576_1122117 | 3300045051 | Bacteria | 823 |
| 477 | Ga0466958_0219404 | 3300045836 | Bacteria | 1213 |
| 478 | Ga0466958_0690280 | 3300045836 | Bacteria | 665 |
| 479 | Ga0466967_0236979 | 3300045976 | Bacteria | 1739 |
| 480 | Ga0466967_0461375 | 3300045976 | Bacteria | 1243 |
| 481 | Ga0495592_0062600 | 3300046454 | Bacteria | 2731 |
| 482 | Ga0495592_0172972 | 3300046454 | Bacteria | 1477 |
| 483 | Ga0495651_0025838 | 3300046462 | Bacteria | 4572 |
| 484 | Ga0495651_0077719 | 3300046462 | Bacteria | 2512 |
| 485 | Ga0495653_0125725 | 3300046463 | Bacteria | 1821 |
| 486 | Ga0495580_0145982 | 3300046472 | Bacteria | 1640 |
| 487 | Ga0495639_0032987 | 3300046475 | Bacteria | 2311 |
| 488 | Ga0495662_0035977 | 3300046476 | Bacteria | 2390 |
| 489 | Ga0495664_0015798 | 3300046477 | Bacteria | 4296 |
| 490 | Ga0495606_0406273 | 3300046507 | Bacteria | 708 |
| 491 | Ga0495608_0014438 | 3300046511 | Bacteria | 5479 |
| 492 | Ga0495608_0029236 | 3300046511 | Bacteria | 3740 |
| 493 | Ga0495610_0161327 | 3300046512 | Bacteria | 947 |
| 494 | Ga0495618_0198464 | 3300046514 | Bacteria | 1270 |
| 495 | Ga0495628_0085120 | 3300046516 | Bacteria | 2453 |
| 496 | Ga0495630_0200753 | 3300046517 | Bacteria | 1522 |
| 497 | Ga0495630_0215096 | 3300046517 | Bacteria | 1467 |
| 498 | Ga0495643_0210664 | 3300046522 | Bacteria | 928 |
| 499 | Ga0495652_0096204 | 3300046529 | Bacteria | 2412 |
| 500 | Ga0495640_0108697 | 3300046533 | Bacteria | 1814 |
| 501 | Ga0495640_0372564 | 3300046533 | Bacteria | 879 |
| 502 | Ga0495586_0518176 | 3300046535 | Bacteria | 688 |
| 503 | Ga0495587_0001558 | 3300046536 | Bacteria | 15259 |
| 504 | Ga0495587_0207877 | 3300046536 | Bacteria | 1106 |
| 505 | Ga0495645_0016793 | 3300046543 | Bacteria | 5238 |
| 506 | Ga0495667_0002486 | 3300046559 | Bacteria | 12315 |
| 507 | Ga0495667_0011953 | 3300046559 | Bacteria | 5883 |
| 508 | Ga0495667_0047410 | 3300046559 | Bacteria | 2840 |
| 509 | Ga0495667_0205908 | 3300046559 | Bacteria | 1258 |
| 510 | Ga0495634_0225703 | 3300046642 | Bacteria | 1154 |
| 511 | Ga0495634_0334740 | 3300046642 | Bacteria | 909 |
| 512 | Ga0495635_0355139 | 3300046663 | Bacteria | 977 |
| 513 | Ga0495657_0046345 | 3300046675 | Bacteria | 2944 |
| 514 | Ga0495657_0060463 | 3300046675 | Bacteria | 2510 |
| 515 | Ga0495599_0026360 | 3300046678 | Bacteria | 3642 |
| 516 | Ga0495623_0079667 | 3300046679 | Bacteria | 2029 |
| 517 | Ga0495604_0060961 | 3300047317 | Bacteria | 2887 |
| 518 | Ga0495674_0250619 | 3300047319 | Bacteria | 1457 |
| 519 | Ga0495674_0379077 | 3300047319 | Bacteria | 1145 |
| 520 | Ga0495680_0155702 | 3300047322 | Bacteria | 1663 |
| 521 | Ga0495680_0250047 | 3300047322 | Bacteria | 1257 |
| 522 | Ga0495675_0004906 | 3300047444 | Bacteria | 8146 |
| 523 | Ga0495675_0058436 | 3300047444 | Bacteria | 2445 |
| 524 | Ga0495684_0163908 | 3300047471 | Bacteria | 1657 |
| 525 | Ga0495684_0275376 | 3300047471 | Bacteria | 1216 |
| 526 | Ga0495602_0001212 | 3300048088 | Bacteria | 25377 |
| 527 | Ga0496110_0623990 | 3300048913 | Bacteria | 977 |
| 528 | Ga0496111_0055749 | 3300048914 | Bacteria | 2859 |
| 529 | Ga0496112_0032394 | 3300048915 | Bacteria | 5075 |
| 530 | Ga0496112_0417860 | 3300048915 | Bacteria | 1280 |
| 531 | Ga0496113_0864091 | 3300048916 | Bacteria | 717 |
| 532 | Ga0496121_0455049 | 3300048924 | Bacteria | 824 |
| 533 | Ga0496122_0023070 | 3300048925 | Bacteria | 5504 |
| 534 | Ga0496126_0013350 | 3300048929 | Bacteria | 8363 |
| 535 | Ga0495682_0091435 | 3300049460 | Bacteria | 1093 |
| 536 | Ga0501314_017178 | 3300049530 | Bacteria | 727 |
| 537 | Ga0501034_0004819 | 3300049571 | Bacteria | 14909 |
| 538 | Ga0501034_0016727 | 3300049571 | Bacteria | 7520 |
| 539 | Ga0501037_0186539 | 3300049573 | Bacteria | 1470 |
| 540 | Ga0501039_0565176 | 3300049575 | Bacteria | 892 |
| 541 | Ga0501043_0224253 | 3300049579 | Bacteria | 1453 |
| 542 | Ga0501046_0060888 | 3300049580 | Bacteria | 2953 |
| 543 | Ga0501047_0041380 | 3300049581 | Bacteria | 4453 |
| 544 | Ga0501047_0054183 | 3300049581 | Bacteria | 3879 |
| 545 | Ga0501047_0142342 | 3300049581 | Bacteria | 2276 |
| 546 | Ga0501047_0217249 | 3300049581 | Bacteria | 1769 |
| 547 | Ga0501068_0385104 | 3300049584 | Bacteria | 903 |
| 548 | Ga0501069_0152429 | 3300049585 | Bacteria | 1329 |
| 549 | Ga0501069_0256089 | 3300049585 | Bacteria | 1021 |
| 550 | Ga0501070_0056424 | 3300049586 | Bacteria | 3256 |
| 551 | Ga0501070_0119097 | 3300049586 | Bacteria | 2182 |
| 552 | Ga0501070_0293642 | 3300049586 | Bacteria | 1325 |
| 553 | Ga0501071_0578014 | 3300049587 | Bacteria | 863 |
| 554 | Ga0501072_0424530 | 3300049588 | Bacteria | 1054 |
| 555 | Ga0501074_0243881 | 3300049590 | Bacteria | 1278 |
| 556 | Ga0501076_0017711 | 3300049592 | Bacteria | 5417 |
| 557 | Ga0501079_0085561 | 3300049741 | Bacteria | 2440 |
| 558 | Ga0501080_0088499 | 3300049742 | Bacteria | 2877 |
| 559 | Ga0501080_0263175 | 3300049742 | Bacteria | 1571 |
| 560 | Ga0501083_0042062 | 3300049744 | Bacteria | 3098 |
| 561 | Ga0501083_0598187 | 3300049744 | Bacteria | 718 |
| 562 | Ga0501035_0081967 | 3300049822 | Bacteria | 2847 |
| 563 | Ga0501044_0033540 | 3300049823 | Bacteria | 5395 |
| 564 | Ga0501044_0080571 | 3300049823 | Bacteria | 3298 |
| 565 | Ga0501044_0115392 | 3300049823 | Bacteria | 2691 |
| 566 | Ga0501045_0050250 | 3300049824 | Bacteria | 3042 |
| 567 | nmdc:mga03683_21383_c1 | 3300050489 | Bacteria | 2493 |
| 568 | nmdc:mga03683_27988_c1 | 3300050489 | Bacteria | 2238 |
| 569 | nmdc:mga0k408_80035_c1 | 3300050493 | Bacteria | 1912 |
| 570 | nmdc:mga04h51_181829_c1 | 3300050495 | Bacteria | 819 |
| 571 | nmdc:mga08y16_531320_c1 | 3300050511 | Bacteria | 1192 |
| 572 | nmdc:mga0n895_207979_c1 | 3300050512 | Bacteria | 1987 |
| 573 | nmdc:mga0sz30_253691_c1 | 3300050516 | Bacteria | 783 |
| 574 | Ga0495601_0019087 | 3300053077 | Bacteria | 4178 |
| 575 | Ga0495601_0100751 | 3300053077 | Bacteria | 1865 |
| 576 | Ga0495601_0120318 | 3300053077 | Bacteria | 1705 |
| 577 | Ga0495601_0127333 | 3300053077 | Bacteria | 1657 |
| 578 | Ga0495612_0000161 | 3300053078 | Bacteria | 28312 |
| 579 | Ga0495595_0019772 | 3300053084 | Bacteria | 2925 |
| 580 | Ga0495595_0029837 | 3300053084 | Bacteria | 2443 |
| 581 | Ga0495619_0006176 | 3300053085 | Bacteria | 7592 |
| 582 | Ga0495619_0083855 | 3300053085 | Bacteria | 2150 |
| 583 | Ga0495619_0167133 | 3300053085 | Bacteria | 1520 |
| 584 | Ga0500647_0091502 | 3300053091 | Bacteria | 1456 |
| 585 | Ga0500583_0211399 | 3300053092 | Bacteria | 963 |
| 586 | Ga0500641_0002314 | 3300053096 | Bacteria | 6750 |
| 587 | Ga0500595_004428 | 3300053119 | Bacteria | 6310 |
| 588 | Ga0500588_0138756 | 3300053146 | Bacteria | 872 |
| 589 | Ga0500616_0003157 | 3300053153 | Bacteria | 12855 |
| 590 | Ga0500616_0070085 | 3300053153 | Bacteria | 1791 |
| 591 | Ga0500636_0205418 | 3300053177 | Bacteria | 1038 |
| 592 | Ga0500637_0100230 | 3300053178 | Bacteria | 1680 |
| 593 | Ga0500645_089423 | 3300053730 | Bacteria | 874 |
| 594 | Ga0500552_000088 | 3300053733 | Bacteria | 7487 |
| 595 | Ga0501084_0213033 | 3300054114 | Bacteria | 1630 |
| 596 | Ga0501084_0452219 | 3300054114 | Bacteria | 1086 |
| 597 | Ga0587091_057063 | 3300059511 | Bacteria | 819 |
| 598 | Ga0587101_037436 | 3300059623 | Bacteria | 786 |
| 599 | Ga0587100_011214 | 3300059648 | Bacteria | 768 |
| 600 | Ga0587107_033646 | 3300059652 | Bacteria | 794 |
| 601 | Ga0587110_021183 | 3300059654 | Bacteria | 738 |
| 602 | Ga0587110_021273 | 3300059654 | Bacteria | 737 |
| 603 | Ga0501082_0017161 | 3300060353 | Bacteria | 6236 |
| 604 | Ga0501082_0753626 | 3300060353 | Bacteria | 852 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013102 | Ga0157371_10213281 | Ga0157371_102132812 | 193 |
| 2 | 3300021388 | Ga0213875_10002212 | Ga0213875_100022122 | 194 |
| 3 | 3300037853 | Ga0436364_1069888 | Ga0436364_1069888_53834_54448 | 194 |
| 4 | 3300059654 | Ga0587110_021273 | Ga0587110_021273_117_704 | 195 |
| 5 | 3300026089 | Ga0207648_10444482 | Ga0207648_104444822 | 200 |
| 6 | 3300059654 | Ga0587110_021183 | Ga0587110_021183_113_715 | 200 |
| 7 | iso_pu_bacteria | 2507262055 | 2507510078 | 200 |
| 8 | iso_pu_bacteria | 2508501042 | 2508697982 | 200 |
| 9 | iso_pu_bacteria | 2511231221 | 2512034206 | 200 |
| 10 | iso_pu_bacteria | 2513237094 | 2513643609 | 200 |
| 11 | iso_pu_bacteria | 2513237102 | 2513706052 | 200 |
| 12 | iso_pu_bacteria | 2513237139 | 2513878069 | 200 |
| 13 | iso_pu_bacteria | 2513237161 | 2514012634 | 200 |
| 14 | iso_pu_bacteria | 2515154112 | 2515629416 | 200 |
| 15 | iso_pu_bacteria | 2524023250 | 2524613567 | 200 |
| 16 | iso_pu_bacteria | 2528768022 | 2528849652 | 200 |
| 17 | iso_pu_bacteria | 2617270735 | 2617353024 | 200 |
| 18 | iso_pu_bacteria | 2802429603 | 2805920029 | 200 |
| 19 | iso_pu_bacteria | 2821443989 | 2821450438 | 200 |
| 20 | iso_pu_bacteria | 2824617872 | 2824622760 | 200 |
| 21 | iso_pu_bacteria | 2824626560 | 2824632407 | 200 |
| 22 | iso_pu_bacteria | 2824635225 | 2824640426 | 200 |
| 23 | iso_pu_bacteria | 2824644064 | 2824647415 | 200 |
| 24 | iso_pu_bacteria | 2824661429 | 2824668738 | 200 |
| 25 | iso_pu_bacteria | 2824671348 | 2824674291 | 200 |
| 26 | iso_pu_bacteria | 2824687955 | 2824690913 | 200 |
| 27 | iso_pu_bacteria | 2824696289 | 2824698511 | 200 |
| 28 | iso_pu_bacteria | 2824714736 | 2824720393 | 200 |
| 29 | iso_pu_bacteria | 2824723954 | 2824728694 | 200 |
| 30 | iso_pu_bacteria | 2824773399 | 2824778226 | 200 |
| 31 | iso_pu_bacteria | 2838122688 | 2838127480 | 200 |
| 32 | iso_pu_bacteria | 2841941048 | 2841941567 | 200 |
| 33 | iso_pu_bacteria | 2841949485 | 2841952417 | 200 |
| 34 | iso_pu_bacteria | 2841966195 | 2841967711 | 200 |
| 35 | iso_pu_bacteria | 2841974524 | 2841982123 | 200 |
| 36 | iso_pu_bacteria | 2841983080 | 2841986441 | 200 |
| 37 | iso_pu_bacteria | 2842333319 | 2842333561 | 200 |
| 38 | iso_pu_bacteria | 2844533157 | 2844534507 | 200 |
| 39 | iso_pu_bacteria | 2847939898 | 2847945078 | 200 |
| 40 | iso_pu_bacteria | 2849076700 | 2849080736 | 200 |
| 41 | iso_pu_bacteria | 2874590934 | 2874593280 | 200 |
| 42 | iso_pu_bacteria | 2874628541 | 2874636095 | 200 |
| 43 | iso_pu_bacteria | 2874645413 | 2874652945 | 200 |
| 44 | iso_pu_bacteria | 2876771140 | 2876773320 | 200 |
| 45 | iso_pu_bacteria | 2876818435 | 2876821273 | 200 |
| 46 | iso_pu_bacteria | 2879074833 | 2879077236 | 200 |
| 47 | iso_pu_bacteria | 2879099564 | 2879107680 | 200 |
| 48 | iso_pu_bacteria | 2879127579 | 2879130207 | 200 |
| 49 | iso_pu_bacteria | 2879142872 | 2879146722 | 200 |
| 50 | iso_pu_bacteria | 2885409591 | 2885410166 | 200 |
| 51 | iso_pu_bacteria | 2922368715 | 2922375555 | 200 |
| 52 | iso_pu_bacteria | 2929615660 | 2929616293 | 200 |
| 53 | iso_pu_bacteria | 2929624759 | 2929625037 | 200 |
| 54 | iso_pu_bacteria | 2932784394 | 2932787043 | 200 |
| 55 | iso_pu_bacteria | 2932794094 | 2932797273 | 200 |
| 56 | iso_pu_bacteria | 2932801729 | 2932804842 | 200 |
| 57 | iso_pu_bacteria | 2932809354 | 2932811240 | 200 |
| 58 | iso_pu_bacteria | 2932818245 | 2932819887 | 200 |
| 59 | iso_pu_bacteria | 2932828146 | 2932832368 | 200 |
| 60 | iso_pu_bacteria | 2933577622 | 2933578423 | 200 |
| 61 | iso_pu_bacteria | 2935608549 | 2935611017 | 200 |
| 62 | iso_pu_bacteria | 2935616580 | 2935619077 | 200 |
| 63 | iso_pu_bacteria | 2935638405 | 2935643105 | 200 |
| 64 | iso_pu_bacteria | 2935648319 | 2935648448 | 200 |
| 65 | iso_pu_bacteria | 2935656913 | 2935657564 | 200 |
| 66 | iso_pu_bacteria | 2935665750 | 2935669732 | 200 |
| 67 | iso_pu_bacteria | 2935675223 | 2935677128 | 200 |
| 68 | iso_pu_bacteria | 2935684952 | 2935693163 | 200 |
| 69 | iso_pu_bacteria | 2935694250 | 2935695343 | 200 |
| 70 | iso_pu_bacteria | 2935703347 | 2935709548 | 200 |
| 71 | iso_pu_bacteria | 2935713505 | 2935719771 | 200 |
| 72 | iso_pu_bacteria | 2935722832 | 2935729462 | 200 |
| 73 | iso_pu_bacteria | 2935732158 | 2935739654 | 200 |
| 74 | iso_pu_bacteria | 2935741537 | 2935748692 | 200 |
| 75 | iso_pu_bacteria | 2935750917 | 2935756721 | 200 |
| 76 | iso_pu_bacteria | 2935760218 | 2935761294 | 200 |
| 77 | iso_pu_bacteria | 2935801545 | 2935807253 | 200 |
| 78 | iso_pu_bacteria | 2935810662 | 2935812390 | 200 |
| 79 | iso_pu_bacteria | 2935819856 | 2935820502 | 200 |
| 80 | iso_pu_bacteria | 2935827899 | 2935832750 | 200 |
| 81 | iso_pu_bacteria | 2935837841 | 2935839170 | 200 |
| 82 | iso_pu_bacteria | 2935847175 | 2935849489 | 200 |
| 83 | iso_pu_bacteria | 2935855204 | 2935857442 | 200 |
| 84 | iso_pu_bacteria | 2935864058 | 2935864972 | 200 |
| 85 | iso_pu_bacteria | 2935873716 | 2935876750 | 200 |
| 86 | iso_pu_bacteria | 2935883170 | 2935884922 | 200 |
| 87 | iso_pu_bacteria | 2935975950 | 2935979181 | 200 |
| 88 | iso_pu_bacteria | 2935984226 | 2935987807 | 200 |
| 89 | iso_pu_bacteria | 2935992306 | 2935999637 | 200 |
| 90 | iso_pu_bacteria | 2936002035 | 2936008341 | 200 |
| 91 | iso_pu_bacteria | 2936011229 | 2936011358 | 200 |
| 92 | iso_pu_bacteria | 2936019824 | 2936019953 | 200 |
| 93 | iso_pu_bacteria | 2936028420 | 2936028549 | 200 |
| 94 | iso_pu_bacteria | 2936037263 | 2936038983 | 200 |
| 95 | iso_pu_bacteria | 2936046547 | 2936046676 | 200 |
| 96 | iso_pu_bacteria | 2936055302 | 2936062369 | 200 |
| 97 | iso_pu_bacteria | 2940556831 | 2940562635 | 200 |
| 98 | iso_pu_bacteria | 2941538514 | 2941539860 | 200 |
| 99 | iso_pu_bacteria | 3005506211 | 3005508792 | 200 |
| 100 | iso_pu_bacteria | 8016511872 | 8016515165 | 200 |
| 101 | iso_pu_bacteria | 8016630954 | 8016632637 | 200 |
| 102 | iso_pu_bacteria | 8017057580 | 8017061288 | 200 |
| 103 | iso_pu_bacteria | 8019576017 | 8019580760 | 200 |
| 104 | iso_pu_bacteria | 8019586578 | 8019588491 | 200 |
| 105 | iso_pu_bacteria | 8019597564 | 8019602845 | 200 |
| 106 | iso_pu_bacteria | 8019608314 | 8019615711 | 200 |
| 107 | iso_pu_bacteria | 8019619141 | 8019626459 | 200 |
| 108 | iso_pu_bacteria | 8019629233 | 8019636034 | 200 |
| 109 | iso_pu_bacteria | 8019638758 | 8019643630 | 200 |
| 110 | iso_pu_bacteria | 8019659431 | 8019663797 | 200 |
| 111 | iso_pu_bacteria | 8019668869 | 8019673430 | 200 |
| 112 | iso_pu_bacteria | 8019678201 | 8019682699 | 200 |
| 113 | iso_pu_bacteria | 8054002106 | 8054004314 | 200 |
| 114 | iso_pu_bacteria | 8055742211 | 8055747939 | 200 |
| 115 | 3300039437 | Ga0436365_0160653 | Ga0436365_0160653_70_678 | 202 |
| 116 | 3300003316 | rootH1_10196287 | rootH1_101962872 | 203 |
| 117 | 3300001989 | JGI24739J22299_10089789 | JGI24739J22299_100897891 | 204 |
| 118 | 3300002987 | JGI25159J45721_1028911 | JGI25159J45721_10289111 | 204 |
| 119 | 3300003163 | Ga0006759J45824_1013627 | Ga0006759J45824_10136271 | 204 |
| 120 | 3300003187 | JGI25151J46595_10000321 | JGI25151J46595_100003216 | 204 |
| 121 | 3300003203 | JGI25406J46586_10075867 | JGI25406J46586_100758671 | 204 |
| 122 | 3300003215 | JGI25153J46596_10026799 | JGI25153J46596_100267992 | 204 |
| 123 | 3300003322 | rootL2_10030863 | rootL2_100308634 | 204 |
| 124 | 3300003354 | JGI25160J50197_1009503 | JGI25160J50197_10095032 | 204 |
| 125 | 3300003544 | Ga0007417J51691_1007909 | Ga0007417J51691_10079091 | 204 |
| 126 | 3300003559 | Ga0007427J51700_106633 | Ga0007427J51700_1066331 | 204 |
| 127 | 3300003568 | Ga0006781J51513_1006864 | Ga0006781J51513_10068641 | 204 |
| 128 | 3300003574 | Ga0007410J51695_1007683 | Ga0007410J51695_10076831 | 204 |
| 129 | 3300003575 | Ga0007409J51694_1009683 | Ga0007409J51694_10096831 | 204 |
| 130 | 3300003577 | Ga0007416J51690_1010630 | Ga0007416J51690_10106301 | 204 |
| 131 | 3300003579 | Ga0007429J51699_1006425 | Ga0007429J51699_10064251 | 204 |
| 132 | 3300003579 | Ga0007429J51699_1016869 | Ga0007429J51699_10168691 | 204 |
| 133 | 3300003611 | Ga0007411J51799_108223 | Ga0007411J51799_1082231 | 204 |
| 134 | 3300003693 | Ga0032354_1003564 | Ga0032354_10035641 | 204 |
| 135 | 3300003735 | Ga0006780_1000822 | Ga0006780_10008221 | 204 |
| 136 | 3300004798 | Ga0058859_11729389 | Ga0058859_117293891 | 204 |
| 137 | 3300004799 | Ga0058863_11741356 | Ga0058863_117413561 | 204 |
| 138 | 3300004800 | Ga0058861_11962574 | Ga0058861_119625741 | 204 |
| 139 | 3300004803 | Ga0058862_12787350 | Ga0058862_127873501 | 204 |
| 140 | 3300005327 | Ga0070658_10005063 | Ga0070658_100050635 | 204 |
| 141 | 3300005331 | Ga0070670_100223883 | Ga0070670_1002238832 | 204 |
| 142 | 3300005331 | Ga0070670_100444683 | Ga0070670_1004446831 | 204 |
| 143 | 3300005336 | Ga0070680_100006823 | Ga0070680_1000068232 | 204 |
| 144 | 3300005336 | Ga0070680_100231599 | Ga0070680_1002315991 | 204 |
| 145 | 3300005336 | Ga0070680_100236729 | Ga0070680_1002367291 | 204 |
| 146 | 3300005336 | Ga0070680_100504805 | Ga0070680_1005048051 | 204 |
| 147 | 3300005338 | Ga0068868_100057272 | Ga0068868_1000572721 | 204 |
| 148 | 3300005339 | Ga0070660_100173845 | Ga0070660_1001738452 | 204 |
| 149 | 3300005341 | Ga0070691_10074318 | Ga0070691_100743182 | 204 |
| 150 | 3300005344 | Ga0070661_100049069 | Ga0070661_1000490693 | 204 |
| 151 | 3300005344 | Ga0070661_100658782 | Ga0070661_1006587821 | 204 |
| 152 | 3300005355 | Ga0070671_100058811 | Ga0070671_1000588112 | 204 |
| 153 | 3300005355 | Ga0070671_100139744 | Ga0070671_1001397442 | 204 |
| 154 | 3300005356 | Ga0070674_100014625 | Ga0070674_1000146252 | 204 |
| 155 | 3300005365 | Ga0070688_100203439 | Ga0070688_1002034392 | 204 |
| 156 | 3300005434 | Ga0070709_10083542 | Ga0070709_100835422 | 204 |
| 157 | 3300005434 | Ga0070709_10585260 | Ga0070709_105852602 | 204 |
| 158 | 3300005435 | Ga0070714_100000109 | Ga0070714_10000010936 | 204 |
| 159 | 3300005435 | Ga0070714_100053722 | Ga0070714_1000537221 | 204 |
| 160 | 3300005435 | Ga0070714_100125190 | Ga0070714_1001251902 | 204 |
| 161 | 3300005435 | Ga0070714_100204564 | Ga0070714_1002045644 | 204 |
| 162 | 3300005435 | Ga0070714_100881694 | Ga0070714_1008816941 | 204 |
| 163 | 3300005435 | Ga0070714_100900979 | Ga0070714_1009009791 | 204 |
| 164 | 3300005436 | Ga0070713_100003647 | Ga0070713_10000364712 | 204 |
| 165 | 3300005436 | Ga0070713_100009862 | Ga0070713_1000098628 | 204 |
| 166 | 3300005436 | Ga0070713_100081654 | Ga0070713_1000816543 | 204 |
| 167 | 3300005436 | Ga0070713_100864901 | Ga0070713_1008649012 | 204 |
| 168 | 3300005436 | Ga0070713_101150857 | Ga0070713_1011508571 | 204 |
| 169 | 3300005436 | Ga0070713_101218906 | Ga0070713_1012189061 | 204 |
| 170 | 3300005437 | Ga0070710_10012410 | Ga0070710_100124104 | 204 |
| 171 | 3300005437 | Ga0070710_10018319 | Ga0070710_100183194 | 204 |
| 172 | 3300005437 | Ga0070710_10065125 | Ga0070710_100651251 | 204 |
| 173 | 3300005437 | Ga0070710_10313858 | Ga0070710_103138581 | 204 |
| 174 | 3300005439 | Ga0070711_100008458 | Ga0070711_1000084583 | 204 |
| 175 | 3300005439 | Ga0070711_100026740 | Ga0070711_1000267406 | 204 |
| 176 | 3300005439 | Ga0070711_100129600 | Ga0070711_1001296002 | 204 |
| 177 | 3300005439 | Ga0070711_100440784 | Ga0070711_1004407841 | 204 |
| 178 | 3300005441 | Ga0070700_100060273 | Ga0070700_1000602732 | 204 |
| 179 | 3300005445 | Ga0070708_100045787 | Ga0070708_1000457873 | 204 |
| 180 | 3300005445 | Ga0070708_100333786 | Ga0070708_1003337861 | 204 |
| 181 | 3300005445 | Ga0070708_100400331 | Ga0070708_1004003312 | 204 |
| 182 | 3300005445 | Ga0070708_101069620 | Ga0070708_1010696201 | 204 |
| 183 | 3300005456 | Ga0070678_100009064 | Ga0070678_1000090644 | 204 |
| 184 | 3300005456 | Ga0070678_100222884 | Ga0070678_1002228843 | 204 |
| 185 | 3300005458 | Ga0070681_10009482 | Ga0070681_100094824 | 204 |
| 186 | 3300005458 | Ga0070681_10010966 | Ga0070681_100109664 | 204 |
| 187 | 3300005458 | Ga0070681_10038254 | Ga0070681_100382545 | 204 |
| 188 | 3300005458 | Ga0070681_10082512 | Ga0070681_100825122 | 204 |
| 189 | 3300005458 | Ga0070681_10218318 | Ga0070681_102183182 | 204 |
| 190 | 3300005458 | Ga0070681_10364739 | Ga0070681_103647391 | 204 |
| 191 | 3300005458 | Ga0070681_10603751 | Ga0070681_106037512 | 204 |
| 192 | 3300005467 | Ga0070706_100428236 | Ga0070706_1004282362 | 204 |
| 193 | 3300005467 | Ga0070706_101025644 | Ga0070706_1010256441 | 204 |
| 194 | 3300005468 | Ga0070707_100067654 | Ga0070707_1000676542 | 204 |
| 195 | 3300005471 | Ga0070698_100009525 | Ga0070698_1000095254 | 204 |
| 196 | 3300005471 | Ga0070698_100009857 | Ga0070698_1000098572 | 204 |
| 197 | 3300005471 | Ga0070698_100066659 | Ga0070698_1000666593 | 204 |
| 198 | 3300005471 | Ga0070698_100142108 | Ga0070698_1001421082 | 204 |
| 199 | 3300005518 | Ga0070699_100033732 | Ga0070699_1000337323 | 204 |
| 200 | 3300005518 | Ga0070699_100293855 | Ga0070699_1002938552 | 204 |
| 201 | 3300005530 | Ga0070679_100001570 | Ga0070679_10000157016 | 204 |
| 202 | 3300005530 | Ga0070679_100046569 | Ga0070679_1000465695 | 204 |
| 203 | 3300005530 | Ga0070679_100714999 | Ga0070679_1007149991 | 204 |
| 204 | 3300005535 | Ga0070684_100015453 | Ga0070684_1000154533 | 204 |
| 205 | 3300005535 | Ga0070684_100629529 | Ga0070684_1006295292 | 204 |
| 206 | 3300005536 | Ga0070697_100145510 | Ga0070697_1001455102 | 204 |
| 207 | 3300005536 | Ga0070697_100208960 | Ga0070697_1002089602 | 204 |
| 208 | 3300005536 | Ga0070697_100356560 | Ga0070697_1003565601 | 204 |
| 209 | 3300005539 | Ga0068853_100027384 | Ga0068853_1000273843 | 204 |
| 210 | 3300005539 | Ga0068853_100027444 | Ga0068853_1000274443 | 204 |
| 211 | 3300005539 | Ga0068853_100484974 | Ga0068853_1004849741 | 204 |
| 212 | 3300005547 | Ga0070693_100655141 | Ga0070693_1006551411 | 204 |
| 213 | 3300005548 | Ga0070665_100001426 | Ga0070665_1000014263 | 204 |
| 214 | 3300005548 | Ga0070665_100669652 | Ga0070665_1006696522 | 204 |
| 215 | 3300005548 | Ga0070665_100863405 | Ga0070665_1008634051 | 204 |
| 216 | 3300005563 | Ga0068855_100055194 | Ga0068855_1000551945 | 204 |
| 217 | 3300005563 | Ga0068855_100235756 | Ga0068855_1002357563 | 204 |
| 218 | 3300005563 | Ga0068855_100290054 | Ga0068855_1002900542 | 204 |
| 219 | 3300005564 | Ga0070664_100063094 | Ga0070664_1000630944 | 204 |
| 220 | 3300005577 | Ga0068857_100024941 | Ga0068857_1000249415 | 204 |
| 221 | 3300005577 | Ga0068857_100285705 | Ga0068857_1002857052 | 204 |
| 222 | 3300005577 | Ga0068857_100816329 | Ga0068857_1008163291 | 204 |
| 223 | 3300005578 | Ga0068854_100089788 | Ga0068854_1000897882 | 204 |
| 224 | 3300005614 | Ga0068856_100048767 | Ga0068856_1000487672 | 204 |
| 225 | 3300005614 | Ga0068856_100051884 | Ga0068856_1000518843 | 204 |
| 226 | 3300005614 | Ga0068856_100118153 | Ga0068856_1001181532 | 204 |
| 227 | 3300005614 | Ga0068856_100404474 | Ga0068856_1004044742 | 204 |
| 228 | 3300005614 | Ga0068856_100588586 | Ga0068856_1005885861 | 204 |
| 229 | 3300005616 | Ga0068852_100048736 | Ga0068852_1000487363 | 204 |
| 230 | 3300005617 | Ga0068859_101207513 | Ga0068859_1012075131 | 204 |
| 231 | 3300005834 | Ga0068851_10277963 | Ga0068851_102779631 | 204 |
| 232 | 3300005840 | Ga0068870_10289542 | Ga0068870_102895421 | 204 |
| 233 | 3300005843 | Ga0068860_100080670 | Ga0068860_1000806702 | 204 |
| 234 | 3300005937 | Ga0081455_10000434 | Ga0081455_100004349 | 204 |
| 235 | 3300005937 | Ga0081455_10008590 | Ga0081455_1000859010 | 204 |
| 236 | 3300005937 | Ga0081455_10183324 | Ga0081455_101833242 | 204 |
| 237 | 3300005937 | Ga0081455_10392483 | Ga0081455_103924832 | 204 |
| 238 | 3300005981 | Ga0081538_10076130 | Ga0081538_100761302 | 204 |
| 239 | 3300005983 | Ga0081540_1042357 | Ga0081540_10423571 | 204 |
| 240 | 3300005983 | Ga0081540_1149827 | Ga0081540_11498271 | 204 |
| 241 | 3300005985 | Ga0081539_10013066 | Ga0081539_100130664 | 204 |
| 242 | 3300006028 | Ga0070717_10000675 | Ga0070717_1000067516 | 204 |
| 243 | 3300006028 | Ga0070717_10090048 | Ga0070717_100900483 | 204 |
| 244 | 3300006028 | Ga0070717_10233523 | Ga0070717_102335233 | 204 |
| 245 | 3300006028 | Ga0070717_10776108 | Ga0070717_107761081 | 204 |
| 246 | 3300006038 | Ga0075365_10083846 | Ga0075365_100838463 | 204 |
| 247 | 3300006163 | Ga0070715_10267458 | Ga0070715_102674581 | 204 |
| 248 | 3300006173 | Ga0070716_100102764 | Ga0070716_1001027642 | 204 |
| 249 | 3300006175 | Ga0070712_100028391 | Ga0070712_1000283916 | 204 |
| 250 | 3300006175 | Ga0070712_100064734 | Ga0070712_1000647341 | 204 |
| 251 | 3300006175 | Ga0070712_100163788 | Ga0070712_1001637882 | 204 |
| 252 | 3300006175 | Ga0070712_100440277 | Ga0070712_1004402772 | 204 |
| 253 | 3300006177 | Ga0075362_10002476 | Ga0075362_100024762 | 204 |
| 254 | 3300006177 | Ga0075362_10037714 | Ga0075362_100377142 | 204 |
| 255 | 3300006195 | Ga0075366_10006532 | Ga0075366_100065322 | 204 |
| 256 | 3300006353 | Ga0075370_10139193 | Ga0075370_101391932 | 204 |
| 257 | 3300006358 | Ga0068871_100556839 | Ga0068871_1005568392 | 204 |
| 258 | 3300006847 | Ga0075431_100458226 | Ga0075431_1004582262 | 204 |
| 259 | 3300006871 | Ga0075434_100303580 | Ga0075434_1003035802 | 204 |
| 260 | 3300006871 | Ga0075434_100320767 | Ga0075434_1003207672 | 204 |
| 261 | 3300006914 | Ga0075436_100190084 | Ga0075436_1001900842 | 204 |
| 262 | 3300006931 | Ga0097620_101207258 | Ga0097620_1012072581 | 204 |
| 263 | 3300007076 | Ga0075435_100095352 | Ga0075435_1000953522 | 204 |
| 264 | 3300007265 | Ga0099794_10080472 | Ga0099794_100804721 | 204 |
| 265 | 3300007265 | Ga0099794_10250257 | Ga0099794_102502571 | 204 |
| 266 | 3300007788 | Ga0099795_10039719 | Ga0099795_100397192 | 204 |
| 267 | 3300007788 | Ga0099795_10043886 | Ga0099795_100438862 | 204 |
| 268 | 3300007788 | Ga0099795_10308681 | Ga0099795_103086811 | 204 |
| 269 | 3300009093 | Ga0105240_10000330 | Ga0105240_1000033047 | 204 |
| 270 | 3300009093 | Ga0105240_10000580 | Ga0105240_1000058073 | 204 |
| 271 | 3300009093 | Ga0105240_10014265 | Ga0105240_1001426510 | 204 |
| 272 | 3300009093 | Ga0105240_10090761 | Ga0105240_100907615 | 204 |
| 273 | 3300009093 | Ga0105240_10213313 | Ga0105240_102133133 | 204 |
| 274 | 3300009093 | Ga0105240_10224624 | Ga0105240_102246242 | 204 |
| 275 | 3300009093 | Ga0105240_10456714 | Ga0105240_104567142 | 204 |
| 276 | 3300009093 | Ga0105240_10565073 | Ga0105240_105650732 | 204 |
| 277 | 3300009093 | Ga0105240_10668720 | Ga0105240_106687202 | 204 |
| 278 | 3300009094 | Ga0111539_10497407 | Ga0111539_104974072 | 204 |
| 279 | 3300009098 | Ga0105245_10066311 | Ga0105245_100663113 | 204 |
| 280 | 3300009147 | Ga0114129_10798305 | Ga0114129_107983052 | 204 |
| 281 | 3300009148 | Ga0105243_10847438 | Ga0105243_108474381 | 204 |
| 282 | 3300009174 | Ga0105241_10413912 | Ga0105241_104139121 | 204 |
| 283 | 3300009176 | Ga0105242_10270422 | Ga0105242_102704221 | 204 |
| 284 | 3300009177 | Ga0105248_10137227 | Ga0105248_101372272 | 204 |
| 285 | 3300009545 | Ga0105237_10105821 | Ga0105237_101058213 | 204 |
| 286 | 3300009551 | Ga0105238_10132022 | Ga0105238_101320222 | 204 |
| 287 | 3300009551 | Ga0105238_10787665 | Ga0105238_107876651 | 204 |
| 288 | 3300009553 | Ga0105249_10391980 | Ga0105249_103919802 | 204 |
| 289 | 3300009986 | Ga0105033_104574 | Ga0105033_1045743 | 204 |
| 290 | 3300010159 | Ga0099796_10018908 | Ga0099796_100189082 | 204 |
| 291 | 3300010375 | Ga0105239_10148242 | Ga0105239_101482421 | 204 |
| 292 | 3300010375 | Ga0105239_10588478 | Ga0105239_105884781 | 204 |
| 293 | 3300013102 | Ga0157371_10070102 | Ga0157371_100701023 | 204 |
| 294 | 3300013104 | Ga0157370_10005028 | Ga0157370_100050286 | 204 |
| 295 | 3300013104 | Ga0157370_10019229 | Ga0157370_100192296 | 204 |
| 296 | 3300013104 | Ga0157370_10025363 | Ga0157370_100253633 | 204 |
| 297 | 3300013104 | Ga0157370_10075051 | Ga0157370_100750512 | 204 |
| 298 | 3300013105 | Ga0157369_10160168 | Ga0157369_101601683 | 204 |
| 299 | 3300013296 | Ga0157374_10040559 | Ga0157374_100405592 | 204 |
| 300 | 3300013296 | Ga0157374_10544380 | Ga0157374_105443801 | 204 |
| 301 | 3300013296 | Ga0157374_10653097 | Ga0157374_106530972 | 204 |
| 302 | 3300013297 | Ga0157378_10218204 | Ga0157378_102182042 | 204 |
| 303 | 3300013297 | Ga0157378_11217626 | Ga0157378_112176261 | 204 |
| 304 | 3300013307 | Ga0157372_11118657 | Ga0157372_111186572 | 204 |
| 305 | 3300014325 | Ga0163163_10088190 | Ga0163163_100881903 | 204 |
| 306 | 3300014325 | Ga0163163_10132205 | Ga0163163_101322053 | 204 |
| 307 | 3300014325 | Ga0163163_10366989 | Ga0163163_103669893 | 204 |
| 308 | 3300014325 | Ga0163163_10403293 | Ga0163163_104032933 | 204 |
| 309 | 3300014497 | Ga0182008_10005670 | Ga0182008_100056707 | 204 |
| 310 | 3300014497 | Ga0182008_10062439 | Ga0182008_100624392 | 204 |
| 311 | 3300014497 | Ga0182008_10073565 | Ga0182008_100735652 | 204 |
| 312 | 3300014745 | Ga0157377_10368228 | Ga0157377_103682281 | 204 |
| 313 | 3300014969 | Ga0157376_10023876 | Ga0157376_100238764 | 204 |
| 314 | 3300014969 | Ga0157376_10193645 | Ga0157376_101936452 | 204 |
| 315 | 3300017792 | Ga0163161_10962790 | Ga0163161_109627901 | 204 |
| 316 | 3300019162 | Ga0184597_126673 | Ga0184597_1266731 | 204 |
| 317 | 3300019166 | Ga0184595_115712 | Ga0184595_1157121 | 204 |
| 318 | 3300019182 | Ga0184598_112434 | Ga0184598_1124341 | 204 |
| 319 | 3300019188 | Ga0184599_106266 | Ga0184599_1062661 | 204 |
| 320 | 3300020069 | Ga0197907_10436073 | Ga0197907_104360732 | 204 |
| 321 | 3300020070 | Ga0206356_11602332 | Ga0206356_116023322 | 204 |
| 322 | 3300020076 | Ga0206355_1429787 | Ga0206355_14297871 | 204 |
| 323 | 3300020077 | Ga0206351_10868433 | Ga0206351_108684331 | 204 |
| 324 | 3300020078 | Ga0206352_11164371 | Ga0206352_111643711 | 204 |
| 325 | 3300021358 | Ga0213873_10022034 | Ga0213873_100220342 | 204 |
| 326 | 3300021361 | Ga0213872_10000696 | Ga0213872_100006963 | 204 |
| 327 | 3300021361 | Ga0213872_10063159 | Ga0213872_100631592 | 204 |
| 328 | 3300021361 | Ga0213872_10132681 | Ga0213872_101326811 | 204 |
| 329 | 3300021384 | Ga0213876_10024314 | Ga0213876_100243143 | 204 |
| 330 | 3300021388 | Ga0213875_10000081 | Ga0213875_1000008193 | 204 |
| 331 | 3300021388 | Ga0213875_10003351 | Ga0213875_100033518 | 204 |
| 332 | 3300021388 | Ga0213875_10017999 | Ga0213875_100179993 | 204 |
| 333 | 3300021388 | Ga0213875_10082814 | Ga0213875_100828141 | 204 |
| 334 | 3300021441 | Ga0213871_10002467 | Ga0213871_100024672 | 204 |
| 335 | 3300021441 | Ga0213871_10010292 | Ga0213871_100102922 | 204 |
| 336 | 3300021441 | Ga0213871_10098501 | Ga0213871_100985011 | 204 |
| 337 | 3300022467 | Ga0224712_10296943 | Ga0224712_102969431 | 204 |
| 338 | 3300023536 | Ga0247552_101207 | Ga0247552_1012071 | 204 |
| 339 | 3300023539 | Ga0247555_101092 | Ga0247555_1010921 | 204 |
| 340 | 3300023547 | Ga0247554_100379 | Ga0247554_1003792 | 204 |
| 341 | 3300023660 | Ga0247550_100572 | Ga0247550_1005722 | 204 |
| 342 | 3300025294 | Ga0209025_1000224 | Ga0209025_100022472 | 204 |
| 343 | 3300025297 | Ga0209758_1001111 | Ga0209758_10011113 | 204 |
| 344 | 3300025898 | Ga0207692_10049055 | Ga0207692_100490552 | 204 |
| 345 | 3300025898 | Ga0207692_10108437 | Ga0207692_101084371 | 204 |
| 346 | 3300025898 | Ga0207692_10112568 | Ga0207692_101125683 | 204 |
| 347 | 3300025903 | Ga0207680_10270975 | Ga0207680_102709752 | 204 |
| 348 | 3300025905 | Ga0207685_10311713 | Ga0207685_103117131 | 204 |
| 349 | 3300025906 | Ga0207699_10005358 | Ga0207699_100053585 | 204 |
| 350 | 3300025906 | Ga0207699_10111722 | Ga0207699_101117222 | 204 |
| 351 | 3300025906 | Ga0207699_10264784 | Ga0207699_102647842 | 204 |
| 352 | 3300025909 | Ga0207705_10037180 | Ga0207705_100371802 | 204 |
| 353 | 3300025910 | Ga0207684_10098817 | Ga0207684_100988172 | 204 |
| 354 | 3300025912 | Ga0207707_10002418 | Ga0207707_100024188 | 204 |
| 355 | 3300025912 | Ga0207707_10010162 | Ga0207707_100101623 | 204 |
| 356 | 3300025912 | Ga0207707_10021504 | Ga0207707_100215043 | 204 |
| 357 | 3300025912 | Ga0207707_10331316 | Ga0207707_103313161 | 204 |
| 358 | 3300025913 | Ga0207695_10000690 | Ga0207695_1000069010 | 204 |
| 359 | 3300025913 | Ga0207695_10002225 | Ga0207695_1000222510 | 204 |
| 360 | 3300025913 | Ga0207695_10265920 | Ga0207695_102659201 | 204 |
| 361 | 3300025913 | Ga0207695_10292078 | Ga0207695_102920781 | 204 |
| 362 | 3300025914 | Ga0207671_10133171 | Ga0207671_101331713 | 204 |
| 363 | 3300025915 | Ga0207693_10001564 | Ga0207693_100015647 | 204 |
| 364 | 3300025915 | Ga0207693_10004020 | Ga0207693_1000402013 | 204 |
| 365 | 3300025915 | Ga0207693_10071776 | Ga0207693_100717762 | 204 |
| 366 | 3300025915 | Ga0207693_10087373 | Ga0207693_100873732 | 204 |
| 367 | 3300025915 | Ga0207693_10121789 | Ga0207693_101217893 | 204 |
| 368 | 3300025915 | Ga0207693_10442644 | Ga0207693_104426442 | 204 |
| 369 | 3300025916 | Ga0207663_10185316 | Ga0207663_101853162 | 204 |
| 370 | 3300025916 | Ga0207663_10261053 | Ga0207663_102610531 | 204 |
| 371 | 3300025916 | Ga0207663_10282525 | Ga0207663_102825251 | 204 |
| 372 | 3300025916 | Ga0207663_10559096 | Ga0207663_105590962 | 204 |
| 373 | 3300025917 | Ga0207660_10029298 | Ga0207660_100292981 | 204 |
| 374 | 3300025917 | Ga0207660_10122502 | Ga0207660_101225022 | 204 |
| 375 | 3300025917 | Ga0207660_10841770 | Ga0207660_108417701 | 204 |
| 376 | 3300025918 | Ga0207662_10315116 | Ga0207662_103151161 | 204 |
| 377 | 3300025918 | Ga0207662_10329006 | Ga0207662_103290062 | 204 |
| 378 | 3300025919 | Ga0207657_10060068 | Ga0207657_100600682 | 204 |
| 379 | 3300025921 | Ga0207652_10010284 | Ga0207652_100102847 | 204 |
| 380 | 3300025921 | Ga0207652_10045957 | Ga0207652_100459571 | 204 |
| 381 | 3300025921 | Ga0207652_10163196 | Ga0207652_101631962 | 204 |
| 382 | 3300025922 | Ga0207646_10130656 | Ga0207646_101306562 | 204 |
| 383 | 3300025922 | Ga0207646_10169845 | Ga0207646_101698452 | 204 |
| 384 | 3300025923 | Ga0207681_10093653 | Ga0207681_100936532 | 204 |
| 385 | 3300025924 | Ga0207694_10001133 | Ga0207694_1000113316 | 204 |
| 386 | 3300025925 | Ga0207650_10294643 | Ga0207650_102946432 | 204 |
| 387 | 3300025927 | Ga0207687_10628459 | Ga0207687_106284592 | 204 |
| 388 | 3300025928 | Ga0207700_10193917 | Ga0207700_101939173 | 204 |
| 389 | 3300025928 | Ga0207700_10416491 | Ga0207700_104164912 | 204 |
| 390 | 3300025928 | Ga0207700_10530834 | Ga0207700_105308342 | 204 |
| 391 | 3300025928 | Ga0207700_10795096 | Ga0207700_107950961 | 204 |
| 392 | 3300025928 | Ga0207700_10864868 | Ga0207700_108648681 | 204 |
| 393 | 3300025928 | Ga0207700_11098278 | Ga0207700_110982781 | 204 |
| 394 | 3300025929 | Ga0207664_10000469 | Ga0207664_1000046916 | 204 |
| 395 | 3300025929 | Ga0207664_10075846 | Ga0207664_100758465 | 204 |
| 396 | 3300025929 | Ga0207664_10150290 | Ga0207664_101502902 | 204 |
| 397 | 3300025929 | Ga0207664_10267068 | Ga0207664_102670682 | 204 |
| 398 | 3300025929 | Ga0207664_10271330 | Ga0207664_102713302 | 204 |
| 399 | 3300025929 | Ga0207664_10368301 | Ga0207664_103683012 | 204 |
| 400 | 3300025929 | Ga0207664_10406261 | Ga0207664_104062612 | 204 |
| 401 | 3300025929 | Ga0207664_10556154 | Ga0207664_105561541 | 204 |
| 402 | 3300025929 | Ga0207664_10969780 | Ga0207664_109697801 | 204 |
| 403 | 3300025931 | Ga0207644_10085096 | Ga0207644_100850963 | 204 |
| 404 | 3300025931 | Ga0207644_10200692 | Ga0207644_102006922 | 204 |
| 405 | 3300025931 | Ga0207644_10379240 | Ga0207644_103792402 | 204 |
| 406 | 3300025934 | Ga0207686_10535078 | Ga0207686_105350782 | 204 |
| 407 | 3300025936 | Ga0207670_10149495 | Ga0207670_101494953 | 204 |
| 408 | 3300025937 | Ga0207669_10261132 | Ga0207669_102611322 | 204 |
| 409 | 3300025939 | Ga0207665_10255896 | Ga0207665_102558963 | 204 |
| 410 | 3300025940 | Ga0207691_10199553 | Ga0207691_101995531 | 204 |
| 411 | 3300025944 | Ga0207661_10052671 | Ga0207661_100526714 | 204 |
| 412 | 3300025944 | Ga0207661_11349310 | Ga0207661_113493101 | 204 |
| 413 | 3300025945 | Ga0207679_10017685 | Ga0207679_100176853 | 204 |
| 414 | 3300025945 | Ga0207679_11211304 | Ga0207679_112113041 | 204 |
| 415 | 3300025949 | Ga0207667_10007312 | Ga0207667_100073122 | 204 |
| 416 | 3300025949 | Ga0207667_10065952 | Ga0207667_100659526 | 204 |
| 417 | 3300025981 | Ga0207640_10057329 | Ga0207640_100573293 | 204 |
| 418 | 3300025981 | Ga0207640_10070109 | Ga0207640_100701092 | 204 |
| 419 | 3300026023 | Ga0207677_10050579 | Ga0207677_100505793 | 204 |
| 420 | 3300026035 | Ga0207703_10233530 | Ga0207703_102335303 | 204 |
| 421 | 3300026041 | Ga0207639_10009123 | Ga0207639_100091234 | 204 |
| 422 | 3300026067 | Ga0207678_10793541 | Ga0207678_107935411 | 204 |
| 423 | 3300026078 | Ga0207702_10067990 | Ga0207702_100679904 | 204 |
| 424 | 3300026078 | Ga0207702_10092366 | Ga0207702_100923662 | 204 |
| 425 | 3300026078 | Ga0207702_10139820 | Ga0207702_101398202 | 204 |
| 426 | 3300026078 | Ga0207702_10948179 | Ga0207702_109481791 | 204 |
| 427 | 3300026095 | Ga0207676_10306403 | Ga0207676_103064031 | 204 |
| 428 | 3300026116 | Ga0207674_10269548 | Ga0207674_102695481 | 204 |
| 429 | 3300026116 | Ga0207674_10373325 | Ga0207674_103733251 | 204 |
| 430 | 3300026118 | Ga0207675_100896267 | Ga0207675_1008962671 | 204 |
| 431 | 3300026121 | Ga0207683_10016904 | Ga0207683_100169044 | 204 |
| 432 | 3300027512 | Ga0209179_1012847 | Ga0209179_10128472 | 204 |
| 433 | 3300027512 | Ga0209179_1014909 | Ga0209179_10149092 | 204 |
| 434 | 3300027512 | Ga0209179_1044509 | Ga0209179_10445091 | 204 |
| 435 | 3300027671 | Ga0209588_1067866 | Ga0209588_10678661 | 204 |
| 436 | 3300028381 | Ga0268264_10056033 | Ga0268264_100560334 | 204 |
| 437 | 3300028800 | Ga0265338_10030246 | Ga0265338_100302464 | 204 |
| 438 | 3300028800 | Ga0265338_10068686 | Ga0265338_100686864 | 204 |
| 439 | 3300028800 | Ga0265338_10153257 | Ga0265338_101532571 | 204 |
| 440 | 3300029283 | Ga0310982_135131 | Ga0310982_1351311 | 204 |
| 441 | 3300029285 | Ga0310981_1078795 | Ga0310981_10787952 | 204 |
| 442 | 3300030888 | Ga0265769_102505 | Ga0265769_1025052 | 204 |
| 443 | 3300031238 | Ga0265332_10042540 | Ga0265332_100425402 | 204 |
| 444 | 3300031240 | Ga0265320_10145120 | Ga0265320_101451202 | 204 |
| 445 | 3300031250 | Ga0265331_10030442 | Ga0265331_100304423 | 204 |
| 446 | 3300031251 | Ga0265327_10001626 | Ga0265327_1000162620 | 204 |
| 447 | 3300031251 | Ga0265327_10007634 | Ga0265327_100076341 | 204 |
| 448 | 3300031344 | Ga0265316_10181079 | Ga0265316_101810792 | 204 |
| 449 | 3300031548 | Ga0307408_100975967 | Ga0307408_1009759671 | 204 |
| 450 | 3300031595 | Ga0265313_10004920 | Ga0265313_100049203 | 204 |
| 451 | 3300031595 | Ga0265313_10183153 | Ga0265313_101831531 | 204 |
| 452 | 3300031595 | Ga0265313_10246670 | Ga0265313_102466701 | 204 |
| 453 | 3300031711 | Ga0265314_10017169 | Ga0265314_100171692 | 204 |
| 454 | 3300031711 | Ga0265314_10038253 | Ga0265314_100382534 | 204 |
| 455 | 3300031711 | Ga0265314_10041957 | Ga0265314_100419575 | 204 |
| 456 | 3300031711 | Ga0265314_10058218 | Ga0265314_100582184 | 204 |
| 457 | 3300031901 | Ga0307406_10238069 | Ga0307406_102380692 | 204 |
| 458 | 3300031903 | Ga0307407_10077620 | Ga0307407_100776202 | 204 |
| 459 | 3300031995 | Ga0307409_100511303 | Ga0307409_1005113032 | 204 |
| 460 | 3300034817 | Ga0373948_0068046 | Ga0373948_0068046_150_764 | 204 |
| 461 | 3300035085 | Ga0373929_0017915 | Ga0373929_0017915_188_847 | 204 |
| 462 | 3300035086 | Ga0373934_0115189 | Ga0373934_0115189_459_1073 | 204 |
| 463 | 3300035089 | Ga0373944_0041225 | Ga0373944_0041225_662_1276 | 204 |
| 464 | 3300035111 | Ga0373923_0015841 | Ga0373923_0015841_800_1414 | 204 |
| 465 | 3300035111 | Ga0373923_0195262 | Ga0373923_0195262_105_719 | 204 |
| 466 | 3300035113 | Ga0373936_0177722 | Ga0373936_0177722_33_647 | 204 |
| 467 | 3300035116 | Ga0373945_0122282 | Ga0373945_0122282_128_742 | 204 |
| 468 | 3300035116 | Ga0373945_0188062 | Ga0373945_0188062_101_715 | 204 |
| 469 | 3300035117 | Ga0373953_0003261 | Ga0373953_0003261_272_886 | 204 |
| 470 | 3300035117 | Ga0373953_0008351 | Ga0373953_0008351_2074_2691 | 204 |
| 471 | 3300035118 | Ga0373954_0053017 | Ga0373954_0053017_1224_1841 | 204 |
| 472 | 3300035118 | Ga0373954_0135544 | Ga0373954_0135544_254_868 | 204 |
| 473 | 3300035119 | Ga0373956_0101827 | Ga0373956_0101827_68_685 | 204 |
| 474 | 3300035119 | Ga0373956_0122694 | Ga0373956_0122694_46_660 | 204 |
| 475 | 3300035170 | Ga0373943_0011117 | Ga0373943_0011117_323_937 | 204 |
| 476 | 3300035170 | Ga0373943_0199520 | Ga0373943_0199520_435_1049 | 204 |
| 477 | 3300035170 | Ga0373943_0432294 | Ga0373943_0432294_121_735 | 204 |
| 478 | 3300035171 | Ga0373946_0016224 | Ga0373946_0016224_604_1218 | 204 |
| 479 | 3300035172 | Ga0373955_0024645 | Ga0373955_0024645_799_1413 | 204 |
| 480 | 3300035172 | Ga0373955_0072968 | Ga0373955_0072968_1286_1903 | 204 |
| 481 | 3300035172 | Ga0373955_0251431 | Ga0373955_0251431_67_681 | 204 |
| 482 | 3300035241 | Ga0373961_0150318 | Ga0373961_0150318_21_635 | 204 |
| 483 | 3300035692 | Ga0373935_0122256 | Ga0373935_0122256_41_655 | 204 |
| 484 | 3300035692 | Ga0373935_0147915 | Ga0373935_0147915_462_1076 | 204 |
| 485 | 3300035692 | Ga0373935_0233176 | Ga0373935_0233176_324_983 | 204 |
| 486 | 3300035692 | Ga0373935_0670760 | Ga0373935_0670760_84_701 | 204 |
| 487 | 3300035695 | Ga0373927_0034688 | Ga0373927_0034688_2137_2751 | 204 |
| 488 | 3300035695 | Ga0373927_0084876 | Ga0373927_0084876_357_971 | 204 |
| 489 | 3300035695 | Ga0373927_0088890 | Ga0373927_0088890_10_624 | 204 |
| 490 | 3300035695 | Ga0373927_0145574 | Ga0373927_0145574_180_794 | 204 |
| 491 | 3300035724 | Ga0373933_0004435 | Ga0373933_0004435_4038_4652 | 204 |
| 492 | 3300035724 | Ga0373933_0116798 | Ga0373933_0116798_731_1345 | 204 |
| 493 | 3300035724 | Ga0373933_0158524 | Ga0373933_0158524_139_753 | 204 |
| 494 | 3300035724 | Ga0373933_0194417 | Ga0373933_0194417_234_848 | 204 |
| 495 | 3300035725 | Ga0373947_0027624 | Ga0373947_0027624_58_672 | 204 |
| 496 | 3300035725 | Ga0373947_0081675 | Ga0373947_0081675_1022_1636 | 204 |
| 497 | 3300035725 | Ga0373947_0140667 | Ga0373947_0140667_580_1194 | 204 |
| 498 | 3300035725 | Ga0373947_0241326 | Ga0373947_0241326_482_1096 | 204 |
| 499 | 3300035725 | Ga0373947_0459410 | Ga0373947_0459410_139_753 | 204 |
| 500 | 3300036401 | Ga0373937_0002465 | Ga0373937_0002465_528_1142 | 204 |
| 501 | 3300036401 | Ga0373937_0017368 | Ga0373937_0017368_5032_5646 | 204 |
| 502 | 3300036401 | Ga0373937_0018071 | Ga0373937_0018071_762_1379 | 204 |
| 503 | 3300036401 | Ga0373937_0037918 | Ga0373937_0037918_618_1277 | 204 |
| 504 | 3300036401 | Ga0373937_0258096 | Ga0373937_0258096_175_789 | 204 |
| 505 | 3300037068 | Ga0373925_0080723 | Ga0373925_0080723_1148_1762 | 204 |
| 506 | 3300037068 | Ga0373925_0081164 | Ga0373925_0081164_1309_1923 | 204 |
| 507 | 3300037068 | Ga0373925_0189682 | Ga0373925_0189682_152_766 | 204 |
| 508 | 3300037068 | Ga0373925_0245844 | Ga0373925_0245844_517_1176 | 204 |
| 509 | 3300037068 | Ga0373925_0538401 | Ga0373925_0538401_71_685 | 204 |
| 510 | 3300037068 | Ga0373925_0706536 | Ga0373925_0706536_87_701 | 204 |
| 511 | 3300037312 | Ga0395899_0007141 | Ga0395899_0007141_7625_8239 | 204 |
| 512 | 3300037418 | Ga0395900_0007046 | Ga0395900_0007046_4979_5644 | 204 |
| 513 | 3300037418 | Ga0395900_0050126 | Ga0395900_0050126_1772_2437 | 204 |
| 514 | 3300037418 | Ga0395900_0066219 | Ga0395900_0066219_1746_2360 | 204 |
| 515 | 3300037418 | Ga0395900_0200017 | Ga0395900_0200017_1034_1648 | 204 |
| 516 | 3300037466 | Ga0395898_0004350 | Ga0395898_0004350_874_1488 | 204 |
| 517 | 3300037466 | Ga0395898_0004896 | Ga0395898_0004896_12557_13222 | 204 |
| 518 | 3300037466 | Ga0395898_0042229 | Ga0395898_0042229_1987_2601 | 204 |
| 519 | 3300037466 | Ga0395898_0514369 | Ga0395898_0514369_102_716 | 204 |
| 520 | 3300037471 | Ga0395905_0015055 | Ga0395905_0015055_1384_1998 | 204 |
| 521 | 3300037471 | Ga0395905_0548964 | Ga0395905_0548964_109_774 | 204 |
| 522 | 3300037853 | Ga0436364_0102143 | Ga0436364_0102143_979_1593 | 204 |
| 523 | 3300037853 | Ga0436364_0143195 | Ga0436364_0143195_4015_4629 | 204 |
| 524 | 3300037853 | Ga0436364_0196111 | Ga0436364_0196111_341_955 | 204 |
| 525 | 3300037853 | Ga0436364_0207976 | Ga0436364_0207976_1666_2280 | 204 |
| 526 | 3300037853 | Ga0436364_0593151 | Ga0436364_0593151_76_690 | 204 |
| 527 | 3300037853 | Ga0436364_0848167 | Ga0436364_0848167_1303_1917 | 204 |
| 528 | 3300037853 | Ga0436364_1003761 | Ga0436364_1003761_72_689 | 204 |
| 529 | 3300037853 | Ga0436364_1335623 | Ga0436364_1335623_56_670 | 204 |
| 530 | 3300038443 | Ga0395901_0001851 | Ga0395901_0001851_7757_8371 | 204 |
| 531 | 3300038443 | Ga0395901_0011526 | Ga0395901_0011526_4784_5449 | 204 |
| 532 | 3300038443 | Ga0395901_0072152 | Ga0395901_0072152_1765_2430 | 204 |
| 533 | 3300038443 | Ga0395901_0763822 | Ga0395901_0763822_230_925 | 204 |
| 534 | 3300039437 | Ga0436365_0406357 | Ga0436365_0406357_65_679 | 204 |
| 535 | 3300039437 | Ga0436365_0473729 | Ga0436365_0473729_944_1558 | 204 |
| 536 | 3300039437 | Ga0436365_1267353 | Ga0436365_1267353_283_900 | 204 |
| 537 | 3300039437 | Ga0436365_1510338 | Ga0436365_1510338_6528_7142 | 204 |
| 538 | 3300039437 | Ga0436365_1540036 | Ga0436365_1540036_63_677 | 204 |
| 539 | 3300039437 | Ga0436365_1789092 | Ga0436365_1789092_87_701 | 204 |
| 540 | 3300039437 | Ga0436365_1835715 | Ga0436365_1835715_773_1390 | 204 |
| 541 | 3300039438 | Ga0436360_0050291 | Ga0436360_0050291_225_839 | 204 |
| 542 | 3300039438 | Ga0436360_0399866 | Ga0436360_0399866_412_1170 | 204 |
| 543 | 3300039438 | Ga0436360_0429557 | Ga0436360_0429557_5194_5808 | 204 |
| 544 | 3300039438 | Ga0436360_0490313 | Ga0436360_0490313_1524_2138 | 204 |
| 545 | 3300039438 | Ga0436360_0517823 | Ga0436360_0517823_119_736 | 204 |
| 546 | 3300039438 | Ga0436360_0561465 | Ga0436360_0561465_2163_2777 | 204 |
| 547 | 3300039438 | Ga0436360_0660398 | Ga0436360_0660398_59_673 | 204 |
| 548 | 3300039438 | Ga0436360_0759298 | Ga0436360_0759298_52_666 | 204 |
| 549 | 3300039438 | Ga0436360_1064075 | Ga0436360_1064075_60_677 | 204 |
| 550 | 3300039438 | Ga0436360_1222696 | Ga0436360_1222696_152_769 | 204 |
| 551 | 3300039438 | Ga0436360_1254791 | Ga0436360_1254791_28_642 | 204 |
| 552 | 3300039447 | Ga0436361_0085302 | Ga0436361_0085302_956_1570 | 204 |
| 553 | 3300039447 | Ga0436361_0210296 | Ga0436361_0210296_289_903 | 204 |
| 554 | 3300039447 | Ga0436361_0221120 | Ga0436361_0221120_109_723 | 204 |
| 555 | 3300039447 | Ga0436361_0450680 | Ga0436361_0450680_913_1527 | 204 |
| 556 | 3300039447 | Ga0436361_0602217 | Ga0436361_0602217_756_1427 | 204 |
| 557 | 3300039447 | Ga0436361_0694107 | Ga0436361_0694107_99_713 | 204 |
| 558 | 3300039447 | Ga0436361_0862442 | Ga0436361_0862442_253_870 | 204 |
| 559 | 3300039447 | Ga0436361_0972347 | Ga0436361_0972347_3713_4327 | 204 |
| 560 | 3300039447 | Ga0436361_0999687 | Ga0436361_0999687_674_1291 | 204 |
| 561 | 3300039450 | Ga0436363_0060299 | Ga0436363_0060299_1029_1643 | 204 |
| 562 | 3300039450 | Ga0436363_0523610 | Ga0436363_0523610_477_1094 | 204 |
| 563 | 3300039450 | Ga0436363_0592968 | Ga0436363_0592968_166_780 | 204 |
| 564 | 3300039450 | Ga0436363_0933867 | Ga0436363_0933867_469_1086 | 204 |
| 565 | 3300039450 | Ga0436363_1453647 | Ga0436363_1453647_547_1164 | 204 |
| 566 | 3300039453 | Ga0436362_0289387 | Ga0436362_0289387_258_875 | 204 |
| 567 | 3300039453 | Ga0436362_0411021 | Ga0436362_0411021_25_642 | 204 |
| 568 | 3300039453 | Ga0436362_0604955 | Ga0436362_0604955_4699_5316 | 204 |
| 569 | 3300039453 | Ga0436362_0630243 | Ga0436362_0630243_233_850 | 204 |
| 570 | 3300039453 | Ga0436362_0787739 | Ga0436362_0787739_291_908 | 204 |
| 571 | 3300039453 | Ga0436362_0993979 | Ga0436362_0993979_4050_4742 | 204 |
| 572 | 3300039453 | Ga0436362_1076558 | Ga0436362_1076558_101_715 | 204 |
| 573 | 3300039453 | Ga0436362_1141189 | Ga0436362_1141189_212_826 | 204 |
| 574 | 3300039453 | Ga0436362_1288810 | Ga0436362_1288810_141_755 | 204 |
| 575 | 3300041459 | Ga0451800_0474877 | Ga0451800_0474877_230_844 | 204 |
| 576 | 3300041997 | Ga0439431_0073355 | Ga0439431_0073355_242_856 | 204 |
| 577 | 3300044694 | Ga0466963_0396486 | Ga0466963_0396486_67_681 | 204 |
| 578 | 3300044706 | Ga0466964_0015509 | Ga0466964_0015509_1839_2453 | 204 |
| 579 | 3300044712 | Ga0453684_0000062 | Ga0453684_0000062_309997_310611 | 204 |
| 580 | 3300044712 | Ga0453684_0000071 | Ga0453684_0000071_206073_206687 | 204 |
| 581 | 3300044712 | Ga0453684_0004682 | Ga0453684_0004682_14945_15559 | 204 |
| 582 | 3300044712 | Ga0453684_0601082 | Ga0453684_0601082_467_1081 | 204 |
| 583 | 3300044842 | Ga0466957_0028639 | Ga0466957_0028639_1108_1722 | 204 |
| 584 | 3300044901 | Ga0466960_0075572 | Ga0466960_0075572_565_1179 | 204 |
| 585 | 3300045051 | Ga0451576_0001200 | Ga0451576_0001200_35511_36125 | 204 |
| 586 | 3300045051 | Ga0451576_1122117 | Ga0451576_1122117_140_754 | 204 |
| 587 | 3300045836 | Ga0466958_0219404 | Ga0466958_0219404_501_1115 | 204 |
| 588 | 3300045836 | Ga0466958_0690280 | Ga0466958_0690280_16_630 | 204 |
| 589 | 3300045976 | Ga0466967_0236979 | Ga0466967_0236979_1033_1647 | 204 |
| 590 | 3300045976 | Ga0466967_0461375 | Ga0466967_0461375_150_764 | 204 |
| 591 | 3300046454 | Ga0495592_0062600 | Ga0495592_0062600_2009_2668 | 204 |
| 592 | 3300046454 | Ga0495592_0172972 | Ga0495592_0172972_159_773 | 204 |
| 593 | 3300046462 | Ga0495651_0025838 | Ga0495651_0025838_3799_4413 | 204 |
| 594 | 3300046462 | Ga0495651_0077719 | Ga0495651_0077719_1649_2263 | 204 |
| 595 | 3300046463 | Ga0495653_0125725 | Ga0495653_0125725_796_1410 | 204 |
| 596 | 3300046472 | Ga0495580_0145982 | Ga0495580_0145982_189_803 | 204 |
| 597 | 3300046475 | Ga0495639_0032987 | Ga0495639_0032987_785_1444 | 204 |
| 598 | 3300046476 | Ga0495662_0035977 | Ga0495662_0035977_966_1625 | 204 |
| 599 | 3300046477 | Ga0495664_0015798 | Ga0495664_0015798_2879_3493 | 204 |
| 600 | 3300046507 | Ga0495606_0406273 | Ga0495606_0406273_65_682 | 204 |
| 601 | 3300046511 | Ga0495608_0014438 | Ga0495608_0014438_2015_2629 | 204 |
| 602 | 3300046511 | Ga0495608_0029236 | Ga0495608_0029236_553_1167 | 204 |
| 603 | 3300046512 | Ga0495610_0161327 | Ga0495610_0161327_160_774 | 204 |
| 604 | 3300046514 | Ga0495618_0198464 | Ga0495618_0198464_201_860 | 204 |
| 605 | 3300046516 | Ga0495628_0085120 | Ga0495628_0085120_1768_2382 | 204 |
| 606 | 3300046517 | Ga0495630_0200753 | Ga0495630_0200753_391_1005 | 204 |
| 607 | 3300046517 | Ga0495630_0215096 | Ga0495630_0215096_712_1371 | 204 |
| 608 | 3300046522 | Ga0495643_0210664 | Ga0495643_0210664_167_781 | 204 |
| 609 | 3300046529 | Ga0495652_0096204 | Ga0495652_0096204_1564_2178 | 204 |
| 610 | 3300046533 | Ga0495640_0108697 | Ga0495640_0108697_554_1168 | 204 |
| 611 | 3300046533 | Ga0495640_0372564 | Ga0495640_0372564_124_738 | 204 |
| 612 | 3300046535 | Ga0495586_0518176 | Ga0495586_0518176_45_659 | 204 |
| 613 | 3300046536 | Ga0495587_0001558 | Ga0495587_0001558_1063_1677 | 204 |
| 614 | 3300046536 | Ga0495587_0207877 | Ga0495587_0207877_49_663 | 204 |
| 615 | 3300046543 | Ga0495645_0016793 | Ga0495645_0016793_529_1143 | 204 |
| 616 | 3300046559 | Ga0495667_0002486 | Ga0495667_0002486_2095_2709 | 204 |
| 617 | 3300046559 | Ga0495667_0011953 | Ga0495667_0011953_519_1178 | 204 |
| 618 | 3300046559 | Ga0495667_0047410 | Ga0495667_0047410_1574_2188 | 204 |
| 619 | 3300046559 | Ga0495667_0205908 | Ga0495667_0205908_264_881 | 204 |
| 620 | 3300046642 | Ga0495634_0225703 | Ga0495634_0225703_323_982 | 204 |
| 621 | 3300046642 | Ga0495634_0334740 | Ga0495634_0334740_257_871 | 204 |
| 622 | 3300046663 | Ga0495635_0355139 | Ga0495635_0355139_174_833 | 204 |
| 623 | 3300046675 | Ga0495657_0046345 | Ga0495657_0046345_1797_2411 | 204 |
| 624 | 3300046675 | Ga0495657_0060463 | Ga0495657_0060463_1495_2109 | 204 |
| 625 | 3300046678 | Ga0495599_0026360 | Ga0495599_0026360_2758_3372 | 204 |
| 626 | 3300046679 | Ga0495623_0079667 | Ga0495623_0079667_655_1269 | 204 |
| 627 | 3300047317 | Ga0495604_0060961 | Ga0495604_0060961_837_1451 | 204 |
| 628 | 3300047319 | Ga0495674_0250619 | Ga0495674_0250619_792_1406 | 204 |
| 629 | 3300047319 | Ga0495674_0379077 | Ga0495674_0379077_52_666 | 204 |
| 630 | 3300047322 | Ga0495680_0155702 | Ga0495680_0155702_415_1029 | 204 |
| 631 | 3300047322 | Ga0495680_0250047 | Ga0495680_0250047_144_758 | 204 |
| 632 | 3300047444 | Ga0495675_0004906 | Ga0495675_0004906_2409_3023 | 204 |
| 633 | 3300047444 | Ga0495675_0058436 | Ga0495675_0058436_1773_2387 | 204 |
| 634 | 3300047471 | Ga0495684_0163908 | Ga0495684_0163908_204_821 | 204 |
| 635 | 3300047471 | Ga0495684_0275376 | Ga0495684_0275376_187_846 | 204 |
| 636 | 3300048088 | Ga0495602_0001212 | Ga0495602_0001212_58_672 | 204 |
| 637 | 3300048913 | Ga0496110_0623990 | Ga0496110_0623990_207_866 | 204 |
| 638 | 3300048914 | Ga0496111_0055749 | Ga0496111_0055749_1302_1916 | 204 |
| 639 | 3300048915 | Ga0496112_0032394 | Ga0496112_0032394_2346_2960 | 204 |
| 640 | 3300048915 | Ga0496112_0417860 | Ga0496112_0417860_495_1154 | 204 |
| 641 | 3300048916 | Ga0496113_0864091 | Ga0496113_0864091_14_628 | 204 |
| 642 | 3300048924 | Ga0496121_0455049 | Ga0496121_0455049_27_641 | 204 |
| 643 | 3300048925 | Ga0496122_0023070 | Ga0496122_0023070_2613_3227 | 204 |
| 644 | 3300048929 | Ga0496126_0013350 | Ga0496126_0013350_4955_5569 | 204 |
| 645 | 3300049460 | Ga0495682_0091435 | Ga0495682_0091435_115_729 | 204 |
| 646 | 3300049530 | Ga0501314_017178 | Ga0501314_017178_29_697 | 204 |
| 647 | 3300049571 | Ga0501034_0004819 | Ga0501034_0004819_11163_11777 | 204 |
| 648 | 3300049571 | Ga0501034_0016727 | Ga0501034_0016727_3194_3808 | 204 |
| 649 | 3300049573 | Ga0501037_0186539 | Ga0501037_0186539_707_1321 | 204 |
| 650 | 3300049575 | Ga0501039_0565176 | Ga0501039_0565176_258_872 | 204 |
| 651 | 3300049579 | Ga0501043_0224253 | Ga0501043_0224253_695_1309 | 204 |
| 652 | 3300049580 | Ga0501046_0060888 | Ga0501046_0060888_205_819 | 204 |
| 653 | 3300049581 | Ga0501047_0041380 | Ga0501047_0041380_959_1573 | 204 |
| 654 | 3300049581 | Ga0501047_0054183 | Ga0501047_0054183_921_1535 | 204 |
| 655 | 3300049581 | Ga0501047_0142342 | Ga0501047_0142342_1589_2206 | 204 |
| 656 | 3300049581 | Ga0501047_0217249 | Ga0501047_0217249_62_676 | 204 |
| 657 | 3300049584 | Ga0501068_0385104 | Ga0501068_0385104_105_719 | 204 |
| 658 | 3300049585 | Ga0501069_0152429 | Ga0501069_0152429_197_811 | 204 |
| 659 | 3300049585 | Ga0501069_0256089 | Ga0501069_0256089_319_933 | 204 |
| 660 | 3300049586 | Ga0501070_0056424 | Ga0501070_0056424_2364_2978 | 204 |
| 661 | 3300049586 | Ga0501070_0119097 | Ga0501070_0119097_303_917 | 204 |
| 662 | 3300049586 | Ga0501070_0293642 | Ga0501070_0293642_301_915 | 204 |
| 663 | 3300049587 | Ga0501071_0578014 | Ga0501071_0578014_217_831 | 204 |
| 664 | 3300049588 | Ga0501072_0424530 | Ga0501072_0424530_85_699 | 204 |
| 665 | 3300049590 | Ga0501074_0243881 | Ga0501074_0243881_642_1256 | 204 |
| 666 | 3300049592 | Ga0501076_0017711 | Ga0501076_0017711_2433_3047 | 204 |
| 667 | 3300049741 | Ga0501079_0085561 | Ga0501079_0085561_31_645 | 204 |
| 668 | 3300049742 | Ga0501080_0088499 | Ga0501080_0088499_1913_2527 | 204 |
| 669 | 3300049742 | Ga0501080_0263175 | Ga0501080_0263175_921_1535 | 204 |
| 670 | 3300049744 | Ga0501083_0042062 | Ga0501083_0042062_878_1492 | 204 |
| 671 | 3300049744 | Ga0501083_0598187 | Ga0501083_0598187_53_667 | 204 |
| 672 | 3300049822 | Ga0501035_0081967 | Ga0501035_0081967_896_1510 | 204 |
| 673 | 3300049823 | Ga0501044_0033540 | Ga0501044_0033540_1350_1964 | 204 |
| 674 | 3300049823 | Ga0501044_0080571 | Ga0501044_0080571_157_771 | 204 |
| 675 | 3300049823 | Ga0501044_0115392 | Ga0501044_0115392_1218_1832 | 204 |
| 676 | 3300049824 | Ga0501045_0050250 | Ga0501045_0050250_602_1216 | 204 |
| 677 | 3300050489 | nmdc:mga03683_21383_c1 | nmdc:mga03683_21383_c1_839_1453 | 204 |
| 678 | 3300050489 | nmdc:mga03683_27988_c1 | nmdc:mga03683_27988_c1_1605_2219 | 204 |
| 679 | 3300050493 | nmdc:mga0k408_80035_c1 | nmdc:mga0k408_80035_c1_99_713 | 204 |
| 680 | 3300050495 | nmdc:mga04h51_181829_c1 | nmdc:mga04h51_181829_c1_87_713 | 204 |
| 681 | 3300050511 | nmdc:mga08y16_531320_c1 | nmdc:mga08y16_531320_c1_350_964 | 204 |
| 682 | 3300050512 | nmdc:mga0n895_207979_c1 | nmdc:mga0n895_207979_c1_694_1353 | 204 |
| 683 | 3300050516 | nmdc:mga0sz30_253691_c1 | nmdc:mga0sz30_253691_c1_135_767 | 204 |
| 684 | 3300053077 | Ga0495601_0019087 | Ga0495601_0019087_686_1300 | 204 |
| 685 | 3300053077 | Ga0495601_0100751 | Ga0495601_0100751_452_1111 | 204 |
| 686 | 3300053077 | Ga0495601_0120318 | Ga0495601_0120318_695_1309 | 204 |
| 687 | 3300053077 | Ga0495601_0127333 | Ga0495601_0127333_639_1256 | 204 |
| 688 | 3300053078 | Ga0495612_0000161 | Ga0495612_0000161_24685_25299 | 204 |
| 689 | 3300053084 | Ga0495595_0019772 | Ga0495595_0019772_411_1070 | 204 |
| 690 | 3300053084 | Ga0495595_0029837 | Ga0495595_0029837_1761_2375 | 204 |
| 691 | 3300053085 | Ga0495619_0006176 | Ga0495619_0006176_5638_6297 | 204 |
| 692 | 3300053085 | Ga0495619_0083855 | Ga0495619_0083855_555_1169 | 204 |
| 693 | 3300053085 | Ga0495619_0167133 | Ga0495619_0167133_545_1162 | 204 |
| 694 | 3300053091 | Ga0500647_0091502 | Ga0500647_0091502_189_833 | 204 |
| 695 | 3300053092 | Ga0500583_0211399 | Ga0500583_0211399_314_940 | 204 |
| 696 | 3300053096 | Ga0500641_0002314 | Ga0500641_0002314_2996_3610 | 204 |
| 697 | 3300053119 | Ga0500595_004428 | Ga0500595_004428_4496_5212 | 204 |
| 698 | 3300053146 | Ga0500588_0138756 | Ga0500588_0138756_26_640 | 204 |
| 699 | 3300053153 | Ga0500616_0003157 | Ga0500616_0003157_4524_5138 | 204 |
| 700 | 3300053153 | Ga0500616_0070085 | Ga0500616_0070085_1150_1764 | 204 |
| 701 | 3300053177 | Ga0500636_0205418 | Ga0500636_0205418_28_645 | 204 |
| 702 | 3300053178 | Ga0500637_0100230 | Ga0500637_0100230_760_1374 | 204 |
| 703 | 3300053730 | Ga0500645_089423 | Ga0500645_089423_43_657 | 204 |
| 704 | 3300053733 | Ga0500552_000088 | Ga0500552_000088_2567_3181 | 204 |
| 705 | 3300054114 | Ga0501084_0213033 | Ga0501084_0213033_968_1582 | 204 |
| 706 | 3300054114 | Ga0501084_0452219 | Ga0501084_0452219_270_884 | 204 |
| 707 | 3300059511 | Ga0587091_057063 | Ga0587091_057063_179_793 | 204 |
| 708 | 3300059623 | Ga0587101_037436 | Ga0587101_037436_102_716 | 204 |
| 709 | 3300059648 | Ga0587100_011214 | Ga0587100_011214_119_733 | 204 |
| 710 | 3300059652 | Ga0587107_033646 | Ga0587107_033646_14_628 | 204 |
| 711 | 3300060353 | Ga0501082_0017161 | Ga0501082_0017161_2799_3413 | 204 |
| 712 | 3300060353 | Ga0501082_0753626 | Ga0501082_0753626_103_717 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9752 | 49 | 149 |
| 6vwl-assembly1.cif.gz_c | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) | 0.9518 | 45 | 202 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9495 | 42 | 204 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9437 | 42 | 204 |
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9384 | 49 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0Y445_123_179_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.992 | 93 | 135 | 3.10.290.10 |
| af_Q4DSJ7_105_180_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9897 | 92 | 135 | 3.10.290.10 |
| af_C6TBL4_107_182_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9818 | 93 | 135 | 3.10.290.10 |
| af_A0A144A2N8_107_181_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9749 | 93 | 135 | 3.10.290.10 |
| af_Q9XPI8_145_195_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9725 | 92 | 142 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A5LBZ0-F1-model_v4 | deleted | 0.9993 | 45 | 203 |
|
| AF-A0A1E4F994-F1-model_v4 | Small ribosomal subunit protein uS4 (30S ribosomal protein S4) | 0.9974 | 53 | 204 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A848SWC6-F1-model_v4 | Small ribosomal subunit protein uS4 (30S ribosomal protein S4) | 0.9938 | 51 | 203 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A3B8QXB5-F1-model_v4 | 30S ribosomal protein S4 | 0.9931 | 70 | 203 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A0F3QSG6-F1-model_v4 | deleted | 0.9913 | 43 | 204 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar