F476650
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 297 | 703 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100028054|Ga0075434_10002805410 |
| Length | 238 |
| Sequence | MGAVLRSGAGCDRLEEQFGIFLAQPEENDLARYRDSVCRLCRREGMKLFLKGDRCLKPSCAIEKRNFAPGQHGKDRKSKVVGYGLQLREKQKVKRIYGLLEGQFRNYFEKAERQKGITGENLLLLLERRLDNIVYRLGFATSRAQSRQFIGHGHVRVNNLKVNIPSYQVKSGDVVSIVEKSQKIPSITSAVEMVGSRGVPNWLELDGAKFSGKVLTLPRREDIGLPVQERLIVELYSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 2 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 3 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 4 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 5 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 10 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 143 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 159 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 163 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 164 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 172 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 193 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 199 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 200 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 201 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 202 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 297 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.11 |
| Metatranscriptomes | 8.04 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 95.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10017129 | 3300001991 | Bacteria | 1358 |
| 2 | JGI25150J39212_1007938 | 3300002774 | Bacteria | 2104 |
| 3 | JGI25407J50210_10002202 | 3300003373 | Bacteria | 4563 |
| 4 | JGI26138J51218_100719 | 3300003504 | Bacteria | 1246 |
| 5 | Ga0058692_1000048 | 3300003856 | Bacteria | 110906 |
| 6 | Ga0058861_10010832 | 3300004800 | Bacteria | 781 |
| 7 | Ga0065714_10071913 | 3300005288 | Bacteria | 3469 |
| 8 | Ga0065714_10078587 | 3300005288 | Bacteria | 2586 |
| 9 | Ga0065704_10006414 | 3300005289 | Bacteria | 3092 |
| 10 | Ga0065712_10069958 | 3300005290 | Bacteria | 6466 |
| 11 | Ga0065712_10325143 | 3300005290 | Bacteria | 822 |
| 12 | Ga0065707_10003866 | 3300005295 | Bacteria | 6530 |
| 13 | Ga0065707_10087143 | 3300005295 | Bacteria | 5147 |
| 14 | Ga0065707_10111745 | 3300005295 | Bacteria | 2384 |
| 15 | Ga0070658_10004878 | 3300005327 | Bacteria | 10928 |
| 16 | Ga0070690_100004138 | 3300005330 | Bacteria | 8025 |
| 17 | Ga0070670_100004112 | 3300005331 | Bacteria | 12158 |
| 18 | Ga0068869_100054740 | 3300005334 | Bacteria | 2906 |
| 19 | Ga0068869_100164438 | 3300005334 | Bacteria | 1729 |
| 20 | Ga0068869_100731449 | 3300005334 | Bacteria | 846 |
| 21 | Ga0070680_100807235 | 3300005336 | Bacteria | 808 |
| 22 | Ga0068868_100657787 | 3300005338 | Unclassified | 934 |
| 23 | Ga0070660_100252820 | 3300005339 | Bacteria | 1437 |
| 24 | Ga0070687_100266757 | 3300005343 | Bacteria | 1071 |
| 25 | Ga0070675_100908153 | 3300005354 | Bacteria | 807 |
| 26 | Ga0070673_100305882 | 3300005364 | Bacteria | 1401 |
| 27 | Ga0070688_100010141 | 3300005365 | Bacteria | 5183 |
| 28 | Ga0070688_100021526 | 3300005365 | Bacteria | 3768 |
| 29 | Ga0070703_10000317 | 3300005406 | Bacteria | 21976 |
| 30 | Ga0070703_10019413 | 3300005406 | Bacteria | 1970 |
| 31 | Ga0070703_10160179 | 3300005406 | Bacteria | 853 |
| 32 | Ga0070709_10000098 | 3300005434 | Bacteria | 61823 |
| 33 | Ga0070709_10486156 | 3300005434 | Bacteria | 936 |
| 34 | Ga0070713_100219189 | 3300005436 | Bacteria | 1725 |
| 35 | Ga0070701_10041796 | 3300005438 | Bacteria | 2338 |
| 36 | Ga0070701_10173950 | 3300005438 | Bacteria | 1256 |
| 37 | Ga0070711_100000059 | 3300005439 | Bacteria | 65064 |
| 38 | Ga0070711_100656995 | 3300005439 | Bacteria | 879 |
| 39 | Ga0070705_100012679 | 3300005440 | Bacteria | 4292 |
| 40 | Ga0070705_100129356 | 3300005440 | Bacteria | 1645 |
| 41 | Ga0070705_100148519 | 3300005440 | Bacteria | 1552 |
| 42 | Ga0070705_100365654 | 3300005440 | Bacteria | 1057 |
| 43 | Ga0070700_100152864 | 3300005441 | Bacteria | 1580 |
| 44 | Ga0070700_100338076 | 3300005441 | Bacteria | 1112 |
| 45 | Ga0070694_100146966 | 3300005444 | Bacteria | 1718 |
| 46 | Ga0070694_100297061 | 3300005444 | Bacteria | 1236 |
| 47 | Ga0070694_100519705 | 3300005444 | Bacteria | 950 |
| 48 | Ga0070708_100000092 | 3300005445 | Bacteria | 59199 |
| 49 | Ga0070708_100005832 | 3300005445 | Bacteria | 9776 |
| 50 | Ga0070708_100015734 | 3300005445 | Bacteria | 6252 |
| 51 | Ga0070708_100035227 | 3300005445 | Bacteria | 4360 |
| 52 | Ga0070708_100068478 | 3300005445 | Bacteria | 3190 |
| 53 | Ga0070708_100127832 | 3300005445 | Bacteria | 2350 |
| 54 | Ga0070708_100685904 | 3300005445 | Bacteria | 965 |
| 55 | Ga0070708_101191325 | 3300005445 | Bacteria | 713 |
| 56 | Ga0070662_100261691 | 3300005457 | Bacteria | 1394 |
| 57 | Ga0070681_10046903 | 3300005458 | Bacteria | 4319 |
| 58 | Ga0068867_100055178 | 3300005459 | Bacteria | 2937 |
| 59 | Ga0070685_10015888 | 3300005466 | Bacteria | 4004 |
| 60 | Ga0070706_100001316 | 3300005467 | Bacteria | 26391 |
| 61 | Ga0070706_100010237 | 3300005467 | Bacteria | 8716 |
| 62 | Ga0070706_100011787 | 3300005467 | Bacteria | 8115 |
| 63 | Ga0070706_100074590 | 3300005467 | Bacteria | 3140 |
| 64 | Ga0070706_100090228 | 3300005467 | Bacteria | 2842 |
| 65 | Ga0070706_100119837 | 3300005467 | Bacteria | 2452 |
| 66 | Ga0070706_100211298 | 3300005467 | Bacteria | 1812 |
| 67 | Ga0070706_100324516 | 3300005467 | Bacteria | 1435 |
| 68 | Ga0070707_100024115 | 3300005468 | Bacteria | 5758 |
| 69 | Ga0070707_100033784 | 3300005468 | Bacteria | 4877 |
| 70 | Ga0070707_100038225 | 3300005468 | Bacteria | 4583 |
| 71 | Ga0070707_100064600 | 3300005468 | Bacteria | 3514 |
| 72 | Ga0070707_100126568 | 3300005468 | Bacteria | 2482 |
| 73 | Ga0070707_100596360 | 3300005468 | Bacteria | 1067 |
| 74 | Ga0070707_100786433 | 3300005468 | Bacteria | 915 |
| 75 | Ga0070698_100070375 | 3300005471 | Bacteria | 3511 |
| 76 | Ga0070698_100104288 | 3300005471 | Bacteria | 2805 |
| 77 | Ga0070698_100255597 | 3300005471 | Bacteria | 1684 |
| 78 | Ga0070698_100416971 | 3300005471 | Bacteria | 1277 |
| 79 | Ga0070699_100000009 | 3300005518 | Bacteria | 272902 |
| 80 | Ga0070699_100028609 | 3300005518 | Bacteria | 4805 |
| 81 | Ga0070699_100048892 | 3300005518 | Bacteria | 3660 |
| 82 | Ga0070699_100177476 | 3300005518 | Unclassified | 1889 |
| 83 | Ga0070699_100438516 | 3300005518 | Bacteria | 1184 |
| 84 | Ga0070684_100092545 | 3300005535 | Bacteria | 2690 |
| 85 | Ga0070697_100030323 | 3300005536 | Bacteria | 4344 |
| 86 | Ga0070697_100579808 | 3300005536 | Bacteria | 985 |
| 87 | Ga0070686_100042639 | 3300005544 | Bacteria | 2843 |
| 88 | Ga0070686_100139579 | 3300005544 | Bacteria | 1685 |
| 89 | Ga0070686_100143805 | 3300005544 | Bacteria | 1663 |
| 90 | Ga0070686_100350479 | 3300005544 | Bacteria | 1109 |
| 91 | Ga0070686_100396679 | 3300005544 | Unclassified | 1048 |
| 92 | Ga0070686_100632492 | 3300005544 | Bacteria | 847 |
| 93 | Ga0070686_100800728 | 3300005544 | Bacteria | 760 |
| 94 | Ga0070695_100143193 | 3300005545 | Bacteria | 1660 |
| 95 | Ga0070695_100323897 | 3300005545 | Bacteria | 1146 |
| 96 | Ga0070695_100654972 | 3300005545 | Bacteria | 829 |
| 97 | Ga0070696_100000153 | 3300005546 | Bacteria | 38514 |
| 98 | Ga0070696_100062684 | 3300005546 | Bacteria | 2603 |
| 99 | Ga0070696_100065752 | 3300005546 | Bacteria | 2542 |
| 100 | Ga0070696_100496134 | 3300005546 | Bacteria | 970 |
| 101 | Ga0070696_100642281 | 3300005546 | Bacteria | 860 |
| 102 | Ga0070693_100336844 | 3300005547 | Bacteria | 1028 |
| 103 | Ga0070704_100016174 | 3300005549 | Bacteria | 4709 |
| 104 | Ga0070704_100064036 | 3300005549 | Bacteria | 2641 |
| 105 | Ga0070704_100101329 | 3300005549 | Bacteria | 2170 |
| 106 | Ga0070704_100239973 | 3300005549 | Bacteria | 1483 |
| 107 | Ga0070704_101097632 | 3300005549 | Bacteria | 722 |
| 108 | Ga0068855_100025740 | 3300005563 | Bacteria | 7036 |
| 109 | Ga0068857_100399521 | 3300005577 | Bacteria | 1279 |
| 110 | Ga0068856_100184992 | 3300005614 | Bacteria | 2097 |
| 111 | Ga0068856_100290876 | 3300005614 | Bacteria | 1650 |
| 112 | Ga0070702_100789825 | 3300005615 | Bacteria | 733 |
| 113 | Ga0068859_100023116 | 3300005617 | Bacteria | 6235 |
| 114 | Ga0068859_100150725 | 3300005617 | Bacteria | 2401 |
| 115 | Ga0068859_100265391 | 3300005617 | Bacteria | 1809 |
| 116 | Ga0068859_100433433 | 3300005617 | Bacteria | 1411 |
| 117 | Ga0068864_100282770 | 3300005618 | Bacteria | 1549 |
| 118 | Ga0068861_100235347 | 3300005719 | Bacteria | 1555 |
| 119 | Ga0068870_10018891 | 3300005840 | Bacteria | 3336 |
| 120 | Ga0068863_100194310 | 3300005841 | Bacteria | 1951 |
| 121 | Ga0068863_100256165 | 3300005841 | Bacteria | 1691 |
| 122 | Ga0068858_100063036 | 3300005842 | Bacteria | 3429 |
| 123 | Ga0068858_100619064 | 3300005842 | Bacteria | 1051 |
| 124 | Ga0068860_100025069 | 3300005843 | Bacteria | 5756 |
| 125 | Ga0068860_100158587 | 3300005843 | Bacteria | 2181 |
| 126 | Ga0068860_101087734 | 3300005843 | Bacteria | 819 |
| 127 | Ga0081455_10083326 | 3300005937 | Bacteria | 2613 |
| 128 | Ga0081455_10127541 | 3300005937 | Bacteria | 1994 |
| 129 | Ga0081538_10000250 | 3300005981 | Bacteria | 60946 |
| 130 | Ga0081538_10002371 | 3300005981 | Bacteria | 18522 |
| 131 | Ga0081538_10042593 | 3300005981 | Bacteria | 2862 |
| 132 | Ga0081539_10015944 | 3300005985 | Bacteria | 5415 |
| 133 | Ga0070715_10082397 | 3300006163 | Bacteria | 1463 |
| 134 | Ga0070716_100013911 | 3300006173 | Bacteria | 4112 |
| 135 | Ga0070712_100046521 | 3300006175 | Bacteria | 3000 |
| 136 | Ga0070712_100620565 | 3300006175 | Bacteria | 916 |
| 137 | Ga0097621_100923162 | 3300006237 | Bacteria | 814 |
| 138 | Ga0075370_10035734 | 3300006353 | Bacteria | 2790 |
| 139 | Ga0075428_100000694 | 3300006844 | Bacteria | 34739 |
| 140 | Ga0075428_100038782 | 3300006844 | Bacteria | 5243 |
| 141 | Ga0075428_100093827 | 3300006844 | Bacteria | 3272 |
| 142 | Ga0075428_100097922 | 3300006844 | Bacteria | 3198 |
| 143 | Ga0075428_100103500 | 3300006844 | Bacteria | 3105 |
| 144 | Ga0075428_100434303 | 3300006844 | Bacteria | 1407 |
| 145 | Ga0075428_100878427 | 3300006844 | Bacteria | 951 |
| 146 | Ga0075430_100019248 | 3300006846 | Bacteria | 5804 |
| 147 | Ga0075430_100820096 | 3300006846 | Bacteria | 767 |
| 148 | Ga0075431_100051274 | 3300006847 | Bacteria | 4256 |
| 149 | Ga0075431_100422689 | 3300006847 | Bacteria | 1332 |
| 150 | Ga0075431_100654931 | 3300006847 | Bacteria | 1030 |
| 151 | Ga0075433_10000980 | 3300006852 | Bacteria | 20289 |
| 152 | Ga0075433_10031678 | 3300006852 | Bacteria | 4521 |
| 153 | Ga0075433_10037835 | 3300006852 | Bacteria | 4164 |
| 154 | Ga0075433_10076682 | 3300006852 | Bacteria | 2944 |
| 155 | Ga0075433_10116481 | 3300006852 | Bacteria | 2371 |
| 156 | Ga0075433_10126725 | 3300006852 | Bacteria | 2267 |
| 157 | Ga0075433_10220824 | 3300006852 | Bacteria | 1683 |
| 158 | Ga0075433_10452365 | 3300006852 | Bacteria | 1132 |
| 159 | Ga0075434_100028054 | 3300006871 | Bacteria | 5529 |
| 160 | Ga0075434_100129993 | 3300006871 | Bacteria | 2537 |
| 161 | Ga0075434_100365168 | 3300006871 | Bacteria | 1464 |
| 162 | Ga0075434_100440906 | 3300006871 | Bacteria | 1323 |
| 163 | Ga0075434_100771944 | 3300006871 | Bacteria | 978 |
| 164 | Ga0075434_100942197 | 3300006871 | Bacteria | 878 |
| 165 | Ga0075434_101069110 | 3300006871 | Unclassified | 820 |
| 166 | Ga0075429_100319932 | 3300006880 | Bacteria | 1358 |
| 167 | Ga0075429_100396123 | 3300006880 | Unclassified | 1209 |
| 168 | Ga0075429_100964785 | 3300006880 | Bacteria | 746 |
| 169 | Ga0075436_100021490 | 3300006914 | Bacteria | 4430 |
| 170 | Ga0075436_100109982 | 3300006914 | Bacteria | 1923 |
| 171 | Ga0075436_100111404 | 3300006914 | Bacteria | 1911 |
| 172 | Ga0075436_100180277 | 3300006914 | Bacteria | 1493 |
| 173 | Ga0075436_100293250 | 3300006914 | Bacteria | 1165 |
| 174 | Ga0097620_100023118 | 3300006931 | Bacteria | 6235 |
| 175 | Ga0097620_100150720 | 3300006931 | Bacteria | 2401 |
| 176 | Ga0097620_100265382 | 3300006931 | Bacteria | 1809 |
| 177 | Ga0097620_100433468 | 3300006931 | Bacteria | 1411 |
| 178 | Ga0075435_100039021 | 3300007076 | Bacteria | 3789 |
| 179 | Ga0075435_100167058 | 3300007076 | Bacteria | 1855 |
| 180 | Ga0075435_100212446 | 3300007076 | Bacteria | 1642 |
| 181 | Ga0075435_100322304 | 3300007076 | Bacteria | 1323 |
| 182 | Ga0075435_100379290 | 3300007076 | Bacteria | 1214 |
| 183 | Ga0099794_10000042 | 3300007265 | Bacteria | 50201 |
| 184 | Ga0099794_10001613 | 3300007265 | Bacteria | 7957 |
| 185 | Ga0111539_10006016 | 3300009094 | Bacteria | 15679 |
| 186 | Ga0111539_10009725 | 3300009094 | Bacteria | 12138 |
| 187 | Ga0111539_10024178 | 3300009094 | Bacteria | 7460 |
| 188 | Ga0111539_10217901 | 3300009094 | Bacteria | 2223 |
| 189 | Ga0111539_10234530 | 3300009094 | Bacteria | 2136 |
| 190 | Ga0111539_10302060 | 3300009094 | Unclassified | 1863 |
| 191 | Ga0111539_11064106 | 3300009094 | Bacteria | 940 |
| 192 | Ga0111539_11304446 | 3300009094 | Bacteria | 843 |
| 193 | Ga0105245_10048434 | 3300009098 | Bacteria | 3802 |
| 194 | Ga0114129_10043050 | 3300009147 | Bacteria | 6355 |
| 195 | Ga0114129_10139563 | 3300009147 | Bacteria | 3323 |
| 196 | Ga0114129_10244086 | 3300009147 | Bacteria | 2413 |
| 197 | Ga0114129_10322163 | 3300009147 | Bacteria | 2054 |
| 198 | Ga0114129_10355930 | 3300009147 | Bacteria | 1938 |
| 199 | Ga0114129_10537326 | 3300009147 | Unclassified | 1522 |
| 200 | Ga0114129_10863572 | 3300009147 | Unclassified | 1149 |
| 201 | Ga0114129_11037715 | 3300009147 | Bacteria | 1030 |
| 202 | Ga0105243_10152057 | 3300009148 | Bacteria | 1986 |
| 203 | Ga0105243_10509721 | 3300009148 | Bacteria | 1142 |
| 204 | Ga0105241_10561229 | 3300009174 | Bacteria | 1026 |
| 205 | Ga0105242_10006482 | 3300009176 | Bacteria | 9013 |
| 206 | Ga0105242_10159590 | 3300009176 | Bacteria | 1972 |
| 207 | Ga0105242_10191532 | 3300009176 | Bacteria | 1811 |
| 208 | Ga0105242_10250786 | 3300009176 | Bacteria | 1595 |
| 209 | Ga0105248_10146643 | 3300009177 | Bacteria | 2663 |
| 210 | Ga0105248_10432757 | 3300009177 | Bacteria | 1482 |
| 211 | Ga0099796_10039519 | 3300010159 | Bacteria | 1589 |
| 212 | Ga0105239_10515706 | 3300010375 | Bacteria | 1360 |
| 213 | Ga0105239_10627179 | 3300010375 | Bacteria | 1227 |
| 214 | Ga0157374_10318285 | 3300013296 | Bacteria | 1541 |
| 215 | Ga0157374_11570981 | 3300013296 | Unclassified | 682 |
| 216 | Ga0157378_10232549 | 3300013297 | Bacteria | 1757 |
| 217 | Ga0157378_10323704 | 3300013297 | Bacteria | 1498 |
| 218 | Ga0157378_10512851 | 3300013297 | Bacteria | 1199 |
| 219 | Ga0163162_11402171 | 3300013306 | Bacteria | 795 |
| 220 | Ga0157375_10140366 | 3300013308 | Bacteria | 2543 |
| 221 | Ga0157375_10495920 | 3300013308 | Bacteria | 1385 |
| 222 | Ga0163163_10014061 | 3300014325 | Bacteria | 7346 |
| 223 | Ga0163163_10109954 | 3300014325 | Bacteria | 2784 |
| 224 | Ga0163163_10125103 | 3300014325 | Bacteria | 2608 |
| 225 | Ga0157380_10010165 | 3300014326 | Bacteria | 6763 |
| 226 | Ga0157380_10082874 | 3300014326 | Bacteria | 2626 |
| 227 | Ga0157380_10793711 | 3300014326 | Bacteria | 963 |
| 228 | Ga0157377_10073583 | 3300014745 | Bacteria | 1980 |
| 229 | Ga0157379_10207601 | 3300014968 | Bacteria | 1772 |
| 230 | Ga0157379_10267362 | 3300014968 | Bacteria | 1554 |
| 231 | Ga0157379_10600456 | 3300014968 | Bacteria | 1027 |
| 232 | Ga0157376_10297477 | 3300014969 | Bacteria | 1526 |
| 233 | Ga0157376_11089257 | 3300014969 | Bacteria | 824 |
| 234 | Ga0163161_11103908 | 3300017792 | Bacteria | 682 |
| 235 | Ga0206354_11440846 | 3300020081 | Bacteria | 1044 |
| 236 | Ga0213876_10042611 | 3300021384 | Bacteria | 2398 |
| 237 | Ga0207653_10000020 | 3300025885 | Bacteria | 136681 |
| 238 | Ga0207653_10082954 | 3300025885 | Bacteria | 1112 |
| 239 | Ga0207699_10000005 | 3300025906 | Bacteria | 534560 |
| 240 | Ga0207705_10004481 | 3300025909 | Bacteria | 10556 |
| 241 | Ga0207684_10002118 | 3300025910 | Bacteria | 20347 |
| 242 | Ga0207684_10018534 | 3300025910 | Bacteria | 5958 |
| 243 | Ga0207684_10034991 | 3300025910 | Bacteria | 4265 |
| 244 | Ga0207684_10116254 | 3300025910 | Bacteria | 2291 |
| 245 | Ga0207684_10211624 | 3300025910 | Bacteria | 1672 |
| 246 | Ga0207684_10229841 | 3300025910 | Bacteria | 1601 |
| 247 | Ga0207684_10942593 | 3300025910 | Bacteria | 724 |
| 248 | Ga0207695_10923455 | 3300025913 | Bacteria | 752 |
| 249 | Ga0207693_10041454 | 3300025915 | Bacteria | 3624 |
| 250 | Ga0207693_10622312 | 3300025915 | Bacteria | 840 |
| 251 | Ga0207663_10000004 | 3300025916 | Bacteria | 294638 |
| 252 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 253 | Ga0207662_10293550 | 3300025918 | Bacteria | 1079 |
| 254 | Ga0207662_10370025 | 3300025918 | Bacteria | 966 |
| 255 | Ga0207657_10107023 | 3300025919 | Bacteria | 2313 |
| 256 | Ga0207652_10360838 | 3300025921 | Bacteria | 1311 |
| 257 | Ga0207646_10028575 | 3300025922 | Bacteria | 5073 |
| 258 | Ga0207646_10037146 | 3300025922 | Bacteria | 4392 |
| 259 | Ga0207646_10210359 | 3300025922 | Bacteria | 1757 |
| 260 | Ga0207646_10610322 | 3300025922 | Bacteria | 979 |
| 261 | Ga0207650_10025331 | 3300025925 | Bacteria | 4226 |
| 262 | Ga0207687_10068636 | 3300025927 | Bacteria | 2526 |
| 263 | Ga0207700_10270557 | 3300025928 | Bacteria | 1458 |
| 264 | Ga0207664_10044350 | 3300025929 | Bacteria | 3482 |
| 265 | Ga0207690_10249236 | 3300025932 | Bacteria | 1371 |
| 266 | Ga0207686_10060186 | 3300025934 | Bacteria | 2403 |
| 267 | Ga0207686_10228561 | 3300025934 | Bacteria | 1347 |
| 268 | Ga0207686_10748398 | 3300025934 | Bacteria | 780 |
| 269 | Ga0207670_10041931 | 3300025936 | Bacteria | 3012 |
| 270 | Ga0207670_10054611 | 3300025936 | Bacteria | 2696 |
| 271 | Ga0207670_10712717 | 3300025936 | Bacteria | 831 |
| 272 | Ga0207665_10013618 | 3300025939 | Bacteria | 5351 |
| 273 | Ga0207711_10466134 | 3300025941 | Bacteria | 1176 |
| 274 | Ga0207689_10030894 | 3300025942 | Bacteria | 4462 |
| 275 | Ga0207689_10647854 | 3300025942 | Bacteria | 890 |
| 276 | Ga0207661_10187411 | 3300025944 | Bacteria | 1812 |
| 277 | Ga0207703_10633985 | 3300026035 | Bacteria | 1013 |
| 278 | Ga0207639_10205235 | 3300026041 | Bacteria | 1693 |
| 279 | Ga0207708_10151584 | 3300026075 | Bacteria | 1825 |
| 280 | Ga0207708_10153468 | 3300026075 | Bacteria | 1815 |
| 281 | Ga0207708_10234993 | 3300026075 | Bacteria | 1472 |
| 282 | Ga0207702_10158054 | 3300026078 | Bacteria | 2068 |
| 283 | Ga0207702_10540642 | 3300026078 | Bacteria | 1139 |
| 284 | Ga0207702_10576422 | 3300026078 | Bacteria | 1103 |
| 285 | Ga0207641_10070148 | 3300026088 | Bacteria | 3011 |
| 286 | Ga0207641_10127085 | 3300026088 | Bacteria | 2284 |
| 287 | Ga0207641_10440903 | 3300026088 | Bacteria | 1257 |
| 288 | Ga0207648_10033790 | 3300026089 | Bacteria | 4509 |
| 289 | Ga0207648_10151012 | 3300026089 | Bacteria | 2050 |
| 290 | Ga0207676_10401872 | 3300026095 | Bacteria | 1280 |
| 291 | Ga0207675_100168611 | 3300026118 | Bacteria | 2092 |
| 292 | Ga0207675_100269085 | 3300026118 | Bacteria | 1653 |
| 293 | Ga0207675_100422382 | 3300026118 | Bacteria | 1317 |
| 294 | Ga0207675_100676088 | 3300026118 | Bacteria | 1040 |
| 295 | Ga0209588_1000034 | 3300027671 | Bacteria | 66337 |
| 296 | Ga0209588_1002219 | 3300027671 | Bacteria | 5248 |
| 297 | Ga0209974_10018041 | 3300027876 | Bacteria | 2340 |
| 298 | Ga0207428_10146257 | 3300027907 | Bacteria | 1801 |
| 299 | Ga0207428_10242953 | 3300027907 | Bacteria | 1345 |
| 300 | Ga0268265_10140439 | 3300028380 | Bacteria | 2022 |
| 301 | Ga0268264_10011525 | 3300028381 | Bacteria | 7304 |
| 302 | Ga0268264_10197545 | 3300028381 | Bacteria | 1838 |
| 303 | Ga0268264_10320820 | 3300028381 | Bacteria | 1465 |
| 304 | Ga0268264_10551028 | 3300028381 | Bacteria | 1131 |
| 305 | Ga0268264_10783648 | 3300028381 | Bacteria | 952 |
| 306 | Ga0268264_11043258 | 3300028381 | Bacteria | 825 |
| 307 | Ga0265326_10004879 | 3300028558 | Bacteria | 4252 |
| 308 | Ga0265319_1000071 | 3300028563 | Bacteria | 81543 |
| 309 | Ga0265334_10000005 | 3300028573 | Bacteria | 242590 |
| 310 | Ga0265334_10000272 | 3300028573 | Bacteria | 29197 |
| 311 | Ga0265318_10000273 | 3300028577 | Bacteria | 43832 |
| 312 | Ga0265318_10001387 | 3300028577 | Bacteria | 14390 |
| 313 | Ga0265338_10145149 | 3300028800 | Bacteria | 1852 |
| 314 | Ga0265338_10513231 | 3300028800 | Bacteria | 843 |
| 315 | Ga0311001_1018981 | 3300029277 | Bacteria | 1148 |
| 316 | Ga0310981_1071358 | 3300029285 | Unclassified | 984 |
| 317 | Ga0265330_10000998 | 3300031235 | Bacteria | 17255 |
| 318 | Ga0265332_10000280 | 3300031238 | Bacteria | 40175 |
| 319 | Ga0265328_10016001 | 3300031239 | Bacteria | 2927 |
| 320 | Ga0265320_10000485 | 3300031240 | Bacteria | 31127 |
| 321 | Ga0265320_10057563 | 3300031240 | Bacteria | 1864 |
| 322 | Ga0265325_10001575 | 3300031241 | Bacteria | 15904 |
| 323 | Ga0265329_10000013 | 3300031242 | Bacteria | 70645 |
| 324 | Ga0265340_10000189 | 3300031247 | Bacteria | 31156 |
| 325 | Ga0265340_10019984 | 3300031247 | Bacteria | 3445 |
| 326 | Ga0265339_10008773 | 3300031249 | Bacteria | 6404 |
| 327 | Ga0265339_10111919 | 3300031249 | Bacteria | 1412 |
| 328 | Ga0265331_10002207 | 3300031250 | Bacteria | 13369 |
| 329 | Ga0265331_10014737 | 3300031250 | Bacteria | 4152 |
| 330 | Ga0265331_10047618 | 3300031250 | Bacteria | 2063 |
| 331 | Ga0265331_10059653 | 3300031250 | Bacteria | 1804 |
| 332 | Ga0265327_10001206 | 3300031251 | Bacteria | 34837 |
| 333 | Ga0265327_10003993 | 3300031251 | Bacteria | 13449 |
| 334 | Ga0265327_10005519 | 3300031251 | Bacteria | 10519 |
| 335 | Ga0265327_10029744 | 3300031251 | Bacteria | 3101 |
| 336 | Ga0265327_10052437 | 3300031251 | Bacteria | 2124 |
| 337 | Ga0265327_10093049 | 3300031251 | Bacteria | 1467 |
| 338 | Ga0265327_10172328 | 3300031251 | Bacteria | 994 |
| 339 | Ga0265316_10001048 | 3300031344 | Bacteria | 29962 |
| 340 | Ga0265316_10001953 | 3300031344 | Bacteria | 21664 |
| 341 | Ga0265316_10002957 | 3300031344 | Bacteria | 17386 |
| 342 | Ga0265316_10025549 | 3300031344 | Bacteria | 4927 |
| 343 | Ga0307509_10000050 | 3300031507 | Bacteria | 165692 |
| 344 | Ga0265313_10000014 | 3300031595 | Bacteria | 156295 |
| 345 | Ga0265313_10000463 | 3300031595 | Bacteria | 42820 |
| 346 | Ga0265313_10001355 | 3300031595 | Bacteria | 23078 |
| 347 | Ga0307508_10012217 | 3300031616 | Bacteria | 7853 |
| 348 | Ga0316575_10022396 | 3300031665 | Bacteria | 2438 |
| 349 | Ga0316575_10030687 | 3300031665 | Bacteria | 2102 |
| 350 | Ga0316575_10042145 | 3300031665 | Bacteria | 1807 |
| 351 | Ga0316579_10019220 | 3300031691 | Unclassified | 3016 |
| 352 | Ga0265314_10002804 | 3300031711 | Bacteria | 17395 |
| 353 | Ga0265314_10026291 | 3300031711 | Bacteria | 4374 |
| 354 | Ga0265314_10050812 | 3300031711 | Bacteria | 2891 |
| 355 | Ga0265342_10000471 | 3300031712 | Bacteria | 43707 |
| 356 | Ga0316576_10165433 | 3300031727 | Bacteria | 1669 |
| 357 | Ga0316576_10345156 | 3300031727 | Bacteria | 1108 |
| 358 | Ga0316578_10005622 | 3300031728 | Bacteria | 6102 |
| 359 | Ga0316577_10031090 | 3300031733 | Bacteria | 2982 |
| 360 | Ga0316577_10102227 | 3300031733 | Bacteria | 1607 |
| 361 | Ga0316577_10103453 | 3300031733 | Unclassified | 1597 |
| 362 | Ga0307413_10006103 | 3300031824 | Bacteria | 5465 |
| 363 | Ga0307410_10045714 | 3300031852 | Bacteria | 2917 |
| 364 | Ga0307410_10412820 | 3300031852 | Bacteria | 1093 |
| 365 | Ga0307407_10018264 | 3300031903 | Bacteria | 3543 |
| 366 | Ga0307409_100002915 | 3300031995 | Bacteria | 9086 |
| 367 | Ga0307409_101398764 | 3300031995 | Bacteria | 726 |
| 368 | Ga0307414_10011674 | 3300032004 | Bacteria | 5163 |
| 369 | Ga0307411_10056297 | 3300032005 | Bacteria | 2591 |
| 370 | Ga0316585_10017604 | 3300032137 | Unclassified | 2162 |
| 371 | Ga0316593_10000033 | 3300032168 | Bacteria | 14603 |
| 372 | Ga0316593_10000918 | 3300032168 | Bacteria | 6043 |
| 373 | Ga0316593_10001049 | 3300032168 | Bacteria | 5761 |
| 374 | Ga0316593_10003675 | 3300032168 | Unclassified | 3840 |
| 375 | Ga0316593_10004660 | 3300032168 | Unclassified | 3539 |
| 376 | Ga0316593_10006758 | 3300032168 | Bacteria | 3116 |
| 377 | Ga0316593_10012789 | 3300032168 | Bacteria | 2470 |
| 378 | Ga0316593_10015794 | 3300032168 | Bacteria | 2279 |
| 379 | Ga0316593_10018179 | 3300032168 | Bacteria | 2156 |
| 380 | Ga0316593_10047659 | 3300032168 | Bacteria | 1441 |
| 381 | Ga0316593_10049598 | 3300032168 | Bacteria | 1415 |
| 382 | Ga0316593_10067209 | 3300032168 | Bacteria | 1235 |
| 383 | Ga0316593_10104479 | 3300032168 | Bacteria | 1008 |
| 384 | Ga0316593_10108027 | 3300032168 | Bacteria | 992 |
| 385 | Ga0316593_10206853 | 3300032168 | Bacteria | 727 |
| 386 | Ga0316592_1002213 | 3300033524 | Bacteria | 3321 |
| 387 | Ga0316592_1005880 | 3300033524 | Bacteria | 2345 |
| 388 | Ga0316592_1024655 | 3300033524 | Bacteria | 1294 |
| 389 | Ga0316592_1029619 | 3300033524 | Bacteria | 1188 |
| 390 | Ga0316586_1000676 | 3300033527 | Bacteria | 3435 |
| 391 | Ga0316586_1025095 | 3300033527 | Bacteria | 1002 |
| 392 | Ga0316588_1019197 | 3300033528 | Bacteria | 1538 |
| 393 | Ga0316588_1020983 | 3300033528 | Bacteria | 1483 |
| 394 | Ga0316587_1001803 | 3300033529 | Bacteria | 2737 |
| 395 | Ga0316587_1005623 | 3300033529 | Bacteria | 1888 |
| 396 | Ga0316596_1000026 | 3300033541 | Bacteria | 14495 |
| 397 | Ga0316596_1000066 | 3300033541 | Bacteria | 12106 |
| 398 | Ga0316596_1000070 | 3300033541 | Bacteria | 11847 |
| 399 | Ga0316596_1000471 | 3300033541 | Bacteria | 6810 |
| 400 | Ga0316596_1000625 | 3300033541 | Bacteria | 6297 |
| 401 | Ga0316596_1001049 | 3300033541 | Bacteria | 5352 |
| 402 | Ga0316596_1002786 | 3300033541 | Bacteria | 3773 |
| 403 | Ga0316596_1004895 | 3300033541 | Bacteria | 3028 |
| 404 | Ga0316596_1005854 | 3300033541 | Bacteria | 2831 |
| 405 | Ga0316596_1012367 | 3300033541 | Bacteria | 2098 |
| 406 | Ga0316596_1014403 | 3300033541 | Bacteria | 1960 |
| 407 | Ga0316596_1015033 | 3300033541 | Bacteria | 1926 |
| 408 | Ga0316596_1017959 | 3300033541 | Bacteria | 1785 |
| 409 | Ga0316596_1040972 | 3300033541 | Bacteria | 1217 |
| 410 | Ga0316596_1045135 | 3300033541 | Bacteria | 1162 |
| 411 | Ga0316596_1053100 | 3300033541 | Bacteria | 1075 |
| 412 | Ga0316596_1082693 | 3300033541 | Bacteria | 863 |
| 413 | Ga0373923_0256444 | 3300035111 | Bacteria | 820 |
| 414 | Ga0373932_0063413 | 3300035112 | Bacteria | 1129 |
| 415 | Ga0373939_0095790 | 3300035114 | Bacteria | 1011 |
| 416 | Ga0373945_0105373 | 3300035116 | Bacteria | 1108 |
| 417 | Ga0373957_0212343 | 3300035120 | Bacteria | 809 |
| 418 | Ga0373942_0006705 | 3300035207 | Bacteria | 2660 |
| 419 | Ga0316574_0062077 | 3300035398 | Bacteria | 2348 |
| 420 | Ga0316574_0063060 | 3300035398 | Bacteria | 2330 |
| 421 | Ga0316574_0137317 | 3300035398 | Bacteria | 1574 |
| 422 | Ga0316574_0223274 | 3300035398 | Bacteria | 1207 |
| 423 | Ga0316574_0633897 | 3300035398 | Unclassified | 659 |
| 424 | Ga0373931_0029997 | 3300035691 | Bacteria | 2797 |
| 425 | Ga0373931_0043909 | 3300035691 | Bacteria | 2356 |
| 426 | Ga0373933_0039894 | 3300035724 | Bacteria | 2764 |
| 427 | Ga0373937_0077853 | 3300036401 | Bacteria | 3064 |
| 428 | Ga0373937_0173592 | 3300036401 | Bacteria | 2023 |
| 429 | Ga0373937_0209616 | 3300036401 | Bacteria | 1833 |
| 430 | Ga0373937_0297971 | 3300036401 | Bacteria | 1524 |
| 431 | Ga0373937_0841925 | 3300036401 | Bacteria | 865 |
| 432 | Ga0316582_0068008 | 3300036647 | Unclassified | 2299 |
| 433 | Ga0316582_0152125 | 3300036647 | Bacteria | 1564 |
| 434 | Ga0316582_0263996 | 3300036647 | Bacteria | 1181 |
| 435 | Ga0316582_0354377 | 3300036647 | Bacteria | 1010 |
| 436 | Ga0316584_0013130 | 3300036712 | Bacteria | 5854 |
| 437 | Ga0316584_0030879 | 3300036712 | Bacteria | 3960 |
| 438 | Ga0316584_0194342 | 3300036712 | Bacteria | 1499 |
| 439 | Ga0316584_0239538 | 3300036712 | Unclassified | 1328 |
| 440 | Ga0373925_0020106 | 3300037068 | Bacteria | 4859 |
| 441 | Ga0373925_0069352 | 3300037068 | Bacteria | 2663 |
| 442 | Ga0395905_0025893 | 3300037471 | Bacteria | 5529 |
| 443 | Ga0400490_35068 | 3300038726 | Bacteria | 1582 |
| 444 | Ga0400483_077376 | 3300039062 | Bacteria | 8060 |
| 445 | Ga0400483_281776 | 3300039062 | Bacteria | 7321 |
| 446 | Ga0436365_0436410 | 3300039437 | Bacteria | 4067 |
| 447 | Ga0436365_1455176 | 3300039437 | Bacteria | 1093 |
| 448 | Ga0436361_0585669 | 3300039447 | Bacteria | 853 |
| 449 | Ga0436363_0950845 | 3300039450 | Bacteria | 1017 |
| 450 | Ga0436363_1686671 | 3300039450 | Bacteria | 1339 |
| 451 | Ga0439465_0061391 | 3300041413 | Bacteria | 1246 |
| 452 | Ga0439441_007228 | 3300042001 | Bacteria | 1782 |
| 453 | Ga0450920_007791 | 3300042122 | Bacteria | 1945 |
| 454 | Ga0450923_003639 | 3300042125 | Bacteria | 2351 |
| 455 | Ga0439458_0049336 | 3300042157 | Bacteria | 1036 |
| 456 | Ga0439444_0032101 | 3300042437 | Unclassified | 992 |
| 457 | Ga0439460_0029385 | 3300042461 | Bacteria | 1556 |
| 458 | Ga0439460_0036362 | 3300042461 | Bacteria | 1428 |
| 459 | Ga0451577_0000019 | 3300042876 | Bacteria | 506976 |
| 460 | Ga0451577_0000210 | 3300042876 | Bacteria | 122637 |
| 461 | Ga0451577_0000328 | 3300042876 | Bacteria | 88518 |
| 462 | Ga0451577_0002073 | 3300042876 | Bacteria | 24707 |
| 463 | Ga0451577_0066183 | 3300042876 | Bacteria | 3223 |
| 464 | Ga0451577_0117036 | 3300042876 | Bacteria | 2387 |
| 465 | Ga0451577_0122252 | 3300042876 | Bacteria | 2332 |
| 466 | Ga0451577_0164499 | 3300042876 | Bacteria | 1999 |
| 467 | Ga0451577_0216667 | 3300042876 | Bacteria | 1730 |
| 468 | Ga0451577_0273405 | 3300042876 | Unclassified | 1530 |
| 469 | Ga0451577_0278907 | 3300042876 | Bacteria | 1514 |
| 470 | Ga0451577_0392375 | 3300042876 | Bacteria | 1260 |
| 471 | Ga0451577_1143079 | 3300042876 | Bacteria | 696 |
| 472 | Ga0451577_1175054 | 3300042876 | Bacteria | 685 |
| 473 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 474 | Ga0453683_0000114 | 3300044673 | Bacteria | 119864 |
| 475 | Ga0453683_0000848 | 3300044673 | Bacteria | 29516 |
| 476 | Ga0453683_0001684 | 3300044673 | Bacteria | 18427 |
| 477 | Ga0453683_0004812 | 3300044673 | Bacteria | 9503 |
| 478 | Ga0453683_0009861 | 3300044673 | Bacteria | 6363 |
| 479 | Ga0453683_0026024 | 3300044673 | Bacteria | 3715 |
| 480 | Ga0453683_0030691 | 3300044673 | Bacteria | 3397 |
| 481 | Ga0453683_0036050 | 3300044673 | Bacteria | 3114 |
| 482 | Ga0453683_0062279 | 3300044673 | Bacteria | 2332 |
| 483 | Ga0453683_0073076 | 3300044673 | Bacteria | 2147 |
| 484 | Ga0453683_0144403 | 3300044673 | Bacteria | 1502 |
| 485 | Ga0453683_0152393 | 3300044673 | Bacteria | 1461 |
| 486 | Ga0453683_0218926 | 3300044673 | Unclassified | 1210 |
| 487 | Ga0466963_0391278 | 3300044694 | Bacteria | 980 |
| 488 | Ga0453684_0000057 | 3300044712 | Bacteria | 506899 |
| 489 | Ga0453684_0000258 | 3300044712 | Bacteria | 228312 |
| 490 | Ga0453684_0000950 | 3300044712 | Bacteria | 95538 |
| 491 | Ga0453684_0001302 | 3300044712 | Bacteria | 74077 |
| 492 | Ga0453684_0002807 | 3300044712 | Bacteria | 41156 |
| 493 | Ga0453684_0005204 | 3300044712 | Bacteria | 26125 |
| 494 | Ga0453684_0006508 | 3300044712 | Bacteria | 22145 |
| 495 | Ga0453684_0013962 | 3300044712 | Bacteria | 12943 |
| 496 | Ga0453684_0025015 | 3300044712 | Bacteria | 8688 |
| 497 | Ga0453684_0028025 | 3300044712 | Bacteria | 8053 |
| 498 | Ga0453684_0032497 | 3300044712 | Bacteria | 7301 |
| 499 | Ga0453684_0037215 | 3300044712 | Bacteria | 6682 |
| 500 | Ga0453684_0056552 | 3300044712 | Bacteria | 5088 |
| 501 | Ga0453684_0086711 | 3300044712 | Bacteria | 3883 |
| 502 | Ga0453684_0104314 | 3300044712 | Bacteria | 3462 |
| 503 | Ga0453684_0109000 | 3300044712 | Bacteria | 3369 |
| 504 | Ga0453684_0114376 | 3300044712 | Bacteria | 3271 |
| 505 | Ga0453684_0187707 | 3300044712 | Bacteria | 2421 |
| 506 | Ga0453684_0268702 | 3300044712 | Bacteria | 1950 |
| 507 | Ga0453684_0311563 | 3300044712 | Bacteria | 1786 |
| 508 | Ga0453684_0364632 | 3300044712 | Bacteria | 1626 |
| 509 | Ga0453684_0420707 | 3300044712 | Bacteria | 1492 |
| 510 | Ga0453684_0560809 | 3300044712 | Bacteria | 1257 |
| 511 | Ga0453684_0570366 | 3300044712 | Bacteria | 1244 |
| 512 | Ga0453684_0638349 | 3300044712 | Bacteria | 1163 |
| 513 | Ga0453684_0695571 | 3300044712 | Bacteria | 1105 |
| 514 | Ga0453684_1300595 | 3300044712 | Bacteria | 759 |
| 515 | Ga0453684_1542090 | 3300044712 | Bacteria | 684 |
| 516 | Ga0451576_0000151 | 3300045051 | Bacteria | 176466 |
| 517 | Ga0451576_0000741 | 3300045051 | Bacteria | 65303 |
| 518 | Ga0451576_0005411 | 3300045051 | Bacteria | 16028 |
| 519 | Ga0451576_0005912 | 3300045051 | Bacteria | 15170 |
| 520 | Ga0451576_0016530 | 3300045051 | Bacteria | 8139 |
| 521 | Ga0451576_0017930 | 3300045051 | Bacteria | 7771 |
| 522 | Ga0451576_0032795 | 3300045051 | Bacteria | 5524 |
| 523 | Ga0451576_0034109 | 3300045051 | Bacteria | 5406 |
| 524 | Ga0451576_0042025 | 3300045051 | Bacteria | 4827 |
| 525 | Ga0451576_0056978 | 3300045051 | Bacteria | 4085 |
| 526 | Ga0451576_0113003 | 3300045051 | Bacteria | 2827 |
| 527 | Ga0451576_0136821 | 3300045051 | Bacteria | 2555 |
| 528 | Ga0451576_0185581 | 3300045051 | Bacteria | 2172 |
| 529 | Ga0451576_0216516 | 3300045051 | Bacteria | 2000 |
| 530 | Ga0451576_0256647 | 3300045051 | Bacteria | 1827 |
| 531 | Ga0451576_0265670 | 3300045051 | Bacteria | 1794 |
| 532 | Ga0451576_0340187 | 3300045051 | Bacteria | 1571 |
| 533 | Ga0451576_0401175 | 3300045051 | Bacteria | 1438 |
| 534 | Ga0451576_0405784 | 3300045051 | Bacteria | 1429 |
| 535 | Ga0451576_0593372 | 3300045051 | Bacteria | 1164 |
| 536 | Ga0451576_0595189 | 3300045051 | Bacteria | 1162 |
| 537 | Ga0451576_0760977 | 3300045051 | Bacteria | 1017 |
| 538 | Ga0451576_0841339 | 3300045051 | Bacteria | 963 |
| 539 | Ga0451576_0872744 | 3300045051 | Bacteria | 944 |
| 540 | Ga0495592_0063390 | 3300046454 | Bacteria | 2711 |
| 541 | Ga0495592_0291642 | 3300046454 | Bacteria | 1063 |
| 542 | Ga0495651_0191883 | 3300046462 | Bacteria | 1437 |
| 543 | Ga0495664_0428339 | 3300046477 | Bacteria | 793 |
| 544 | Ga0495607_0147031 | 3300046501 | Bacteria | 1210 |
| 545 | Ga0495608_0005035 | 3300046511 | Bacteria | 9450 |
| 546 | Ga0495608_0062545 | 3300046511 | Bacteria | 2445 |
| 547 | Ga0495618_0171277 | 3300046514 | Bacteria | 1381 |
| 548 | Ga0495618_0228924 | 3300046514 | Bacteria | 1171 |
| 549 | Ga0495628_0008440 | 3300046516 | Bacteria | 8836 |
| 550 | Ga0495628_0054682 | 3300046516 | Bacteria | 3146 |
| 551 | Ga0495628_0188926 | 3300046516 | Bacteria | 1556 |
| 552 | Ga0495630_0115328 | 3300046517 | Bacteria | 2036 |
| 553 | Ga0495666_0209665 | 3300046526 | Bacteria | 894 |
| 554 | Ga0495652_0282156 | 3300046529 | Bacteria | 1215 |
| 555 | Ga0495640_0298762 | 3300046533 | Bacteria | 1000 |
| 556 | Ga0495587_0120882 | 3300046536 | Bacteria | 1500 |
| 557 | Ga0495667_0006088 | 3300046559 | Bacteria | 8166 |
| 558 | Ga0495667_0069833 | 3300046559 | Bacteria | 2292 |
| 559 | Ga0495667_0106590 | 3300046559 | Bacteria | 1811 |
| 560 | Ga0495634_0367904 | 3300046642 | Bacteria | 858 |
| 561 | Ga0495635_0047399 | 3300046663 | Bacteria | 2964 |
| 562 | Ga0495657_0289073 | 3300046675 | Bacteria | 979 |
| 563 | Ga0495646_0022367 | 3300046680 | Bacteria | 3989 |
| 564 | Ga0495613_0008239 | 3300046689 | Bacteria | 7736 |
| 565 | Ga0495613_0435722 | 3300046689 | Bacteria | 890 |
| 566 | Ga0495589_0070097 | 3300046794 | Bacteria | 1714 |
| 567 | Ga0495600_0336936 | 3300046809 | Bacteria | 946 |
| 568 | Ga0495581_0053618 | 3300047315 | Bacteria | 2329 |
| 569 | Ga0495604_0156149 | 3300047317 | Bacteria | 1616 |
| 570 | Ga0495636_0000151 | 3300047318 | Bacteria | 27652 |
| 571 | Ga0495636_0132596 | 3300047318 | Bacteria | 1109 |
| 572 | Ga0495674_0063930 | 3300047319 | Bacteria | 3200 |
| 573 | Ga0495674_0099683 | 3300047319 | Bacteria | 2473 |
| 574 | Ga0495672_0021328 | 3300047320 | Bacteria | 4227 |
| 575 | Ga0495676_0196760 | 3300047321 | Bacteria | 1403 |
| 576 | Ga0495680_0182420 | 3300047322 | Bacteria | 1514 |
| 577 | Ga0495675_0181396 | 3300047444 | Bacteria | 1289 |
| 578 | Ga0495684_0006263 | 3300047471 | Bacteria | 9247 |
| 579 | Ga0495684_0122850 | 3300047471 | Bacteria | 1954 |
| 580 | Ga0496103_0217202 | 3300048906 | Bacteria | 1230 |
| 581 | Ga0496104_0001101 | 3300048907 | Bacteria | 23115 |
| 582 | Ga0496105_0000654 | 3300048908 | Bacteria | 23208 |
| 583 | Ga0496105_0192710 | 3300048908 | Bacteria | 1666 |
| 584 | Ga0496106_0151998 | 3300048909 | Bacteria | 1827 |
| 585 | Ga0496106_0209014 | 3300048909 | Bacteria | 1554 |
| 586 | Ga0496109_0496916 | 3300048912 | Bacteria | 1151 |
| 587 | Ga0496112_0000007 | 3300048915 | Bacteria | 338850 |
| 588 | Ga0496112_0108653 | 3300048915 | Bacteria | 2744 |
| 589 | Ga0496115_0020996 | 3300048918 | Bacteria | 5039 |
| 590 | Ga0496117_0000041 | 3300048920 | Bacteria | 317207 |
| 591 | Ga0496121_0248562 | 3300048924 | Bacteria | 1235 |
| 592 | Ga0501311_005863 | 3300049527 | Bacteria | 1364 |
| 593 | Ga0501311_009241 | 3300049527 | Unclassified | 1173 |
| 594 | Ga0501320_001132 | 3300049536 | Bacteria | 1853 |
| 595 | Ga0501323_000262 | 3300049539 | Bacteria | 3548 |
| 596 | Ga0501031_0394991 | 3300049568 | Bacteria | 894 |
| 597 | Ga0501033_0140765 | 3300049570 | Bacteria | 1744 |
| 598 | Ga0501033_0903131 | 3300049570 | Bacteria | 594 |
| 599 | Ga0501034_0026488 | 3300049571 | Bacteria | 5905 |
| 600 | Ga0501036_0145001 | 3300049572 | Bacteria | 2003 |
| 601 | Ga0501036_0254258 | 3300049572 | Bacteria | 1472 |
| 602 | Ga0501040_0003158 | 3300049576 | Bacteria | 10676 |
| 603 | Ga0501040_0521808 | 3300049576 | Bacteria | 857 |
| 604 | Ga0501041_0029976 | 3300049577 | Bacteria | 3283 |
| 605 | Ga0501042_0044792 | 3300049578 | Bacteria | 3153 |
| 606 | Ga0501047_0085715 | 3300049581 | Bacteria | 3027 |
| 607 | Ga0501047_0326014 | 3300049581 | Bacteria | 1375 |
| 608 | Ga0501048_0054255 | 3300049582 | Bacteria | 2847 |
| 609 | Ga0501048_0358599 | 3300049582 | Bacteria | 1040 |
| 610 | Ga0501067_0062062 | 3300049583 | Bacteria | 2069 |
| 611 | Ga0501071_0093200 | 3300049587 | Bacteria | 2215 |
| 612 | Ga0501072_0478457 | 3300049588 | Bacteria | 985 |
| 613 | Ga0501073_0298486 | 3300049589 | Bacteria | 1111 |
| 614 | Ga0501074_0002140 | 3300049590 | Bacteria | 13659 |
| 615 | Ga0501074_0145812 | 3300049590 | Bacteria | 1693 |
| 616 | Ga0501074_0195427 | 3300049590 | Bacteria | 1442 |
| 617 | Ga0501075_0080818 | 3300049591 | Bacteria | 2460 |
| 618 | Ga0501075_0121937 | 3300049591 | Bacteria | 1984 |
| 619 | Ga0501075_0195225 | 3300049591 | Bacteria | 1544 |
| 620 | Ga0501076_0016433 | 3300049592 | Bacteria | 5611 |
| 621 | Ga0501076_0050446 | 3300049592 | Bacteria | 3292 |
| 622 | Ga0501077_0172558 | 3300049593 | Bacteria | 1374 |
| 623 | Ga0501077_0220789 | 3300049593 | Bacteria | 1204 |
| 624 | Ga0501243_064064 | 3300049675 | Bacteria | 687 |
| 625 | Ga0501079_0024440 | 3300049741 | Bacteria | 4636 |
| 626 | Ga0501079_0037527 | 3300049741 | Bacteria | 3735 |
| 627 | Ga0501080_0161826 | 3300049742 | Bacteria | 2067 |
| 628 | Ga0501080_0733663 | 3300049742 | Bacteria | 870 |
| 629 | Ga0501081_0019228 | 3300049743 | Bacteria | 4546 |
| 630 | Ga0501081_0112025 | 3300049743 | Bacteria | 1937 |
| 631 | Ga0501081_0519624 | 3300049743 | Bacteria | 888 |
| 632 | Ga0501044_0054246 | 3300049823 | Bacteria | 4122 |
| 633 | Ga0501044_0255019 | 3300049823 | Bacteria | 1694 |
| 634 | Ga0501044_0562273 | 3300049823 | Bacteria | 1037 |
| 635 | Ga0501044_1087883 | 3300049823 | Bacteria | 669 |
| 636 | Ga0501045_0033905 | 3300049824 | Bacteria | 3704 |
| 637 | Ga0501045_0745903 | 3300049824 | Bacteria | 722 |
| 638 | nmdc:mga03n38_158250_c1 | 3300050490 | Bacteria | 1145 |
| 639 | nmdc:mga07m45_467372_c1 | 3300050496 | Bacteria | 731 |
| 640 | nmdc:mga05p37_255382_c1 | 3300050507 | Bacteria | 2100 |
| 641 | nmdc:mga05p37_33875_c1 | 3300050507 | Bacteria | 6257 |
| 642 | nmdc:mga05p37_446689_c1 | 3300050507 | Unclassified | 1498 |
| 643 | nmdc:mga05p37_59933_c1 | 3300050507 | Bacteria | 4687 |
| 644 | nmdc:mga05p37_66573_c1 | 3300050507 | Bacteria | 4431 |
| 645 | nmdc:mga05p37_67990_c1 | 3300050507 | Bacteria | 4382 |
| 646 | nmdc:mga05p37_73039_c1 | 3300050507 | Bacteria | 4221 |
| 647 | nmdc:mga05p37_896465_c1 | 3300050507 | Unclassified | 957 |
| 648 | nmdc:mga09592_318183_c1 | 3300050508 | Bacteria | 1348 |
| 649 | nmdc:mga09592_319870_c1 | 3300050508 | Bacteria | 1344 |
| 650 | nmdc:mga09592_473295_c1 | 3300050508 | Bacteria | 1080 |
| 651 | nmdc:mga09592_817203_c1 | 3300050508 | Bacteria | 788 |
| 652 | nmdc:mga0qj67_11591_c1 | 3300050509 | Bacteria | 6611 |
| 653 | nmdc:mga0qj67_185592_c1 | 3300050509 | Bacteria | 1689 |
| 654 | nmdc:mga0qj67_348205_c1 | 3300050509 | Bacteria | 1198 |
| 655 | nmdc:mga0qj67_923306_c1 | 3300050509 | Bacteria | 687 |
| 656 | nmdc:mga06r32_29887_c1 | 3300050510 | Bacteria | 4643 |
| 657 | nmdc:mga06r32_381682_c1 | 3300050510 | Bacteria | 1392 |
| 658 | nmdc:mga06r32_691002_c1 | 3300050510 | Bacteria | 986 |
| 659 | nmdc:mga08y16_18218_c1 | 3300050511 | Bacteria | 7398 |
| 660 | nmdc:mga08y16_201649_c1 | 3300050511 | Bacteria | 2062 |
| 661 | nmdc:mga08y16_328203_c1 | 3300050511 | Bacteria | 1574 |
| 662 | nmdc:mga08y16_407706_c1 | 3300050511 | Bacteria | 1390 |
| 663 | nmdc:mga08y16_863142_c1 | 3300050511 | Unclassified | 894 |
| 664 | nmdc:mga0n895_1032586_c1 | 3300050512 | Unclassified | 802 |
| 665 | nmdc:mga0n895_186749_c1 | 3300050512 | Bacteria | 2104 |
| 666 | nmdc:mga0n895_25782_c1 | 3300050512 | Bacteria | 5559 |
| 667 | nmdc:mga0n895_396768_c1 | 3300050512 | Bacteria | 1395 |
| 668 | nmdc:mga0n895_833860_c1 | 3300050512 | Bacteria | 911 |
| 669 | nmdc:mga0rr50_199265_c1 | 3300050513 | Bacteria | 1644 |
| 670 | nmdc:mga0rr50_346720_c1 | 3300050513 | Unclassified | 1248 |
| 671 | nmdc:mga0rr50_670915_c1 | 3300050513 | Bacteria | 885 |
| 672 | nmdc:mga0rr50_95662_c1 | 3300050513 | Bacteria | 2322 |
| 673 | nmdc:mga08x19_101344_c1 | 3300050514 | Bacteria | 1911 |
| 674 | nmdc:mga08x19_17_c1 | 3300050514 | Bacteria | 313678 |
| 675 | nmdc:mga08x19_830508_c1 | 3300050514 | Bacteria | 656 |
| 676 | nmdc:mga0a205_1228_c1 | 3300050515 | Bacteria | 21495 |
| 677 | nmdc:mga0a205_195238_c1 | 3300050515 | Bacteria | 1915 |
| 678 | nmdc:mga0a205_198386_c1 | 3300050515 | Bacteria | 1898 |
| 679 | nmdc:mga0a205_201594_c1 | 3300050515 | Bacteria | 1880 |
| 680 | nmdc:mga0a205_25790_c3 | 3300050515 | Bacteria | 4591 |
| 681 | nmdc:mga0a205_29399_c1 | 3300050515 | Bacteria | 5258 |
| 682 | nmdc:mga0a205_386433_c1 | 3300050515 | Unclassified | 1264 |
| 683 | nmdc:mga0a205_542325_c1 | 3300050515 | Unclassified | 1019 |
| 684 | nmdc:mga0a205_89147_c1 | 3300050515 | Bacteria | 2982 |
| 685 | Ga0495619_0220317 | 3300053085 | Bacteria | 1314 |
| 686 | Ga0500616_0063131 | 3300053153 | Bacteria | 1911 |
| 687 | Ga0501084_0000461 | 3300054114 | Bacteria | 31395 |
| 688 | Ga0501084_0083056 | 3300054114 | Bacteria | 2688 |
| 689 | Ga0501084_0399402 | 3300054114 | Bacteria | 1162 |
| 690 | Ga0501084_0916333 | 3300054114 | Bacteria | 737 |
| 691 | Ga0587084_035876 | 3300059477 | Bacteria | 821 |
| 692 | Ga0587083_0004115 | 3300059505 | Bacteria | 1993 |
| 693 | Ga0587085_015328 | 3300059506 | Bacteria | 1094 |
| 694 | Ga0587088_048261 | 3300059508 | Bacteria | 826 |
| 695 | Ga0587091_076436 | 3300059511 | Bacteria | 743 |
| 696 | Ga0587062_017757 | 3300059639 | Bacteria | 976 |
| 697 | Ga0587069_029009 | 3300059642 | Bacteria | 882 |
| 698 | Ga0501082_0061445 | 3300060353 | Bacteria | 3234 |
| 699 | Ga0501082_0123778 | 3300060353 | Bacteria | 2242 |
| 700 | Ga0466962_0134911 | 3300061719 | Bacteria | 1194 |
| 701 | Ga0530510_0015081 | 3300061734 | Bacteria | 5459 |
| 702 | Ga0530510_0056387 | 3300061734 | Bacteria | 2838 |
| 703 | Ga0530510_0060067 | 3300061734 | Bacteria | 2751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005985 | Ga0081539_10015944 | Ga0081539_1001594411 | 132 |
| 2 | 3300009147 | Ga0114129_10244086 | Ga0114129_102440862 | 148 |
| 3 | 3300050507 | nmdc:mga05p37_73039_c1 | nmdc:mga05p37_73039_c1_2130_2681 | 148 |
| 4 | 3300005445 | Ga0070708_100035227 | Ga0070708_1000352277 | 166 |
| 5 | 3300005467 | Ga0070706_100074590 | Ga0070706_1000745904 | 166 |
| 6 | 3300005471 | Ga0070698_100070375 | Ga0070698_1000703752 | 166 |
| 7 | 3300025910 | Ga0207684_10034991 | Ga0207684_100349912 | 166 |
| 8 | 3300049589 | Ga0501073_0298486 | Ga0501073_0298486_87_725 | 166 |
| 9 | 3300005468 | Ga0070707_100786433 | Ga0070707_1007864332 | 167 |
| 10 | 3300005544 | Ga0070686_100396679 | Ga0070686_1003966792 | 167 |
| 11 | 3300005719 | Ga0068861_100235347 | Ga0068861_1002353473 | 167 |
| 12 | 3300025922 | Ga0207646_10610322 | Ga0207646_106103221 | 167 |
| 13 | 3300044673 | Ga0453683_0218926 | Ga0453683_0218926_27_629 | 167 |
| 14 | 3300045051 | Ga0451576_0032795 | Ga0451576_0032795_2005_2607 | 167 |
| 15 | 3300036401 | Ga0373937_0077853 | Ga0373937_0077853_2427_3032 | 168 |
| 16 | 3300005841 | Ga0068863_100256165 | Ga0068863_1002561653 | 169 |
| 17 | 3300009094 | Ga0111539_11064106 | Ga0111539_110641061 | 169 |
| 18 | 3300026088 | Ga0207641_10070148 | Ga0207641_100701483 | 169 |
| 19 | 3300046511 | Ga0495608_0005035 | Ga0495608_0005035_1480_2106 | 169 |
| 20 | 3300046514 | Ga0495618_0228924 | Ga0495618_0228924_214_840 | 169 |
| 21 | 3300046516 | Ga0495628_0188926 | Ga0495628_0188926_295_921 | 169 |
| 22 | 3300046559 | Ga0495667_0006088 | Ga0495667_0006088_3627_4253 | 169 |
| 23 | 3300048908 | Ga0496105_0192710 | Ga0496105_0192710_941_1468 | 169 |
| 24 | 3300050515 | nmdc:mga0a205_201594_c1 | nmdc:mga0a205_201594_c1_213_839 | 169 |
| 25 | 3300031344 | Ga0265316_10025549 | Ga0265316_100255492 | 170 |
| 26 | 3300031711 | Ga0265314_10050812 | Ga0265314_100508124 | 170 |
| 27 | 3300031733 | Ga0316577_10031090 | Ga0316577_100310902 | 170 |
| 28 | 3300033541 | Ga0316596_1004895 | Ga0316596_10048954 | 170 |
| 29 | 3300035398 | Ga0316574_0137317 | Ga0316574_0137317_259_789 | 170 |
| 30 | 3300006844 | Ga0075428_100103500 | Ga0075428_1001035003 | 171 |
| 31 | 3300044694 | Ga0466963_0391278 | Ga0466963_0391278_314_940 | 171 |
| 32 | 3300050509 | nmdc:mga0qj67_185592_c1 | nmdc:mga0qj67_185592_c1_954_1574 | 171 |
| 33 | 3300047320 | Ga0495672_0021328 | Ga0495672_0021328_350_979 | 173 |
| 34 | 3300048918 | Ga0496115_0020996 | Ga0496115_0020996_1910_2503 | 173 |
| 35 | 3300002774 | JGI25150J39212_1007938 | JGI25150J39212_10079383 | 174 |
| 36 | 3300003504 | JGI26138J51218_100719 | JGI26138J51218_1007192 | 174 |
| 37 | 3300003856 | Ga0058692_1000048 | Ga0058692_100004842 | 174 |
| 38 | 3300005288 | Ga0065714_10071913 | Ga0065714_100719134 | 174 |
| 39 | 3300005327 | Ga0070658_10004878 | Ga0070658_100048786 | 174 |
| 40 | 3300005339 | Ga0070660_100252820 | Ga0070660_1002528201 | 174 |
| 41 | 3300005563 | Ga0068855_100025740 | Ga0068855_1000257408 | 174 |
| 42 | 3300005842 | Ga0068858_100063036 | Ga0068858_1000630362 | 174 |
| 43 | 3300010375 | Ga0105239_10515706 | Ga0105239_105157062 | 174 |
| 44 | 3300013296 | Ga0157374_10318285 | Ga0157374_103182852 | 174 |
| 45 | 3300021384 | Ga0213876_10042611 | Ga0213876_100426114 | 174 |
| 46 | 3300025909 | Ga0207705_10004481 | Ga0207705_100044815 | 174 |
| 47 | 3300025919 | Ga0207657_10107023 | Ga0207657_101070232 | 174 |
| 48 | 3300026041 | Ga0207639_10205235 | Ga0207639_102052351 | 174 |
| 49 | 3300028558 | Ga0265326_10004879 | Ga0265326_100048794 | 174 |
| 50 | 3300028573 | Ga0265334_10000005 | Ga0265334_10000005193 | 174 |
| 51 | 3300028573 | Ga0265334_10000272 | Ga0265334_1000027217 | 174 |
| 52 | 3300028800 | Ga0265338_10145149 | Ga0265338_101451493 | 174 |
| 53 | 3300031250 | Ga0265331_10014737 | Ga0265331_100147373 | 174 |
| 54 | 3300031250 | Ga0265331_10047618 | Ga0265331_100476183 | 174 |
| 55 | 3300031251 | Ga0265327_10001206 | Ga0265327_1000120626 | 174 |
| 56 | 3300031251 | Ga0265327_10003993 | Ga0265327_100039933 | 174 |
| 57 | 3300031251 | Ga0265327_10005519 | Ga0265327_100055194 | 174 |
| 58 | 3300031251 | Ga0265327_10029744 | Ga0265327_100297445 | 174 |
| 59 | 3300031251 | Ga0265327_10093049 | Ga0265327_100930493 | 174 |
| 60 | 3300031344 | Ga0265316_10001953 | Ga0265316_1000195317 | 174 |
| 61 | 3300031595 | Ga0265313_10000014 | Ga0265313_10000014127 | 174 |
| 62 | 3300031665 | Ga0316575_10030687 | Ga0316575_100306872 | 174 |
| 63 | 3300032168 | Ga0316593_10000918 | Ga0316593_100009183 | 174 |
| 64 | 3300032168 | Ga0316593_10004660 | Ga0316593_100046604 | 174 |
| 65 | 3300032168 | Ga0316593_10012789 | Ga0316593_100127894 | 174 |
| 66 | 3300032168 | Ga0316593_10015794 | Ga0316593_100157942 | 174 |
| 67 | 3300032168 | Ga0316593_10018179 | Ga0316593_100181793 | 174 |
| 68 | 3300032168 | Ga0316593_10067209 | Ga0316593_100672092 | 174 |
| 69 | 3300032168 | Ga0316593_10104479 | Ga0316593_101044792 | 174 |
| 70 | 3300033524 | Ga0316592_1024655 | Ga0316592_10246553 | 174 |
| 71 | 3300033524 | Ga0316592_1029619 | Ga0316592_10296192 | 174 |
| 72 | 3300033527 | Ga0316586_1000676 | Ga0316586_10006765 | 174 |
| 73 | 3300033541 | Ga0316596_1000026 | Ga0316596_100002628 | 174 |
| 74 | 3300033541 | Ga0316596_1000066 | Ga0316596_10000663 | 174 |
| 75 | 3300033541 | Ga0316596_1000625 | Ga0316596_10006251 | 174 |
| 76 | 3300033541 | Ga0316596_1002786 | Ga0316596_10027864 | 174 |
| 77 | 3300033541 | Ga0316596_1015033 | Ga0316596_10150333 | 174 |
| 78 | 3300033541 | Ga0316596_1017959 | Ga0316596_10179593 | 174 |
| 79 | 3300033541 | Ga0316596_1040972 | Ga0316596_10409721 | 174 |
| 80 | 3300033541 | Ga0316596_1053100 | Ga0316596_10531002 | 174 |
| 81 | 3300036647 | Ga0316582_0354377 | Ga0316582_0354377_347_967 | 174 |
| 82 | 3300039437 | Ga0436365_0436410 | Ga0436365_0436410_1859_2479 | 174 |
| 83 | 3300042876 | Ga0451577_0000019 | Ga0451577_0000019_216799_217419 | 174 |
| 84 | 3300042876 | Ga0451577_0000210 | Ga0451577_0000210_109604_110224 | 174 |
| 85 | 3300042876 | Ga0451577_0216667 | Ga0451577_0216667_458_1078 | 174 |
| 86 | 3300044712 | Ga0453684_0000057 | Ga0453684_0000057_216722_217342 | 174 |
| 87 | 3300044712 | Ga0453684_0002807 | Ga0453684_0002807_30971_31591 | 174 |
| 88 | 3300044712 | Ga0453684_0104314 | Ga0453684_0104314_2004_2624 | 174 |
| 89 | 3300044712 | Ga0453684_0187707 | Ga0453684_0187707_1585_2208 | 174 |
| 90 | 3300044712 | Ga0453684_0268702 | Ga0453684_0268702_1160_1780 | 174 |
| 91 | 3300044712 | Ga0453684_0364632 | Ga0453684_0364632_974_1594 | 174 |
| 92 | 3300044712 | Ga0453684_0570366 | Ga0453684_0570366_406_1026 | 174 |
| 93 | 3300045051 | Ga0451576_0000741 | Ga0451576_0000741_32281_32901 | 174 |
| 94 | 3300045051 | Ga0451576_0016530 | Ga0451576_0016530_6441_7064 | 174 |
| 95 | 3300048920 | Ga0496117_0000041 | Ga0496117_0000041_286370_286990 | 174 |
| 96 | 3300049581 | Ga0501047_0085715 | Ga0501047_0085715_197_817 | 174 |
| 97 | 3300049581 | Ga0501047_0326014 | Ga0501047_0326014_302_922 | 174 |
| 98 | 3300049590 | Ga0501074_0195427 | Ga0501074_0195427_537_1157 | 174 |
| 99 | 3300049742 | Ga0501080_0161826 | Ga0501080_0161826_912_1532 | 174 |
| 100 | 3300049823 | Ga0501044_0054246 | Ga0501044_0054246_1034_1654 | 174 |
| 101 | 3300049823 | Ga0501044_0255019 | Ga0501044_0255019_200_820 | 174 |
| 102 | 3300050496 | nmdc:mga07m45_467372_c1 | nmdc:mga07m45_467372_c1_93_716 | 174 |
| 103 | iso_pu_bacteria | 2734482258 | 2735818123 | 174 |
| 104 | iso_pu_bacteria | 2881714928 | 2881716665 | 174 |
| 105 | iso_pu_bacteria | 2894510363 | 2894510830 | 174 |
| 106 | iso_pu_bacteria | 2919704043 | 2919708809 | 174 |
| 107 | iso_pu_bacteria | 2989392574 | 2989393104 | 174 |
| 108 | iso_pu_bacteria | 8001522603 | 8001524085 | 174 |
| 109 | 3300005288 | Ga0065714_10078587 | Ga0065714_100785873 | 175 |
| 110 | 3300005290 | Ga0065712_10069958 | Ga0065712_100699583 | 175 |
| 111 | 3300005331 | Ga0070670_100004112 | Ga0070670_10000411213 | 175 |
| 112 | 3300005334 | Ga0068869_100054740 | Ga0068869_1000547401 | 175 |
| 113 | 3300005364 | Ga0070673_100305882 | Ga0070673_1003058822 | 175 |
| 114 | 3300005365 | Ga0070688_100010141 | Ga0070688_1000101413 | 175 |
| 115 | 3300005438 | Ga0070701_10041796 | Ga0070701_100417963 | 175 |
| 116 | 3300005441 | Ga0070700_100152864 | Ga0070700_1001528642 | 175 |
| 117 | 3300005459 | Ga0068867_100055178 | Ga0068867_1000551785 | 175 |
| 118 | 3300005466 | Ga0070685_10015888 | Ga0070685_100158887 | 175 |
| 119 | 3300005617 | Ga0068859_100023116 | Ga0068859_1000231168 | 175 |
| 120 | 3300005618 | Ga0068864_100282770 | Ga0068864_1002827702 | 175 |
| 121 | 3300005840 | Ga0068870_10018891 | Ga0068870_100188914 | 175 |
| 122 | 3300006914 | Ga0075436_100111404 | Ga0075436_1001114042 | 175 |
| 123 | 3300006931 | Ga0097620_100023118 | Ga0097620_1000231184 | 175 |
| 124 | 3300009094 | Ga0111539_11304446 | Ga0111539_113044461 | 175 |
| 125 | 3300009176 | Ga0105242_10006482 | Ga0105242_100064822 | 175 |
| 126 | 3300013308 | Ga0157375_10140366 | Ga0157375_101403666 | 175 |
| 127 | 3300014326 | Ga0157380_10010165 | Ga0157380_100101654 | 175 |
| 128 | 3300014745 | Ga0157377_10073583 | Ga0157377_100735834 | 175 |
| 129 | 3300025925 | Ga0207650_10025331 | Ga0207650_100253314 | 175 |
| 130 | 3300025934 | Ga0207686_10060186 | Ga0207686_100601862 | 175 |
| 131 | 3300025936 | Ga0207670_10054611 | Ga0207670_100546112 | 175 |
| 132 | 3300025942 | Ga0207689_10030894 | Ga0207689_100308948 | 175 |
| 133 | 3300026075 | Ga0207708_10151584 | Ga0207708_101515843 | 175 |
| 134 | 3300026089 | Ga0207648_10033790 | Ga0207648_100337908 | 175 |
| 135 | 3300026095 | Ga0207676_10401872 | Ga0207676_104018722 | 175 |
| 136 | 3300031691 | Ga0316579_10019220 | Ga0316579_100192203 | 175 |
| 137 | 3300031728 | Ga0316578_10005622 | Ga0316578_100056223 | 175 |
| 138 | 3300031733 | Ga0316577_10102227 | Ga0316577_101022272 | 175 |
| 139 | 3300032137 | Ga0316585_10017604 | Ga0316585_100176042 | 175 |
| 140 | 3300032168 | Ga0316593_10003675 | Ga0316593_100036752 | 175 |
| 141 | 3300032168 | Ga0316593_10006758 | Ga0316593_100067584 | 175 |
| 142 | 3300032168 | Ga0316593_10206853 | Ga0316593_102068531 | 175 |
| 143 | 3300033524 | Ga0316592_1002213 | Ga0316592_10022135 | 175 |
| 144 | 3300033524 | Ga0316592_1005880 | Ga0316592_10058803 | 175 |
| 145 | 3300033527 | Ga0316586_1025095 | Ga0316586_10250952 | 175 |
| 146 | 3300033541 | Ga0316596_1005854 | Ga0316596_10058543 | 175 |
| 147 | 3300033541 | Ga0316596_1012367 | Ga0316596_10123673 | 175 |
| 148 | 3300035398 | Ga0316574_0633897 | Ga0316574_0633897_16_600 | 175 |
| 149 | 3300035691 | Ga0373931_0043909 | Ga0373931_0043909_1570_2199 | 175 |
| 150 | 3300036401 | Ga0373937_0173592 | Ga0373937_0173592_591_1220 | 175 |
| 151 | 3300036647 | Ga0316582_0068008 | Ga0316582_0068008_791_1444 | 175 |
| 152 | 3300036647 | Ga0316582_0263996 | Ga0316582_0263996_431_1084 | 175 |
| 153 | 3300036712 | Ga0316584_0013130 | Ga0316584_0013130_1008_1661 | 175 |
| 154 | 3300036712 | Ga0316584_0030879 | Ga0316584_0030879_1397_2050 | 175 |
| 155 | 3300037068 | Ga0373925_0020106 | Ga0373925_0020106_1823_2452 | 175 |
| 156 | 3300042461 | Ga0439460_0036362 | Ga0439460_0036362_711_1289 | 175 |
| 157 | 3300045051 | Ga0451576_0056978 | Ga0451576_0056978_333_962 | 175 |
| 158 | 3300046526 | Ga0495666_0209665 | Ga0495666_0209665_202_831 | 175 |
| 159 | 3300046689 | Ga0495613_0008239 | Ga0495613_0008239_4036_4665 | 175 |
| 160 | 3300047318 | Ga0495636_0000151 | Ga0495636_0000151_2082_2678 | 175 |
| 161 | 3300049570 | Ga0501033_0140765 | Ga0501033_0140765_235_816 | 175 |
| 162 | 3300049743 | Ga0501081_0519624 | Ga0501081_0519624_170_808 | 175 |
| 163 | 3300050513 | nmdc:mga0rr50_670915_c1 | nmdc:mga0rr50_670915_c1_235_864 | 175 |
| 164 | 3300050514 | nmdc:mga08x19_101344_c1 | nmdc:mga08x19_101344_c1_762_1391 | 175 |
| 165 | 3300059642 | Ga0587069_029009 | Ga0587069_029009_113_742 | 175 |
| 166 | 3300001991 | JGI24743J22301_10017129 | JGI24743J22301_100171293 | 176 |
| 167 | 3300003373 | JGI25407J50210_10002202 | JGI25407J50210_100022027 | 176 |
| 168 | 3300004800 | Ga0058861_10010832 | Ga0058861_100108321 | 176 |
| 169 | 3300005289 | Ga0065704_10006414 | Ga0065704_100064144 | 176 |
| 170 | 3300005290 | Ga0065712_10325143 | Ga0065712_103251431 | 176 |
| 171 | 3300005295 | Ga0065707_10003866 | Ga0065707_100038663 | 176 |
| 172 | 3300005295 | Ga0065707_10087143 | Ga0065707_100871437 | 176 |
| 173 | 3300005295 | Ga0065707_10111745 | Ga0065707_101117454 | 176 |
| 174 | 3300005330 | Ga0070690_100004138 | Ga0070690_10000413812 | 176 |
| 175 | 3300005334 | Ga0068869_100164438 | Ga0068869_1001644382 | 176 |
| 176 | 3300005334 | Ga0068869_100731449 | Ga0068869_1007314492 | 176 |
| 177 | 3300005336 | Ga0070680_100807235 | Ga0070680_1008072352 | 176 |
| 178 | 3300005338 | Ga0068868_100657787 | Ga0068868_1006577872 | 176 |
| 179 | 3300005343 | Ga0070687_100266757 | Ga0070687_1002667571 | 176 |
| 180 | 3300005354 | Ga0070675_100908153 | Ga0070675_1009081531 | 176 |
| 181 | 3300005365 | Ga0070688_100021526 | Ga0070688_1000215263 | 176 |
| 182 | 3300005406 | Ga0070703_10000317 | Ga0070703_1000031725 | 176 |
| 183 | 3300005406 | Ga0070703_10019413 | Ga0070703_100194134 | 176 |
| 184 | 3300005406 | Ga0070703_10160179 | Ga0070703_101601791 | 176 |
| 185 | 3300005434 | Ga0070709_10000098 | Ga0070709_1000009829 | 176 |
| 186 | 3300005434 | Ga0070709_10486156 | Ga0070709_104861562 | 176 |
| 187 | 3300005436 | Ga0070713_100219189 | Ga0070713_1002191892 | 176 |
| 188 | 3300005438 | Ga0070701_10173950 | Ga0070701_101739502 | 176 |
| 189 | 3300005439 | Ga0070711_100000059 | Ga0070711_10000005928 | 176 |
| 190 | 3300005439 | Ga0070711_100656995 | Ga0070711_1006569951 | 176 |
| 191 | 3300005440 | Ga0070705_100012679 | Ga0070705_1000126797 | 176 |
| 192 | 3300005440 | Ga0070705_100129356 | Ga0070705_1001293562 | 176 |
| 193 | 3300005440 | Ga0070705_100148519 | Ga0070705_1001485191 | 176 |
| 194 | 3300005440 | Ga0070705_100365654 | Ga0070705_1003656541 | 176 |
| 195 | 3300005441 | Ga0070700_100338076 | Ga0070700_1003380762 | 176 |
| 196 | 3300005444 | Ga0070694_100146966 | Ga0070694_1001469662 | 176 |
| 197 | 3300005444 | Ga0070694_100297061 | Ga0070694_1002970612 | 176 |
| 198 | 3300005444 | Ga0070694_100519705 | Ga0070694_1005197051 | 176 |
| 199 | 3300005445 | Ga0070708_100000092 | Ga0070708_10000009239 | 176 |
| 200 | 3300005445 | Ga0070708_100005832 | Ga0070708_10000583211 | 176 |
| 201 | 3300005445 | Ga0070708_100015734 | Ga0070708_1000157347 | 176 |
| 202 | 3300005445 | Ga0070708_100068478 | Ga0070708_1000684786 | 176 |
| 203 | 3300005445 | Ga0070708_100127832 | Ga0070708_1001278323 | 176 |
| 204 | 3300005445 | Ga0070708_100685904 | Ga0070708_1006859042 | 176 |
| 205 | 3300005445 | Ga0070708_101191325 | Ga0070708_1011913251 | 176 |
| 206 | 3300005457 | Ga0070662_100261691 | Ga0070662_1002616913 | 176 |
| 207 | 3300005458 | Ga0070681_10046903 | Ga0070681_100469033 | 176 |
| 208 | 3300005467 | Ga0070706_100001316 | Ga0070706_10000131624 | 176 |
| 209 | 3300005467 | Ga0070706_100010237 | Ga0070706_1000102372 | 176 |
| 210 | 3300005467 | Ga0070706_100011787 | Ga0070706_1000117876 | 176 |
| 211 | 3300005467 | Ga0070706_100090228 | Ga0070706_1000902285 | 176 |
| 212 | 3300005467 | Ga0070706_100119837 | Ga0070706_1001198373 | 176 |
| 213 | 3300005467 | Ga0070706_100211298 | Ga0070706_1002112981 | 176 |
| 214 | 3300005467 | Ga0070706_100324516 | Ga0070706_1003245162 | 176 |
| 215 | 3300005468 | Ga0070707_100024115 | Ga0070707_1000241156 | 176 |
| 216 | 3300005468 | Ga0070707_100033784 | Ga0070707_1000337842 | 176 |
| 217 | 3300005468 | Ga0070707_100038225 | Ga0070707_1000382257 | 176 |
| 218 | 3300005468 | Ga0070707_100064600 | Ga0070707_1000646002 | 176 |
| 219 | 3300005468 | Ga0070707_100126568 | Ga0070707_1001265682 | 176 |
| 220 | 3300005468 | Ga0070707_100596360 | Ga0070707_1005963601 | 176 |
| 221 | 3300005471 | Ga0070698_100104288 | Ga0070698_1001042885 | 176 |
| 222 | 3300005471 | Ga0070698_100255597 | Ga0070698_1002555972 | 176 |
| 223 | 3300005471 | Ga0070698_100416971 | Ga0070698_1004169712 | 176 |
| 224 | 3300005518 | Ga0070699_100000009 | Ga0070699_100000009231 | 176 |
| 225 | 3300005518 | Ga0070699_100028609 | Ga0070699_1000286096 | 176 |
| 226 | 3300005518 | Ga0070699_100048892 | Ga0070699_1000488922 | 176 |
| 227 | 3300005518 | Ga0070699_100177476 | Ga0070699_1001774762 | 176 |
| 228 | 3300005518 | Ga0070699_100438516 | Ga0070699_1004385162 | 176 |
| 229 | 3300005535 | Ga0070684_100092545 | Ga0070684_1000925456 | 176 |
| 230 | 3300005536 | Ga0070697_100030323 | Ga0070697_1000303235 | 176 |
| 231 | 3300005536 | Ga0070697_100579808 | Ga0070697_1005798082 | 176 |
| 232 | 3300005544 | Ga0070686_100042639 | Ga0070686_1000426392 | 176 |
| 233 | 3300005544 | Ga0070686_100139579 | Ga0070686_1001395793 | 176 |
| 234 | 3300005544 | Ga0070686_100143805 | Ga0070686_1001438052 | 176 |
| 235 | 3300005544 | Ga0070686_100350479 | Ga0070686_1003504792 | 176 |
| 236 | 3300005544 | Ga0070686_100632492 | Ga0070686_1006324921 | 176 |
| 237 | 3300005544 | Ga0070686_100800728 | Ga0070686_1008007281 | 176 |
| 238 | 3300005545 | Ga0070695_100143193 | Ga0070695_1001431932 | 176 |
| 239 | 3300005545 | Ga0070695_100323897 | Ga0070695_1003238972 | 176 |
| 240 | 3300005545 | Ga0070695_100654972 | Ga0070695_1006549722 | 176 |
| 241 | 3300005546 | Ga0070696_100000153 | Ga0070696_1000001532 | 176 |
| 242 | 3300005546 | Ga0070696_100062684 | Ga0070696_1000626843 | 176 |
| 243 | 3300005546 | Ga0070696_100065752 | Ga0070696_1000657522 | 176 |
| 244 | 3300005546 | Ga0070696_100496134 | Ga0070696_1004961342 | 176 |
| 245 | 3300005546 | Ga0070696_100642281 | Ga0070696_1006422811 | 176 |
| 246 | 3300005547 | Ga0070693_100336844 | Ga0070693_1003368442 | 176 |
| 247 | 3300005549 | Ga0070704_100016174 | Ga0070704_1000161747 | 176 |
| 248 | 3300005549 | Ga0070704_100064036 | Ga0070704_1000640365 | 176 |
| 249 | 3300005549 | Ga0070704_100101329 | Ga0070704_1001013293 | 176 |
| 250 | 3300005549 | Ga0070704_100239973 | Ga0070704_1002399732 | 176 |
| 251 | 3300005549 | Ga0070704_101097632 | Ga0070704_1010976321 | 176 |
| 252 | 3300005577 | Ga0068857_100399521 | Ga0068857_1003995212 | 176 |
| 253 | 3300005614 | Ga0068856_100184992 | Ga0068856_1001849924 | 176 |
| 254 | 3300005614 | Ga0068856_100290876 | Ga0068856_1002908762 | 176 |
| 255 | 3300005615 | Ga0070702_100789825 | Ga0070702_1007898251 | 176 |
| 256 | 3300005617 | Ga0068859_100150725 | Ga0068859_1001507252 | 176 |
| 257 | 3300005617 | Ga0068859_100265391 | Ga0068859_1002653912 | 176 |
| 258 | 3300005617 | Ga0068859_100433433 | Ga0068859_1004334332 | 176 |
| 259 | 3300005841 | Ga0068863_100194310 | Ga0068863_1001943104 | 176 |
| 260 | 3300005842 | Ga0068858_100619064 | Ga0068858_1006190642 | 176 |
| 261 | 3300005843 | Ga0068860_100025069 | Ga0068860_1000250696 | 176 |
| 262 | 3300005843 | Ga0068860_100158587 | Ga0068860_1001585872 | 176 |
| 263 | 3300005843 | Ga0068860_101087734 | Ga0068860_1010877342 | 176 |
| 264 | 3300005937 | Ga0081455_10083326 | Ga0081455_100833263 | 176 |
| 265 | 3300005937 | Ga0081455_10127541 | Ga0081455_101275412 | 176 |
| 266 | 3300005981 | Ga0081538_10000250 | Ga0081538_1000025033 | 176 |
| 267 | 3300005981 | Ga0081538_10002371 | Ga0081538_100023713 | 176 |
| 268 | 3300005981 | Ga0081538_10042593 | Ga0081538_100425932 | 176 |
| 269 | 3300006163 | Ga0070715_10082397 | Ga0070715_100823972 | 176 |
| 270 | 3300006173 | Ga0070716_100013911 | Ga0070716_1000139114 | 176 |
| 271 | 3300006175 | Ga0070712_100046521 | Ga0070712_1000465212 | 176 |
| 272 | 3300006175 | Ga0070712_100620565 | Ga0070712_1006205652 | 176 |
| 273 | 3300006237 | Ga0097621_100923162 | Ga0097621_1009231622 | 176 |
| 274 | 3300006353 | Ga0075370_10035734 | Ga0075370_100357343 | 176 |
| 275 | 3300006844 | Ga0075428_100000694 | Ga0075428_10000069424 | 176 |
| 276 | 3300006844 | Ga0075428_100038782 | Ga0075428_1000387823 | 176 |
| 277 | 3300006844 | Ga0075428_100093827 | Ga0075428_1000938273 | 176 |
| 278 | 3300006844 | Ga0075428_100097922 | Ga0075428_1000979221 | 176 |
| 279 | 3300006844 | Ga0075428_100434303 | Ga0075428_1004343032 | 176 |
| 280 | 3300006844 | Ga0075428_100878427 | Ga0075428_1008784272 | 176 |
| 281 | 3300006846 | Ga0075430_100019248 | Ga0075430_1000192485 | 176 |
| 282 | 3300006846 | Ga0075430_100820096 | Ga0075430_1008200961 | 176 |
| 283 | 3300006847 | Ga0075431_100051274 | Ga0075431_1000512744 | 176 |
| 284 | 3300006847 | Ga0075431_100422689 | Ga0075431_1004226892 | 176 |
| 285 | 3300006847 | Ga0075431_100654931 | Ga0075431_1006549311 | 176 |
| 286 | 3300006852 | Ga0075433_10000980 | Ga0075433_1000098026 | 176 |
| 287 | 3300006852 | Ga0075433_10031678 | Ga0075433_100316782 | 176 |
| 288 | 3300006852 | Ga0075433_10037835 | Ga0075433_100378354 | 176 |
| 289 | 3300006852 | Ga0075433_10076682 | Ga0075433_100766825 | 176 |
| 290 | 3300006852 | Ga0075433_10116481 | Ga0075433_101164812 | 176 |
| 291 | 3300006852 | Ga0075433_10126725 | Ga0075433_101267252 | 176 |
| 292 | 3300006852 | Ga0075433_10220824 | Ga0075433_102208242 | 176 |
| 293 | 3300006852 | Ga0075433_10452365 | Ga0075433_104523652 | 176 |
| 294 | 3300006871 | Ga0075434_100028054 | Ga0075434_10002805410 | 176 |
| 295 | 3300006871 | Ga0075434_100129993 | Ga0075434_1001299933 | 176 |
| 296 | 3300006871 | Ga0075434_100365168 | Ga0075434_1003651682 | 176 |
| 297 | 3300006871 | Ga0075434_100440906 | Ga0075434_1004409061 | 176 |
| 298 | 3300006871 | Ga0075434_100771944 | Ga0075434_1007719441 | 176 |
| 299 | 3300006871 | Ga0075434_100942197 | Ga0075434_1009421971 | 176 |
| 300 | 3300006871 | Ga0075434_101069110 | Ga0075434_1010691102 | 176 |
| 301 | 3300006880 | Ga0075429_100319932 | Ga0075429_1003199322 | 176 |
| 302 | 3300006880 | Ga0075429_100396123 | Ga0075429_1003961232 | 176 |
| 303 | 3300006880 | Ga0075429_100964785 | Ga0075429_1009647851 | 176 |
| 304 | 3300006914 | Ga0075436_100021490 | Ga0075436_1000214905 | 176 |
| 305 | 3300006914 | Ga0075436_100109982 | Ga0075436_1001099822 | 176 |
| 306 | 3300006914 | Ga0075436_100180277 | Ga0075436_1001802772 | 176 |
| 307 | 3300006914 | Ga0075436_100293250 | Ga0075436_1002932502 | 176 |
| 308 | 3300006931 | Ga0097620_100150720 | Ga0097620_1001507202 | 176 |
| 309 | 3300006931 | Ga0097620_100265382 | Ga0097620_1002653822 | 176 |
| 310 | 3300006931 | Ga0097620_100433468 | Ga0097620_1004334682 | 176 |
| 311 | 3300007076 | Ga0075435_100039021 | Ga0075435_1000390213 | 176 |
| 312 | 3300007076 | Ga0075435_100167058 | Ga0075435_1001670584 | 176 |
| 313 | 3300007076 | Ga0075435_100212446 | Ga0075435_1002124463 | 176 |
| 314 | 3300007076 | Ga0075435_100322304 | Ga0075435_1003223042 | 176 |
| 315 | 3300007076 | Ga0075435_100379290 | Ga0075435_1003792902 | 176 |
| 316 | 3300007265 | Ga0099794_10000042 | Ga0099794_1000004230 | 176 |
| 317 | 3300007265 | Ga0099794_10001613 | Ga0099794_1000161313 | 176 |
| 318 | 3300009094 | Ga0111539_10006016 | Ga0111539_100060163 | 176 |
| 319 | 3300009094 | Ga0111539_10009725 | Ga0111539_100097257 | 176 |
| 320 | 3300009094 | Ga0111539_10024178 | Ga0111539_100241785 | 176 |
| 321 | 3300009094 | Ga0111539_10217901 | Ga0111539_102179015 | 176 |
| 322 | 3300009094 | Ga0111539_10234530 | Ga0111539_102345302 | 176 |
| 323 | 3300009094 | Ga0111539_10302060 | Ga0111539_103020603 | 176 |
| 324 | 3300009098 | Ga0105245_10048434 | Ga0105245_100484345 | 176 |
| 325 | 3300009147 | Ga0114129_10043050 | Ga0114129_100430506 | 176 |
| 326 | 3300009147 | Ga0114129_10139563 | Ga0114129_101395631 | 176 |
| 327 | 3300009147 | Ga0114129_10322163 | Ga0114129_103221632 | 176 |
| 328 | 3300009147 | Ga0114129_10355930 | Ga0114129_103559302 | 176 |
| 329 | 3300009147 | Ga0114129_10537326 | Ga0114129_105373261 | 176 |
| 330 | 3300009147 | Ga0114129_10863572 | Ga0114129_108635721 | 176 |
| 331 | 3300009147 | Ga0114129_11037715 | Ga0114129_110377151 | 176 |
| 332 | 3300009148 | Ga0105243_10152057 | Ga0105243_101520572 | 176 |
| 333 | 3300009148 | Ga0105243_10509721 | Ga0105243_105097212 | 176 |
| 334 | 3300009174 | Ga0105241_10561229 | Ga0105241_105612291 | 176 |
| 335 | 3300009176 | Ga0105242_10159590 | Ga0105242_101595902 | 176 |
| 336 | 3300009176 | Ga0105242_10191532 | Ga0105242_101915323 | 176 |
| 337 | 3300009176 | Ga0105242_10250786 | Ga0105242_102507863 | 176 |
| 338 | 3300009177 | Ga0105248_10146643 | Ga0105248_101466432 | 176 |
| 339 | 3300009177 | Ga0105248_10432757 | Ga0105248_104327572 | 176 |
| 340 | 3300010159 | Ga0099796_10039519 | Ga0099796_100395192 | 176 |
| 341 | 3300010375 | Ga0105239_10627179 | Ga0105239_106271791 | 176 |
| 342 | 3300013296 | Ga0157374_11570981 | Ga0157374_115709811 | 176 |
| 343 | 3300013297 | Ga0157378_10232549 | Ga0157378_102325492 | 176 |
| 344 | 3300013297 | Ga0157378_10323704 | Ga0157378_103237042 | 176 |
| 345 | 3300013297 | Ga0157378_10512851 | Ga0157378_105128512 | 176 |
| 346 | 3300013306 | Ga0163162_11402171 | Ga0163162_114021711 | 176 |
| 347 | 3300013308 | Ga0157375_10495920 | Ga0157375_104959202 | 176 |
| 348 | 3300014325 | Ga0163163_10014061 | Ga0163163_100140617 | 176 |
| 349 | 3300014325 | Ga0163163_10109954 | Ga0163163_101099542 | 176 |
| 350 | 3300014325 | Ga0163163_10125103 | Ga0163163_101251035 | 176 |
| 351 | 3300014326 | Ga0157380_10082874 | Ga0157380_100828742 | 176 |
| 352 | 3300014326 | Ga0157380_10793711 | Ga0157380_107937112 | 176 |
| 353 | 3300014968 | Ga0157379_10207601 | Ga0157379_102076014 | 176 |
| 354 | 3300014968 | Ga0157379_10267362 | Ga0157379_102673622 | 176 |
| 355 | 3300014968 | Ga0157379_10600456 | Ga0157379_106004561 | 176 |
| 356 | 3300014969 | Ga0157376_10297477 | Ga0157376_102974772 | 176 |
| 357 | 3300014969 | Ga0157376_11089257 | Ga0157376_110892571 | 176 |
| 358 | 3300017792 | Ga0163161_11103908 | Ga0163161_111039081 | 176 |
| 359 | 3300020081 | Ga0206354_11440846 | Ga0206354_114408461 | 176 |
| 360 | 3300025885 | Ga0207653_10000020 | Ga0207653_1000002029 | 176 |
| 361 | 3300025885 | Ga0207653_10082954 | Ga0207653_100829542 | 176 |
| 362 | 3300025906 | Ga0207699_10000005 | Ga0207699_1000000528 | 176 |
| 363 | 3300025910 | Ga0207684_10002118 | Ga0207684_1000211828 | 176 |
| 364 | 3300025910 | Ga0207684_10018534 | Ga0207684_100185342 | 176 |
| 365 | 3300025910 | Ga0207684_10116254 | Ga0207684_101162542 | 176 |
| 366 | 3300025910 | Ga0207684_10211624 | Ga0207684_102116243 | 176 |
| 367 | 3300025910 | Ga0207684_10229841 | Ga0207684_102298412 | 176 |
| 368 | 3300025910 | Ga0207684_10942593 | Ga0207684_109425931 | 176 |
| 369 | 3300025913 | Ga0207695_10923455 | Ga0207695_109234551 | 176 |
| 370 | 3300025915 | Ga0207693_10041454 | Ga0207693_100414543 | 176 |
| 371 | 3300025915 | Ga0207693_10622312 | Ga0207693_106223122 | 176 |
| 372 | 3300025916 | Ga0207663_10000004 | Ga0207663_10000004125 | 176 |
| 373 | 3300025917 | Ga0207660_10000002 | Ga0207660_10000002332 | 176 |
| 374 | 3300025918 | Ga0207662_10293550 | Ga0207662_102935502 | 176 |
| 375 | 3300025918 | Ga0207662_10370025 | Ga0207662_103700252 | 176 |
| 376 | 3300025921 | Ga0207652_10360838 | Ga0207652_103608382 | 176 |
| 377 | 3300025922 | Ga0207646_10028575 | Ga0207646_100285752 | 176 |
| 378 | 3300025922 | Ga0207646_10037146 | Ga0207646_100371462 | 176 |
| 379 | 3300025922 | Ga0207646_10210359 | Ga0207646_102103593 | 176 |
| 380 | 3300025927 | Ga0207687_10068636 | Ga0207687_100686362 | 176 |
| 381 | 3300025928 | Ga0207700_10270557 | Ga0207700_102705572 | 176 |
| 382 | 3300025929 | Ga0207664_10044350 | Ga0207664_100443507 | 176 |
| 383 | 3300025932 | Ga0207690_10249236 | Ga0207690_102492362 | 176 |
| 384 | 3300025934 | Ga0207686_10228561 | Ga0207686_102285612 | 176 |
| 385 | 3300025934 | Ga0207686_10748398 | Ga0207686_107483981 | 176 |
| 386 | 3300025936 | Ga0207670_10041931 | Ga0207670_100419316 | 176 |
| 387 | 3300025936 | Ga0207670_10712717 | Ga0207670_107127171 | 176 |
| 388 | 3300025939 | Ga0207665_10013618 | Ga0207665_100136186 | 176 |
| 389 | 3300025941 | Ga0207711_10466134 | Ga0207711_104661342 | 176 |
| 390 | 3300025942 | Ga0207689_10647854 | Ga0207689_106478542 | 176 |
| 391 | 3300025944 | Ga0207661_10187411 | Ga0207661_101874112 | 176 |
| 392 | 3300026035 | Ga0207703_10633985 | Ga0207703_106339852 | 176 |
| 393 | 3300026075 | Ga0207708_10153468 | Ga0207708_101534682 | 176 |
| 394 | 3300026075 | Ga0207708_10234993 | Ga0207708_102349932 | 176 |
| 395 | 3300026078 | Ga0207702_10158054 | Ga0207702_101580544 | 176 |
| 396 | 3300026078 | Ga0207702_10540642 | Ga0207702_105406421 | 176 |
| 397 | 3300026078 | Ga0207702_10576422 | Ga0207702_105764221 | 176 |
| 398 | 3300026088 | Ga0207641_10127085 | Ga0207641_101270852 | 176 |
| 399 | 3300026088 | Ga0207641_10440903 | Ga0207641_104409032 | 176 |
| 400 | 3300026089 | Ga0207648_10151012 | Ga0207648_101510122 | 176 |
| 401 | 3300026118 | Ga0207675_100168611 | Ga0207675_1001686111 | 176 |
| 402 | 3300026118 | Ga0207675_100269085 | Ga0207675_1002690852 | 176 |
| 403 | 3300026118 | Ga0207675_100422382 | Ga0207675_1004223822 | 176 |
| 404 | 3300026118 | Ga0207675_100676088 | Ga0207675_1006760881 | 176 |
| 405 | 3300027671 | Ga0209588_1000034 | Ga0209588_100003428 | 176 |
| 406 | 3300027671 | Ga0209588_1002219 | Ga0209588_10022197 | 176 |
| 407 | 3300027876 | Ga0209974_10018041 | Ga0209974_100180413 | 176 |
| 408 | 3300027907 | Ga0207428_10146257 | Ga0207428_101462572 | 176 |
| 409 | 3300027907 | Ga0207428_10242953 | Ga0207428_102429532 | 176 |
| 410 | 3300028380 | Ga0268265_10140439 | Ga0268265_101404392 | 176 |
| 411 | 3300028381 | Ga0268264_10011525 | Ga0268264_100115255 | 176 |
| 412 | 3300028381 | Ga0268264_10197545 | Ga0268264_101975452 | 176 |
| 413 | 3300028381 | Ga0268264_10320820 | Ga0268264_103208202 | 176 |
| 414 | 3300028381 | Ga0268264_10551028 | Ga0268264_105510282 | 176 |
| 415 | 3300028381 | Ga0268264_10783648 | Ga0268264_107836482 | 176 |
| 416 | 3300028381 | Ga0268264_11043258 | Ga0268264_110432581 | 176 |
| 417 | 3300028563 | Ga0265319_1000071 | Ga0265319_100007128 | 176 |
| 418 | 3300028577 | Ga0265318_10000273 | Ga0265318_1000027327 | 176 |
| 419 | 3300028577 | Ga0265318_10001387 | Ga0265318_100013877 | 176 |
| 420 | 3300028800 | Ga0265338_10513231 | Ga0265338_105132312 | 176 |
| 421 | 3300029277 | Ga0311001_1018981 | Ga0311001_10189811 | 176 |
| 422 | 3300029285 | Ga0310981_1071358 | Ga0310981_10713582 | 176 |
| 423 | 3300031235 | Ga0265330_10000998 | Ga0265330_100009986 | 176 |
| 424 | 3300031238 | Ga0265332_10000280 | Ga0265332_1000028027 | 176 |
| 425 | 3300031239 | Ga0265328_10016001 | Ga0265328_100160015 | 176 |
| 426 | 3300031240 | Ga0265320_10000485 | Ga0265320_1000048516 | 176 |
| 427 | 3300031240 | Ga0265320_10057563 | Ga0265320_100575631 | 176 |
| 428 | 3300031241 | Ga0265325_10001575 | Ga0265325_1000157527 | 176 |
| 429 | 3300031242 | Ga0265329_10000013 | Ga0265329_1000001328 | 176 |
| 430 | 3300031247 | Ga0265340_10000189 | Ga0265340_1000018916 | 176 |
| 431 | 3300031247 | Ga0265340_10019984 | Ga0265340_100199842 | 176 |
| 432 | 3300031249 | Ga0265339_10008773 | Ga0265339_100087734 | 176 |
| 433 | 3300031249 | Ga0265339_10111919 | Ga0265339_101119192 | 176 |
| 434 | 3300031250 | Ga0265331_10002207 | Ga0265331_1000220716 | 176 |
| 435 | 3300031250 | Ga0265331_10059653 | Ga0265331_100596534 | 176 |
| 436 | 3300031251 | Ga0265327_10052437 | Ga0265327_100524372 | 176 |
| 437 | 3300031251 | Ga0265327_10172328 | Ga0265327_101723282 | 176 |
| 438 | 3300031344 | Ga0265316_10001048 | Ga0265316_1000104817 | 176 |
| 439 | 3300031344 | Ga0265316_10002957 | Ga0265316_100029576 | 176 |
| 440 | 3300031507 | Ga0307509_10000050 | Ga0307509_1000005071 | 176 |
| 441 | 3300031595 | Ga0265313_10000463 | Ga0265313_1000046327 | 176 |
| 442 | 3300031595 | Ga0265313_10001355 | Ga0265313_1000135524 | 176 |
| 443 | 3300031616 | Ga0307508_10012217 | Ga0307508_100122176 | 176 |
| 444 | 3300031665 | Ga0316575_10022396 | Ga0316575_100223962 | 176 |
| 445 | 3300031665 | Ga0316575_10042145 | Ga0316575_100421453 | 176 |
| 446 | 3300031711 | Ga0265314_10002804 | Ga0265314_1000280427 | 176 |
| 447 | 3300031711 | Ga0265314_10026291 | Ga0265314_100262917 | 176 |
| 448 | 3300031712 | Ga0265342_10000471 | Ga0265342_1000047128 | 176 |
| 449 | 3300031727 | Ga0316576_10165433 | Ga0316576_101654332 | 176 |
| 450 | 3300031727 | Ga0316576_10345156 | Ga0316576_103451562 | 176 |
| 451 | 3300031733 | Ga0316577_10103453 | Ga0316577_101034531 | 176 |
| 452 | 3300031824 | Ga0307413_10006103 | Ga0307413_100061033 | 176 |
| 453 | 3300031852 | Ga0307410_10045714 | Ga0307410_100457143 | 176 |
| 454 | 3300031852 | Ga0307410_10412820 | Ga0307410_104128202 | 176 |
| 455 | 3300031903 | Ga0307407_10018264 | Ga0307407_100182643 | 176 |
| 456 | 3300031995 | Ga0307409_100002915 | Ga0307409_1000029152 | 176 |
| 457 | 3300031995 | Ga0307409_101398764 | Ga0307409_1013987642 | 176 |
| 458 | 3300032004 | Ga0307414_10011674 | Ga0307414_100116744 | 176 |
| 459 | 3300032005 | Ga0307411_10056297 | Ga0307411_100562976 | 176 |
| 460 | 3300032168 | Ga0316593_10000033 | Ga0316593_1000003327 | 176 |
| 461 | 3300032168 | Ga0316593_10001049 | Ga0316593_100010492 | 176 |
| 462 | 3300032168 | Ga0316593_10047659 | Ga0316593_100476591 | 176 |
| 463 | 3300032168 | Ga0316593_10049598 | Ga0316593_100495982 | 176 |
| 464 | 3300032168 | Ga0316593_10108027 | Ga0316593_101080272 | 176 |
| 465 | 3300033528 | Ga0316588_1019197 | Ga0316588_10191972 | 176 |
| 466 | 3300033528 | Ga0316588_1020983 | Ga0316588_10209832 | 176 |
| 467 | 3300033529 | Ga0316587_1001803 | Ga0316587_10018033 | 176 |
| 468 | 3300033529 | Ga0316587_1005623 | Ga0316587_10056233 | 176 |
| 469 | 3300033541 | Ga0316596_1000070 | Ga0316596_100007024 | 176 |
| 470 | 3300033541 | Ga0316596_1000471 | Ga0316596_100047110 | 176 |
| 471 | 3300033541 | Ga0316596_1001049 | Ga0316596_10010496 | 176 |
| 472 | 3300033541 | Ga0316596_1014403 | Ga0316596_10144033 | 176 |
| 473 | 3300033541 | Ga0316596_1045135 | Ga0316596_10451352 | 176 |
| 474 | 3300033541 | Ga0316596_1082693 | Ga0316596_10826932 | 176 |
| 475 | 3300035111 | Ga0373923_0256444 | Ga0373923_0256444_23_649 | 176 |
| 476 | 3300035112 | Ga0373932_0063413 | Ga0373932_0063413_246_872 | 176 |
| 477 | 3300035114 | Ga0373939_0095790 | Ga0373939_0095790_284_910 | 176 |
| 478 | 3300035116 | Ga0373945_0105373 | Ga0373945_0105373_444_1019 | 176 |
| 479 | 3300035120 | Ga0373957_0212343 | Ga0373957_0212343_80_706 | 176 |
| 480 | 3300035207 | Ga0373942_0006705 | Ga0373942_0006705_916_1542 | 176 |
| 481 | 3300035398 | Ga0316574_0062077 | Ga0316574_0062077_372_950 | 176 |
| 482 | 3300035398 | Ga0316574_0063060 | Ga0316574_0063060_801_1379 | 176 |
| 483 | 3300035398 | Ga0316574_0223274 | Ga0316574_0223274_506_1129 | 176 |
| 484 | 3300035691 | Ga0373931_0029997 | Ga0373931_0029997_1638_2264 | 176 |
| 485 | 3300035724 | Ga0373933_0039894 | Ga0373933_0039894_672_1301 | 176 |
| 486 | 3300036401 | Ga0373937_0209616 | Ga0373937_0209616_246_875 | 176 |
| 487 | 3300036401 | Ga0373937_0297971 | Ga0373937_0297971_175_750 | 176 |
| 488 | 3300036401 | Ga0373937_0841925 | Ga0373937_0841925_86_712 | 176 |
| 489 | 3300036647 | Ga0316582_0152125 | Ga0316582_0152125_421_999 | 176 |
| 490 | 3300036712 | Ga0316584_0194342 | Ga0316584_0194342_629_1207 | 176 |
| 491 | 3300036712 | Ga0316584_0239538 | Ga0316584_0239538_339_1016 | 176 |
| 492 | 3300037068 | Ga0373925_0069352 | Ga0373925_0069352_1455_2081 | 176 |
| 493 | 3300037471 | Ga0395905_0025893 | Ga0395905_0025893_2009_2638 | 176 |
| 494 | 3300038726 | Ga0400490_35068 | Ga0400490_35068_848_1429 | 176 |
| 495 | 3300039062 | Ga0400483_077376 | Ga0400483_077376_5510_6091 | 176 |
| 496 | 3300039062 | Ga0400483_281776 | Ga0400483_281776_241_822 | 176 |
| 497 | 3300039437 | Ga0436365_1455176 | Ga0436365_1455176_57_683 | 176 |
| 498 | 3300039447 | Ga0436361_0585669 | Ga0436361_0585669_48_677 | 176 |
| 499 | 3300039450 | Ga0436363_0950845 | Ga0436363_0950845_41_667 | 176 |
| 500 | 3300039450 | Ga0436363_1686671 | Ga0436363_1686671_605_1231 | 176 |
| 501 | 3300041413 | Ga0439465_0061391 | Ga0439465_0061391_198_824 | 176 |
| 502 | 3300042001 | Ga0439441_007228 | Ga0439441_007228_76_702 | 176 |
| 503 | 3300042122 | Ga0450920_007791 | Ga0450920_007791_152_778 | 176 |
| 504 | 3300042125 | Ga0450923_003639 | Ga0450923_003639_507_1133 | 176 |
| 505 | 3300042157 | Ga0439458_0049336 | Ga0439458_0049336_243_824 | 176 |
| 506 | 3300042437 | Ga0439444_0032101 | Ga0439444_0032101_195_773 | 176 |
| 507 | 3300042461 | Ga0439460_0029385 | Ga0439460_0029385_506_1132 | 176 |
| 508 | 3300042876 | Ga0451577_0000328 | Ga0451577_0000328_6330_6908 | 176 |
| 509 | 3300042876 | Ga0451577_0002073 | Ga0451577_0002073_10139_10717 | 176 |
| 510 | 3300042876 | Ga0451577_0066183 | Ga0451577_0066183_1738_2316 | 176 |
| 511 | 3300042876 | Ga0451577_0117036 | Ga0451577_0117036_423_1049 | 176 |
| 512 | 3300042876 | Ga0451577_0122252 | Ga0451577_0122252_1635_2213 | 176 |
| 513 | 3300042876 | Ga0451577_0164499 | Ga0451577_0164499_588_1214 | 176 |
| 514 | 3300042876 | Ga0451577_0273405 | Ga0451577_0273405_508_1086 | 176 |
| 515 | 3300042876 | Ga0451577_0278907 | Ga0451577_0278907_105_683 | 176 |
| 516 | 3300042876 | Ga0451577_0392375 | Ga0451577_0392375_445_1071 | 176 |
| 517 | 3300042876 | Ga0451577_1143079 | Ga0451577_1143079_101_679 | 176 |
| 518 | 3300042876 | Ga0451577_1175054 | Ga0451577_1175054_11_589 | 176 |
| 519 | 3300044673 | Ga0453683_0000002 | Ga0453683_0000002_893158_893736 | 176 |
| 520 | 3300044673 | Ga0453683_0000114 | Ga0453683_0000114_1779_2357 | 176 |
| 521 | 3300044673 | Ga0453683_0000848 | Ga0453683_0000848_15557_16135 | 176 |
| 522 | 3300044673 | Ga0453683_0001684 | Ga0453683_0001684_13197_13769 | 176 |
| 523 | 3300044673 | Ga0453683_0004812 | Ga0453683_0004812_2481_3059 | 176 |
| 524 | 3300044673 | Ga0453683_0009861 | Ga0453683_0009861_1946_2518 | 176 |
| 525 | 3300044673 | Ga0453683_0026024 | Ga0453683_0026024_3040_3618 | 176 |
| 526 | 3300044673 | Ga0453683_0030691 | Ga0453683_0030691_2670_3248 | 176 |
| 527 | 3300044673 | Ga0453683_0036050 | Ga0453683_0036050_115_741 | 176 |
| 528 | 3300044673 | Ga0453683_0062279 | Ga0453683_0062279_219_791 | 176 |
| 529 | 3300044673 | Ga0453683_0073076 | Ga0453683_0073076_85_711 | 176 |
| 530 | 3300044673 | Ga0453683_0144403 | Ga0453683_0144403_600_1190 | 176 |
| 531 | 3300044673 | Ga0453683_0152393 | Ga0453683_0152393_531_1103 | 176 |
| 532 | 3300044712 | Ga0453684_0000258 | Ga0453684_0000258_214544_215116 | 176 |
| 533 | 3300044712 | Ga0453684_0000950 | Ga0453684_0000950_13242_13820 | 176 |
| 534 | 3300044712 | Ga0453684_0001302 | Ga0453684_0001302_12874_13452 | 176 |
| 535 | 3300044712 | Ga0453684_0005204 | Ga0453684_0005204_4200_4778 | 176 |
| 536 | 3300044712 | Ga0453684_0006508 | Ga0453684_0006508_11964_12590 | 176 |
| 537 | 3300044712 | Ga0453684_0013962 | Ga0453684_0013962_11709_12335 | 176 |
| 538 | 3300044712 | Ga0453684_0025015 | Ga0453684_0025015_7149_7721 | 176 |
| 539 | 3300044712 | Ga0453684_0028025 | Ga0453684_0028025_6923_7501 | 176 |
| 540 | 3300044712 | Ga0453684_0032497 | Ga0453684_0032497_48_626 | 176 |
| 541 | 3300044712 | Ga0453684_0037215 | Ga0453684_0037215_3823_4401 | 176 |
| 542 | 3300044712 | Ga0453684_0056552 | Ga0453684_0056552_1160_1756 | 176 |
| 543 | 3300044712 | Ga0453684_0086711 | Ga0453684_0086711_2383_2955 | 176 |
| 544 | 3300044712 | Ga0453684_0109000 | Ga0453684_0109000_915_1568 | 176 |
| 545 | 3300044712 | Ga0453684_0114376 | Ga0453684_0114376_1966_2538 | 176 |
| 546 | 3300044712 | Ga0453684_0311563 | Ga0453684_0311563_808_1380 | 176 |
| 547 | 3300044712 | Ga0453684_0420707 | Ga0453684_0420707_442_1014 | 176 |
| 548 | 3300044712 | Ga0453684_0560809 | Ga0453684_0560809_239_817 | 176 |
| 549 | 3300044712 | Ga0453684_0638349 | Ga0453684_0638349_17_595 | 176 |
| 550 | 3300044712 | Ga0453684_0695571 | Ga0453684_0695571_314_892 | 176 |
| 551 | 3300044712 | Ga0453684_1300595 | Ga0453684_1300595_50_622 | 176 |
| 552 | 3300044712 | Ga0453684_1542090 | Ga0453684_1542090_47_625 | 176 |
| 553 | 3300045051 | Ga0451576_0000151 | Ga0451576_0000151_163040_163618 | 176 |
| 554 | 3300045051 | Ga0451576_0005411 | Ga0451576_0005411_10953_11525 | 176 |
| 555 | 3300045051 | Ga0451576_0005912 | Ga0451576_0005912_12851_13429 | 176 |
| 556 | 3300045051 | Ga0451576_0017930 | Ga0451576_0017930_3103_3675 | 176 |
| 557 | 3300045051 | Ga0451576_0034109 | Ga0451576_0034109_1768_2394 | 176 |
| 558 | 3300045051 | Ga0451576_0042025 | Ga0451576_0042025_3887_4465 | 176 |
| 559 | 3300045051 | Ga0451576_0113003 | Ga0451576_0113003_2060_2638 | 176 |
| 560 | 3300045051 | Ga0451576_0136821 | Ga0451576_0136821_1911_2489 | 176 |
| 561 | 3300045051 | Ga0451576_0185581 | Ga0451576_0185581_1185_1811 | 176 |
| 562 | 3300045051 | Ga0451576_0216516 | Ga0451576_0216516_397_1023 | 176 |
| 563 | 3300045051 | Ga0451576_0256647 | Ga0451576_0256647_1024_1620 | 176 |
| 564 | 3300045051 | Ga0451576_0265670 | Ga0451576_0265670_312_893 | 176 |
| 565 | 3300045051 | Ga0451576_0340187 | Ga0451576_0340187_797_1423 | 176 |
| 566 | 3300045051 | Ga0451576_0401175 | Ga0451576_0401175_373_1002 | 176 |
| 567 | 3300045051 | Ga0451576_0405784 | Ga0451576_0405784_221_799 | 176 |
| 568 | 3300045051 | Ga0451576_0593372 | Ga0451576_0593372_250_828 | 176 |
| 569 | 3300045051 | Ga0451576_0595189 | Ga0451576_0595189_70_642 | 176 |
| 570 | 3300045051 | Ga0451576_0760977 | Ga0451576_0760977_36_662 | 176 |
| 571 | 3300045051 | Ga0451576_0841339 | Ga0451576_0841339_208_780 | 176 |
| 572 | 3300045051 | Ga0451576_0872744 | Ga0451576_0872744_183_761 | 176 |
| 573 | 3300046454 | Ga0495592_0063390 | Ga0495592_0063390_1968_2543 | 176 |
| 574 | 3300046454 | Ga0495592_0291642 | Ga0495592_0291642_319_939 | 176 |
| 575 | 3300046462 | Ga0495651_0191883 | Ga0495651_0191883_209_784 | 176 |
| 576 | 3300046477 | Ga0495664_0428339 | Ga0495664_0428339_202_777 | 176 |
| 577 | 3300046501 | Ga0495607_0147031 | Ga0495607_0147031_115_690 | 176 |
| 578 | 3300046511 | Ga0495608_0062545 | Ga0495608_0062545_259_882 | 176 |
| 579 | 3300046514 | Ga0495618_0171277 | Ga0495618_0171277_449_1024 | 176 |
| 580 | 3300046516 | Ga0495628_0008440 | Ga0495628_0008440_6337_6963 | 176 |
| 581 | 3300046516 | Ga0495628_0054682 | Ga0495628_0054682_1649_2224 | 176 |
| 582 | 3300046517 | Ga0495630_0115328 | Ga0495630_0115328_676_1302 | 176 |
| 583 | 3300046529 | Ga0495652_0282156 | Ga0495652_0282156_593_1168 | 176 |
| 584 | 3300046533 | Ga0495640_0298762 | Ga0495640_0298762_152_727 | 176 |
| 585 | 3300046536 | Ga0495587_0120882 | Ga0495587_0120882_326_949 | 176 |
| 586 | 3300046559 | Ga0495667_0069833 | Ga0495667_0069833_1498_2073 | 176 |
| 587 | 3300046559 | Ga0495667_0106590 | Ga0495667_0106590_172_747 | 176 |
| 588 | 3300046642 | Ga0495634_0367904 | Ga0495634_0367904_44_667 | 176 |
| 589 | 3300046663 | Ga0495635_0047399 | Ga0495635_0047399_1622_2197 | 176 |
| 590 | 3300046675 | Ga0495657_0289073 | Ga0495657_0289073_217_840 | 176 |
| 591 | 3300046680 | Ga0495646_0022367 | Ga0495646_0022367_2775_3350 | 176 |
| 592 | 3300046689 | Ga0495613_0435722 | Ga0495613_0435722_200_826 | 176 |
| 593 | 3300046794 | Ga0495589_0070097 | Ga0495589_0070097_901_1521 | 176 |
| 594 | 3300046809 | Ga0495600_0336936 | Ga0495600_0336936_264_890 | 176 |
| 595 | 3300047315 | Ga0495581_0053618 | Ga0495581_0053618_562_1188 | 176 |
| 596 | 3300047317 | Ga0495604_0156149 | Ga0495604_0156149_218_793 | 176 |
| 597 | 3300047318 | Ga0495636_0132596 | Ga0495636_0132596_116_742 | 176 |
| 598 | 3300047319 | Ga0495674_0063930 | Ga0495674_0063930_130_753 | 176 |
| 599 | 3300047319 | Ga0495674_0099683 | Ga0495674_0099683_1461_2036 | 176 |
| 600 | 3300047321 | Ga0495676_0196760 | Ga0495676_0196760_257_883 | 176 |
| 601 | 3300047322 | Ga0495680_0182420 | Ga0495680_0182420_424_1047 | 176 |
| 602 | 3300047444 | Ga0495675_0181396 | Ga0495675_0181396_565_1188 | 176 |
| 603 | 3300047471 | Ga0495684_0006263 | Ga0495684_0006263_1715_2341 | 176 |
| 604 | 3300047471 | Ga0495684_0122850 | Ga0495684_0122850_1297_1872 | 176 |
| 605 | 3300048906 | Ga0496103_0217202 | Ga0496103_0217202_57_683 | 176 |
| 606 | 3300048907 | Ga0496104_0001101 | Ga0496104_0001101_10658_11233 | 176 |
| 607 | 3300048908 | Ga0496105_0000654 | Ga0496105_0000654_15218_15793 | 176 |
| 608 | 3300048909 | Ga0496106_0151998 | Ga0496106_0151998_412_1038 | 176 |
| 609 | 3300048909 | Ga0496106_0209014 | Ga0496106_0209014_396_1022 | 176 |
| 610 | 3300048912 | Ga0496109_0496916 | Ga0496109_0496916_311_886 | 176 |
| 611 | 3300048915 | Ga0496112_0000007 | Ga0496112_0000007_14328_14954 | 176 |
| 612 | 3300048915 | Ga0496112_0108653 | Ga0496112_0108653_154_780 | 176 |
| 613 | 3300048924 | Ga0496121_0248562 | Ga0496121_0248562_642_1223 | 176 |
| 614 | 3300049527 | Ga0501311_005863 | Ga0501311_005863_137_796 | 176 |
| 615 | 3300049527 | Ga0501311_009241 | Ga0501311_009241_69_647 | 176 |
| 616 | 3300049536 | Ga0501320_001132 | Ga0501320_001132_1149_1730 | 176 |
| 617 | 3300049539 | Ga0501323_000262 | Ga0501323_000262_1615_2196 | 176 |
| 618 | 3300049568 | Ga0501031_0394991 | Ga0501031_0394991_182_772 | 176 |
| 619 | 3300049570 | Ga0501033_0903131 | Ga0501033_0903131_12_584 | 176 |
| 620 | 3300049571 | Ga0501034_0026488 | Ga0501034_0026488_271_903 | 176 |
| 621 | 3300049572 | Ga0501036_0145001 | Ga0501036_0145001_23_613 | 176 |
| 622 | 3300049572 | Ga0501036_0254258 | Ga0501036_0254258_151_777 | 176 |
| 623 | 3300049576 | Ga0501040_0003158 | Ga0501040_0003158_5062_5652 | 176 |
| 624 | 3300049576 | Ga0501040_0521808 | Ga0501040_0521808_152_781 | 176 |
| 625 | 3300049577 | Ga0501041_0029976 | Ga0501041_0029976_579_1169 | 176 |
| 626 | 3300049578 | Ga0501042_0044792 | Ga0501042_0044792_2031_2621 | 176 |
| 627 | 3300049582 | Ga0501048_0054255 | Ga0501048_0054255_633_1223 | 176 |
| 628 | 3300049582 | Ga0501048_0358599 | Ga0501048_0358599_217_843 | 176 |
| 629 | 3300049583 | Ga0501067_0062062 | Ga0501067_0062062_852_1478 | 176 |
| 630 | 3300049587 | Ga0501071_0093200 | Ga0501071_0093200_1036_1662 | 176 |
| 631 | 3300049588 | Ga0501072_0478457 | Ga0501072_0478457_146_772 | 176 |
| 632 | 3300049590 | Ga0501074_0002140 | Ga0501074_0002140_926_1525 | 176 |
| 633 | 3300049590 | Ga0501074_0145812 | Ga0501074_0145812_742_1332 | 176 |
| 634 | 3300049591 | Ga0501075_0080818 | Ga0501075_0080818_1169_1819 | 176 |
| 635 | 3300049591 | Ga0501075_0121937 | Ga0501075_0121937_1110_1682 | 176 |
| 636 | 3300049591 | Ga0501075_0195225 | Ga0501075_0195225_195_821 | 176 |
| 637 | 3300049592 | Ga0501076_0016433 | Ga0501076_0016433_1396_2046 | 176 |
| 638 | 3300049592 | Ga0501076_0050446 | Ga0501076_0050446_1783_2373 | 176 |
| 639 | 3300049593 | Ga0501077_0172558 | Ga0501077_0172558_25_651 | 176 |
| 640 | 3300049593 | Ga0501077_0220789 | Ga0501077_0220789_460_1050 | 176 |
| 641 | 3300049675 | Ga0501243_064064 | Ga0501243_064064_69_647 | 176 |
| 642 | 3300049741 | Ga0501079_0024440 | Ga0501079_0024440_2551_3201 | 176 |
| 643 | 3300049741 | Ga0501079_0037527 | Ga0501079_0037527_1462_2052 | 176 |
| 644 | 3300049742 | Ga0501080_0733663 | Ga0501080_0733663_83_709 | 176 |
| 645 | 3300049743 | Ga0501081_0019228 | Ga0501081_0019228_2860_3450 | 176 |
| 646 | 3300049743 | Ga0501081_0112025 | Ga0501081_0112025_965_1555 | 176 |
| 647 | 3300049823 | Ga0501044_0562273 | Ga0501044_0562273_21_611 | 176 |
| 648 | 3300049823 | Ga0501044_1087883 | Ga0501044_1087883_81_653 | 176 |
| 649 | 3300049824 | Ga0501045_0033905 | Ga0501045_0033905_2545_3135 | 176 |
| 650 | 3300049824 | Ga0501045_0745903 | Ga0501045_0745903_49_675 | 176 |
| 651 | 3300050490 | nmdc:mga03n38_158250_c1 | nmdc:mga03n38_158250_c1_443_1072 | 176 |
| 652 | 3300050507 | nmdc:mga05p37_255382_c1 | nmdc:mga05p37_255382_c1_28_654 | 176 |
| 653 | 3300050507 | nmdc:mga05p37_33875_c1 | nmdc:mga05p37_33875_c1_3717_4343 | 176 |
| 654 | 3300050507 | nmdc:mga05p37_446689_c1 | nmdc:mga05p37_446689_c1_413_1006 | 176 |
| 655 | 3300050507 | nmdc:mga05p37_59933_c1 | nmdc:mga05p37_59933_c1_2704_3294 | 176 |
| 656 | 3300050507 | nmdc:mga05p37_66573_c1 | nmdc:mga05p37_66573_c1_3709_4290 | 176 |
| 657 | 3300050507 | nmdc:mga05p37_67990_c1 | nmdc:mga05p37_67990_c1_3736_4362 | 176 |
| 658 | 3300050507 | nmdc:mga05p37_896465_c1 | nmdc:mga05p37_896465_c1_116_706 | 176 |
| 659 | 3300050508 | nmdc:mga09592_318183_c1 | nmdc:mga09592_318183_c1_684_1310 | 176 |
| 660 | 3300050508 | nmdc:mga09592_319870_c1 | nmdc:mga09592_319870_c1_222_848 | 176 |
| 661 | 3300050508 | nmdc:mga09592_473295_c1 | nmdc:mga09592_473295_c1_349_921 | 176 |
| 662 | 3300050508 | nmdc:mga09592_817203_c1 | nmdc:mga09592_817203_c1_79_660 | 176 |
| 663 | 3300050509 | nmdc:mga0qj67_11591_c1 | nmdc:mga0qj67_11591_c1_2701_3279 | 176 |
| 664 | 3300050509 | nmdc:mga0qj67_348205_c1 | nmdc:mga0qj67_348205_c1_226_798 | 176 |
| 665 | 3300050509 | nmdc:mga0qj67_923306_c1 | nmdc:mga0qj67_923306_c1_49_675 | 176 |
| 666 | 3300050510 | nmdc:mga06r32_29887_c1 | nmdc:mga06r32_29887_c1_2617_3195 | 176 |
| 667 | 3300050510 | nmdc:mga06r32_381682_c1 | nmdc:mga06r32_381682_c1_176_802 | 176 |
| 668 | 3300050510 | nmdc:mga06r32_691002_c1 | nmdc:mga06r32_691002_c1_100_726 | 176 |
| 669 | 3300050511 | nmdc:mga08y16_18218_c1 | nmdc:mga08y16_18218_c1_3244_3870 | 176 |
| 670 | 3300050511 | nmdc:mga08y16_201649_c1 | nmdc:mga08y16_201649_c1_1111_1692 | 176 |
| 671 | 3300050511 | nmdc:mga08y16_328203_c1 | nmdc:mga08y16_328203_c1_51_677 | 176 |
| 672 | 3300050511 | nmdc:mga08y16_407706_c1 | nmdc:mga08y16_407706_c1_640_1266 | 176 |
| 673 | 3300050511 | nmdc:mga08y16_863142_c1 | nmdc:mga08y16_863142_c1_195_788 | 176 |
| 674 | 3300050512 | nmdc:mga0n895_1032586_c1 | nmdc:mga0n895_1032586_c1_10_600 | 176 |
| 675 | 3300050512 | nmdc:mga0n895_186749_c1 | nmdc:mga0n895_186749_c1_799_1425 | 176 |
| 676 | 3300050512 | nmdc:mga0n895_25782_c1 | nmdc:mga0n895_25782_c1_4558_5139 | 176 |
| 677 | 3300050512 | nmdc:mga0n895_396768_c1 | nmdc:mga0n895_396768_c1_554_1180 | 176 |
| 678 | 3300050512 | nmdc:mga0n895_833860_c1 | nmdc:mga0n895_833860_c1_88_714 | 176 |
| 679 | 3300050513 | nmdc:mga0rr50_199265_c1 | nmdc:mga0rr50_199265_c1_834_1460 | 176 |
| 680 | 3300050513 | nmdc:mga0rr50_346720_c1 | nmdc:mga0rr50_346720_c1_181_762 | 176 |
| 681 | 3300050513 | nmdc:mga0rr50_95662_c1 | nmdc:mga0rr50_95662_c1_1069_1662 | 176 |
| 682 | 3300050514 | nmdc:mga08x19_17_c1 | nmdc:mga08x19_17_c1_23674_24264 | 176 |
| 683 | 3300050514 | nmdc:mga08x19_830508_c1 | nmdc:mga08x19_830508_c1_11_637 | 176 |
| 684 | 3300050515 | nmdc:mga0a205_1228_c1 | nmdc:mga0a205_1228_c1_11280_11861 | 176 |
| 685 | 3300050515 | nmdc:mga0a205_195238_c1 | nmdc:mga0a205_195238_c1_189_779 | 176 |
| 686 | 3300050515 | nmdc:mga0a205_198386_c1 | nmdc:mga0a205_198386_c1_1028_1618 | 176 |
| 687 | 3300050515 | nmdc:mga0a205_25790_c3 | nmdc:mga0a205_25790_c3_360_953 | 176 |
| 688 | 3300050515 | nmdc:mga0a205_29399_c1 | nmdc:mga0a205_29399_c1_1563_2189 | 176 |
| 689 | 3300050515 | nmdc:mga0a205_386433_c1 | nmdc:mga0a205_386433_c1_430_1020 | 176 |
| 690 | 3300050515 | nmdc:mga0a205_542325_c1 | nmdc:mga0a205_542325_c1_425_1006 | 176 |
| 691 | 3300050515 | nmdc:mga0a205_89147_c1 | nmdc:mga0a205_89147_c1_83_709 | 176 |
| 692 | 3300053085 | Ga0495619_0220317 | Ga0495619_0220317_512_1087 | 176 |
| 693 | 3300053153 | Ga0500616_0063131 | Ga0500616_0063131_89_715 | 176 |
| 694 | 3300054114 | Ga0501084_0000461 | Ga0501084_0000461_6068_6697 | 176 |
| 695 | 3300054114 | Ga0501084_0083056 | Ga0501084_0083056_275_865 | 176 |
| 696 | 3300054114 | Ga0501084_0399402 | Ga0501084_0399402_140_766 | 176 |
| 697 | 3300054114 | Ga0501084_0916333 | Ga0501084_0916333_120_713 | 176 |
| 698 | 3300059477 | Ga0587084_035876 | Ga0587084_035876_61_690 | 176 |
| 699 | 3300059505 | Ga0587083_0004115 | Ga0587083_0004115_1193_1822 | 176 |
| 700 | 3300059506 | Ga0587085_015328 | Ga0587085_015328_413_1039 | 176 |
| 701 | 3300059508 | Ga0587088_048261 | Ga0587088_048261_170_796 | 176 |
| 702 | 3300059511 | Ga0587091_076436 | Ga0587091_076436_96_725 | 176 |
| 703 | 3300059639 | Ga0587062_017757 | Ga0587062_017757_93_713 | 176 |
| 704 | 3300060353 | Ga0501082_0061445 | Ga0501082_0061445_1755_2345 | 176 |
| 705 | 3300060353 | Ga0501082_0123778 | Ga0501082_0123778_1272_1922 | 176 |
| 706 | 3300061719 | Ga0466962_0134911 | Ga0466962_0134911_511_1083 | 176 |
| 707 | 3300061734 | Ga0530510_0015081 | Ga0530510_0015081_2515_3087 | 176 |
| 708 | 3300061734 | Ga0530510_0056387 | Ga0530510_0056387_1557_2183 | 176 |
| 709 | 3300061734 | Ga0530510_0060067 | Ga0530510_0060067_1702_2292 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.968 | 23 | 121 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9581 | 18 | 176 |
| 7p48-assembly1.cif.gz_d | staphylococcus aureus ribosome in complex with sal(b) | 0.9529 | 17 | 176 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9522 | 18 | 176 |
| 6yef-assembly1.cif.gz_d | 70s initiation complex with assigned rrna modifications from staphylococcus aureus | 0.9479 | 17 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LXG1_108_164_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9898 | 67 | 110 | 3.10.290.10 |
| af_P02355_88_184_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9772 | 67 | 161 | 3.10.290.10 |
| af_Q9XPI8_145_195_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9694 | 67 | 117 | 3.10.290.10 |
| af_Q9XPI8_145_195_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9515 | 67 | 117 | 3.10.290.10 |
| af_P02355_88_184_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9478 | 67 | 161 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9VR11-F1-model_v4 | deleted | 0.9807 | 36 | 176 |
|
| AF-A0A838N3C0-F1-model_v4 | Small ribosomal subunit protein uS4 | 0.9795 | 34 | 176 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A4P5YPR9-F1-model_v4 | Small ribosomal subunit protein uS4 | 0.9757 | 26 | 176 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A7V9VR11-F1-model_v4 | deleted | 0.9739 | 36 | 176 |
|
| AF-A0A6N6P898-F1-model_v4 | Small ribosomal subunit protein uS4 | 0.9738 | 21 | 176 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar