F476650

General Info

Members Datasets Scaffolds Average Seq Length
709 297 703 204

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100028054|Ga0075434_10002805410
Length 238
Sequence MGAVLRSGAGCDRLEEQFGIFLAQPEENDLARYRDSVCRLCRREGMKLFLKGDRCLKPSCAIEKRNFAPGQHGKDRKSKVVGYGLQLREKQKVKRIYGLLEGQFRNYFEKAERQKGITGENLLLLLERRLDNIVYRLGFATSRAQSRQFIGHGHVRVNNLKVNIPSYQVKSGDVVSIVEKSQKIPSITSAVEMVGSRGVPNWLELDGAKFSGKVLTLPRREDIGLPVQERLIVELYSK

Samples

Sample ID Description Type Environment
1 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
2 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
3 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
4 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
5 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
143 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
193 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.11
Metatranscriptomes 8.04
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 1.41
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10017129 3300001991 Bacteria 1358
2 JGI25150J39212_1007938 3300002774 Bacteria 2104
3 JGI25407J50210_10002202 3300003373 Bacteria 4563
4 JGI26138J51218_100719 3300003504 Bacteria 1246
5 Ga0058692_1000048 3300003856 Bacteria 110906
6 Ga0058861_10010832 3300004800 Bacteria 781
7 Ga0065714_10071913 3300005288 Bacteria 3469
8 Ga0065714_10078587 3300005288 Bacteria 2586
9 Ga0065704_10006414 3300005289 Bacteria 3092
10 Ga0065712_10069958 3300005290 Bacteria 6466
11 Ga0065712_10325143 3300005290 Bacteria 822
12 Ga0065707_10003866 3300005295 Bacteria 6530
13 Ga0065707_10087143 3300005295 Bacteria 5147
14 Ga0065707_10111745 3300005295 Bacteria 2384
15 Ga0070658_10004878 3300005327 Bacteria 10928
16 Ga0070690_100004138 3300005330 Bacteria 8025
17 Ga0070670_100004112 3300005331 Bacteria 12158
18 Ga0068869_100054740 3300005334 Bacteria 2906
19 Ga0068869_100164438 3300005334 Bacteria 1729
20 Ga0068869_100731449 3300005334 Bacteria 846
21 Ga0070680_100807235 3300005336 Bacteria 808
22 Ga0068868_100657787 3300005338 Unclassified 934
23 Ga0070660_100252820 3300005339 Bacteria 1437
24 Ga0070687_100266757 3300005343 Bacteria 1071
25 Ga0070675_100908153 3300005354 Bacteria 807
26 Ga0070673_100305882 3300005364 Bacteria 1401
27 Ga0070688_100010141 3300005365 Bacteria 5183
28 Ga0070688_100021526 3300005365 Bacteria 3768
29 Ga0070703_10000317 3300005406 Bacteria 21976
30 Ga0070703_10019413 3300005406 Bacteria 1970
31 Ga0070703_10160179 3300005406 Bacteria 853
32 Ga0070709_10000098 3300005434 Bacteria 61823
33 Ga0070709_10486156 3300005434 Bacteria 936
34 Ga0070713_100219189 3300005436 Bacteria 1725
35 Ga0070701_10041796 3300005438 Bacteria 2338
36 Ga0070701_10173950 3300005438 Bacteria 1256
37 Ga0070711_100000059 3300005439 Bacteria 65064
38 Ga0070711_100656995 3300005439 Bacteria 879
39 Ga0070705_100012679 3300005440 Bacteria 4292
40 Ga0070705_100129356 3300005440 Bacteria 1645
41 Ga0070705_100148519 3300005440 Bacteria 1552
42 Ga0070705_100365654 3300005440 Bacteria 1057
43 Ga0070700_100152864 3300005441 Bacteria 1580
44 Ga0070700_100338076 3300005441 Bacteria 1112
45 Ga0070694_100146966 3300005444 Bacteria 1718
46 Ga0070694_100297061 3300005444 Bacteria 1236
47 Ga0070694_100519705 3300005444 Bacteria 950
48 Ga0070708_100000092 3300005445 Bacteria 59199
49 Ga0070708_100005832 3300005445 Bacteria 9776
50 Ga0070708_100015734 3300005445 Bacteria 6252
51 Ga0070708_100035227 3300005445 Bacteria 4360
52 Ga0070708_100068478 3300005445 Bacteria 3190
53 Ga0070708_100127832 3300005445 Bacteria 2350
54 Ga0070708_100685904 3300005445 Bacteria 965
55 Ga0070708_101191325 3300005445 Bacteria 713
56 Ga0070662_100261691 3300005457 Bacteria 1394
57 Ga0070681_10046903 3300005458 Bacteria 4319
58 Ga0068867_100055178 3300005459 Bacteria 2937
59 Ga0070685_10015888 3300005466 Bacteria 4004
60 Ga0070706_100001316 3300005467 Bacteria 26391
61 Ga0070706_100010237 3300005467 Bacteria 8716
62 Ga0070706_100011787 3300005467 Bacteria 8115
63 Ga0070706_100074590 3300005467 Bacteria 3140
64 Ga0070706_100090228 3300005467 Bacteria 2842
65 Ga0070706_100119837 3300005467 Bacteria 2452
66 Ga0070706_100211298 3300005467 Bacteria 1812
67 Ga0070706_100324516 3300005467 Bacteria 1435
68 Ga0070707_100024115 3300005468 Bacteria 5758
69 Ga0070707_100033784 3300005468 Bacteria 4877
70 Ga0070707_100038225 3300005468 Bacteria 4583
71 Ga0070707_100064600 3300005468 Bacteria 3514
72 Ga0070707_100126568 3300005468 Bacteria 2482
73 Ga0070707_100596360 3300005468 Bacteria 1067
74 Ga0070707_100786433 3300005468 Bacteria 915
75 Ga0070698_100070375 3300005471 Bacteria 3511
76 Ga0070698_100104288 3300005471 Bacteria 2805
77 Ga0070698_100255597 3300005471 Bacteria 1684
78 Ga0070698_100416971 3300005471 Bacteria 1277
79 Ga0070699_100000009 3300005518 Bacteria 272902
80 Ga0070699_100028609 3300005518 Bacteria 4805
81 Ga0070699_100048892 3300005518 Bacteria 3660
82 Ga0070699_100177476 3300005518 Unclassified 1889
83 Ga0070699_100438516 3300005518 Bacteria 1184
84 Ga0070684_100092545 3300005535 Bacteria 2690
85 Ga0070697_100030323 3300005536 Bacteria 4344
86 Ga0070697_100579808 3300005536 Bacteria 985
87 Ga0070686_100042639 3300005544 Bacteria 2843
88 Ga0070686_100139579 3300005544 Bacteria 1685
89 Ga0070686_100143805 3300005544 Bacteria 1663
90 Ga0070686_100350479 3300005544 Bacteria 1109
91 Ga0070686_100396679 3300005544 Unclassified 1048
92 Ga0070686_100632492 3300005544 Bacteria 847
93 Ga0070686_100800728 3300005544 Bacteria 760
94 Ga0070695_100143193 3300005545 Bacteria 1660
95 Ga0070695_100323897 3300005545 Bacteria 1146
96 Ga0070695_100654972 3300005545 Bacteria 829
97 Ga0070696_100000153 3300005546 Bacteria 38514
98 Ga0070696_100062684 3300005546 Bacteria 2603
99 Ga0070696_100065752 3300005546 Bacteria 2542
100 Ga0070696_100496134 3300005546 Bacteria 970
101 Ga0070696_100642281 3300005546 Bacteria 860
102 Ga0070693_100336844 3300005547 Bacteria 1028
103 Ga0070704_100016174 3300005549 Bacteria 4709
104 Ga0070704_100064036 3300005549 Bacteria 2641
105 Ga0070704_100101329 3300005549 Bacteria 2170
106 Ga0070704_100239973 3300005549 Bacteria 1483
107 Ga0070704_101097632 3300005549 Bacteria 722
108 Ga0068855_100025740 3300005563 Bacteria 7036
109 Ga0068857_100399521 3300005577 Bacteria 1279
110 Ga0068856_100184992 3300005614 Bacteria 2097
111 Ga0068856_100290876 3300005614 Bacteria 1650
112 Ga0070702_100789825 3300005615 Bacteria 733
113 Ga0068859_100023116 3300005617 Bacteria 6235
114 Ga0068859_100150725 3300005617 Bacteria 2401
115 Ga0068859_100265391 3300005617 Bacteria 1809
116 Ga0068859_100433433 3300005617 Bacteria 1411
117 Ga0068864_100282770 3300005618 Bacteria 1549
118 Ga0068861_100235347 3300005719 Bacteria 1555
119 Ga0068870_10018891 3300005840 Bacteria 3336
120 Ga0068863_100194310 3300005841 Bacteria 1951
121 Ga0068863_100256165 3300005841 Bacteria 1691
122 Ga0068858_100063036 3300005842 Bacteria 3429
123 Ga0068858_100619064 3300005842 Bacteria 1051
124 Ga0068860_100025069 3300005843 Bacteria 5756
125 Ga0068860_100158587 3300005843 Bacteria 2181
126 Ga0068860_101087734 3300005843 Bacteria 819
127 Ga0081455_10083326 3300005937 Bacteria 2613
128 Ga0081455_10127541 3300005937 Bacteria 1994
129 Ga0081538_10000250 3300005981 Bacteria 60946
130 Ga0081538_10002371 3300005981 Bacteria 18522
131 Ga0081538_10042593 3300005981 Bacteria 2862
132 Ga0081539_10015944 3300005985 Bacteria 5415
133 Ga0070715_10082397 3300006163 Bacteria 1463
134 Ga0070716_100013911 3300006173 Bacteria 4112
135 Ga0070712_100046521 3300006175 Bacteria 3000
136 Ga0070712_100620565 3300006175 Bacteria 916
137 Ga0097621_100923162 3300006237 Bacteria 814
138 Ga0075370_10035734 3300006353 Bacteria 2790
139 Ga0075428_100000694 3300006844 Bacteria 34739
140 Ga0075428_100038782 3300006844 Bacteria 5243
141 Ga0075428_100093827 3300006844 Bacteria 3272
142 Ga0075428_100097922 3300006844 Bacteria 3198
143 Ga0075428_100103500 3300006844 Bacteria 3105
144 Ga0075428_100434303 3300006844 Bacteria 1407
145 Ga0075428_100878427 3300006844 Bacteria 951
146 Ga0075430_100019248 3300006846 Bacteria 5804
147 Ga0075430_100820096 3300006846 Bacteria 767
148 Ga0075431_100051274 3300006847 Bacteria 4256
149 Ga0075431_100422689 3300006847 Bacteria 1332
150 Ga0075431_100654931 3300006847 Bacteria 1030
151 Ga0075433_10000980 3300006852 Bacteria 20289
152 Ga0075433_10031678 3300006852 Bacteria 4521
153 Ga0075433_10037835 3300006852 Bacteria 4164
154 Ga0075433_10076682 3300006852 Bacteria 2944
155 Ga0075433_10116481 3300006852 Bacteria 2371
156 Ga0075433_10126725 3300006852 Bacteria 2267
157 Ga0075433_10220824 3300006852 Bacteria 1683
158 Ga0075433_10452365 3300006852 Bacteria 1132
159 Ga0075434_100028054 3300006871 Bacteria 5529
160 Ga0075434_100129993 3300006871 Bacteria 2537
161 Ga0075434_100365168 3300006871 Bacteria 1464
162 Ga0075434_100440906 3300006871 Bacteria 1323
163 Ga0075434_100771944 3300006871 Bacteria 978
164 Ga0075434_100942197 3300006871 Bacteria 878
165 Ga0075434_101069110 3300006871 Unclassified 820
166 Ga0075429_100319932 3300006880 Bacteria 1358
167 Ga0075429_100396123 3300006880 Unclassified 1209
168 Ga0075429_100964785 3300006880 Bacteria 746
169 Ga0075436_100021490 3300006914 Bacteria 4430
170 Ga0075436_100109982 3300006914 Bacteria 1923
171 Ga0075436_100111404 3300006914 Bacteria 1911
172 Ga0075436_100180277 3300006914 Bacteria 1493
173 Ga0075436_100293250 3300006914 Bacteria 1165
174 Ga0097620_100023118 3300006931 Bacteria 6235
175 Ga0097620_100150720 3300006931 Bacteria 2401
176 Ga0097620_100265382 3300006931 Bacteria 1809
177 Ga0097620_100433468 3300006931 Bacteria 1411
178 Ga0075435_100039021 3300007076 Bacteria 3789
179 Ga0075435_100167058 3300007076 Bacteria 1855
180 Ga0075435_100212446 3300007076 Bacteria 1642
181 Ga0075435_100322304 3300007076 Bacteria 1323
182 Ga0075435_100379290 3300007076 Bacteria 1214
183 Ga0099794_10000042 3300007265 Bacteria 50201
184 Ga0099794_10001613 3300007265 Bacteria 7957
185 Ga0111539_10006016 3300009094 Bacteria 15679
186 Ga0111539_10009725 3300009094 Bacteria 12138
187 Ga0111539_10024178 3300009094 Bacteria 7460
188 Ga0111539_10217901 3300009094 Bacteria 2223
189 Ga0111539_10234530 3300009094 Bacteria 2136
190 Ga0111539_10302060 3300009094 Unclassified 1863
191 Ga0111539_11064106 3300009094 Bacteria 940
192 Ga0111539_11304446 3300009094 Bacteria 843
193 Ga0105245_10048434 3300009098 Bacteria 3802
194 Ga0114129_10043050 3300009147 Bacteria 6355
195 Ga0114129_10139563 3300009147 Bacteria 3323
196 Ga0114129_10244086 3300009147 Bacteria 2413
197 Ga0114129_10322163 3300009147 Bacteria 2054
198 Ga0114129_10355930 3300009147 Bacteria 1938
199 Ga0114129_10537326 3300009147 Unclassified 1522
200 Ga0114129_10863572 3300009147 Unclassified 1149
201 Ga0114129_11037715 3300009147 Bacteria 1030
202 Ga0105243_10152057 3300009148 Bacteria 1986
203 Ga0105243_10509721 3300009148 Bacteria 1142
204 Ga0105241_10561229 3300009174 Bacteria 1026
205 Ga0105242_10006482 3300009176 Bacteria 9013
206 Ga0105242_10159590 3300009176 Bacteria 1972
207 Ga0105242_10191532 3300009176 Bacteria 1811
208 Ga0105242_10250786 3300009176 Bacteria 1595
209 Ga0105248_10146643 3300009177 Bacteria 2663
210 Ga0105248_10432757 3300009177 Bacteria 1482
211 Ga0099796_10039519 3300010159 Bacteria 1589
212 Ga0105239_10515706 3300010375 Bacteria 1360
213 Ga0105239_10627179 3300010375 Bacteria 1227
214 Ga0157374_10318285 3300013296 Bacteria 1541
215 Ga0157374_11570981 3300013296 Unclassified 682
216 Ga0157378_10232549 3300013297 Bacteria 1757
217 Ga0157378_10323704 3300013297 Bacteria 1498
218 Ga0157378_10512851 3300013297 Bacteria 1199
219 Ga0163162_11402171 3300013306 Bacteria 795
220 Ga0157375_10140366 3300013308 Bacteria 2543
221 Ga0157375_10495920 3300013308 Bacteria 1385
222 Ga0163163_10014061 3300014325 Bacteria 7346
223 Ga0163163_10109954 3300014325 Bacteria 2784
224 Ga0163163_10125103 3300014325 Bacteria 2608
225 Ga0157380_10010165 3300014326 Bacteria 6763
226 Ga0157380_10082874 3300014326 Bacteria 2626
227 Ga0157380_10793711 3300014326 Bacteria 963
228 Ga0157377_10073583 3300014745 Bacteria 1980
229 Ga0157379_10207601 3300014968 Bacteria 1772
230 Ga0157379_10267362 3300014968 Bacteria 1554
231 Ga0157379_10600456 3300014968 Bacteria 1027
232 Ga0157376_10297477 3300014969 Bacteria 1526
233 Ga0157376_11089257 3300014969 Bacteria 824
234 Ga0163161_11103908 3300017792 Bacteria 682
235 Ga0206354_11440846 3300020081 Bacteria 1044
236 Ga0213876_10042611 3300021384 Bacteria 2398
237 Ga0207653_10000020 3300025885 Bacteria 136681
238 Ga0207653_10082954 3300025885 Bacteria 1112
239 Ga0207699_10000005 3300025906 Bacteria 534560
240 Ga0207705_10004481 3300025909 Bacteria 10556
241 Ga0207684_10002118 3300025910 Bacteria 20347
242 Ga0207684_10018534 3300025910 Bacteria 5958
243 Ga0207684_10034991 3300025910 Bacteria 4265
244 Ga0207684_10116254 3300025910 Bacteria 2291
245 Ga0207684_10211624 3300025910 Bacteria 1672
246 Ga0207684_10229841 3300025910 Bacteria 1601
247 Ga0207684_10942593 3300025910 Bacteria 724
248 Ga0207695_10923455 3300025913 Bacteria 752
249 Ga0207693_10041454 3300025915 Bacteria 3624
250 Ga0207693_10622312 3300025915 Bacteria 840
251 Ga0207663_10000004 3300025916 Bacteria 294638
252 Ga0207660_10000002 3300025917 Bacteria 883566
253 Ga0207662_10293550 3300025918 Bacteria 1079
254 Ga0207662_10370025 3300025918 Bacteria 966
255 Ga0207657_10107023 3300025919 Bacteria 2313
256 Ga0207652_10360838 3300025921 Bacteria 1311
257 Ga0207646_10028575 3300025922 Bacteria 5073
258 Ga0207646_10037146 3300025922 Bacteria 4392
259 Ga0207646_10210359 3300025922 Bacteria 1757
260 Ga0207646_10610322 3300025922 Bacteria 979
261 Ga0207650_10025331 3300025925 Bacteria 4226
262 Ga0207687_10068636 3300025927 Bacteria 2526
263 Ga0207700_10270557 3300025928 Bacteria 1458
264 Ga0207664_10044350 3300025929 Bacteria 3482
265 Ga0207690_10249236 3300025932 Bacteria 1371
266 Ga0207686_10060186 3300025934 Bacteria 2403
267 Ga0207686_10228561 3300025934 Bacteria 1347
268 Ga0207686_10748398 3300025934 Bacteria 780
269 Ga0207670_10041931 3300025936 Bacteria 3012
270 Ga0207670_10054611 3300025936 Bacteria 2696
271 Ga0207670_10712717 3300025936 Bacteria 831
272 Ga0207665_10013618 3300025939 Bacteria 5351
273 Ga0207711_10466134 3300025941 Bacteria 1176
274 Ga0207689_10030894 3300025942 Bacteria 4462
275 Ga0207689_10647854 3300025942 Bacteria 890
276 Ga0207661_10187411 3300025944 Bacteria 1812
277 Ga0207703_10633985 3300026035 Bacteria 1013
278 Ga0207639_10205235 3300026041 Bacteria 1693
279 Ga0207708_10151584 3300026075 Bacteria 1825
280 Ga0207708_10153468 3300026075 Bacteria 1815
281 Ga0207708_10234993 3300026075 Bacteria 1472
282 Ga0207702_10158054 3300026078 Bacteria 2068
283 Ga0207702_10540642 3300026078 Bacteria 1139
284 Ga0207702_10576422 3300026078 Bacteria 1103
285 Ga0207641_10070148 3300026088 Bacteria 3011
286 Ga0207641_10127085 3300026088 Bacteria 2284
287 Ga0207641_10440903 3300026088 Bacteria 1257
288 Ga0207648_10033790 3300026089 Bacteria 4509
289 Ga0207648_10151012 3300026089 Bacteria 2050
290 Ga0207676_10401872 3300026095 Bacteria 1280
291 Ga0207675_100168611 3300026118 Bacteria 2092
292 Ga0207675_100269085 3300026118 Bacteria 1653
293 Ga0207675_100422382 3300026118 Bacteria 1317
294 Ga0207675_100676088 3300026118 Bacteria 1040
295 Ga0209588_1000034 3300027671 Bacteria 66337
296 Ga0209588_1002219 3300027671 Bacteria 5248
297 Ga0209974_10018041 3300027876 Bacteria 2340
298 Ga0207428_10146257 3300027907 Bacteria 1801
299 Ga0207428_10242953 3300027907 Bacteria 1345
300 Ga0268265_10140439 3300028380 Bacteria 2022
301 Ga0268264_10011525 3300028381 Bacteria 7304
302 Ga0268264_10197545 3300028381 Bacteria 1838
303 Ga0268264_10320820 3300028381 Bacteria 1465
304 Ga0268264_10551028 3300028381 Bacteria 1131
305 Ga0268264_10783648 3300028381 Bacteria 952
306 Ga0268264_11043258 3300028381 Bacteria 825
307 Ga0265326_10004879 3300028558 Bacteria 4252
308 Ga0265319_1000071 3300028563 Bacteria 81543
309 Ga0265334_10000005 3300028573 Bacteria 242590
310 Ga0265334_10000272 3300028573 Bacteria 29197
311 Ga0265318_10000273 3300028577 Bacteria 43832
312 Ga0265318_10001387 3300028577 Bacteria 14390
313 Ga0265338_10145149 3300028800 Bacteria 1852
314 Ga0265338_10513231 3300028800 Bacteria 843
315 Ga0311001_1018981 3300029277 Bacteria 1148
316 Ga0310981_1071358 3300029285 Unclassified 984
317 Ga0265330_10000998 3300031235 Bacteria 17255
318 Ga0265332_10000280 3300031238 Bacteria 40175
319 Ga0265328_10016001 3300031239 Bacteria 2927
320 Ga0265320_10000485 3300031240 Bacteria 31127
321 Ga0265320_10057563 3300031240 Bacteria 1864
322 Ga0265325_10001575 3300031241 Bacteria 15904
323 Ga0265329_10000013 3300031242 Bacteria 70645
324 Ga0265340_10000189 3300031247 Bacteria 31156
325 Ga0265340_10019984 3300031247 Bacteria 3445
326 Ga0265339_10008773 3300031249 Bacteria 6404
327 Ga0265339_10111919 3300031249 Bacteria 1412
328 Ga0265331_10002207 3300031250 Bacteria 13369
329 Ga0265331_10014737 3300031250 Bacteria 4152
330 Ga0265331_10047618 3300031250 Bacteria 2063
331 Ga0265331_10059653 3300031250 Bacteria 1804
332 Ga0265327_10001206 3300031251 Bacteria 34837
333 Ga0265327_10003993 3300031251 Bacteria 13449
334 Ga0265327_10005519 3300031251 Bacteria 10519
335 Ga0265327_10029744 3300031251 Bacteria 3101
336 Ga0265327_10052437 3300031251 Bacteria 2124
337 Ga0265327_10093049 3300031251 Bacteria 1467
338 Ga0265327_10172328 3300031251 Bacteria 994
339 Ga0265316_10001048 3300031344 Bacteria 29962
340 Ga0265316_10001953 3300031344 Bacteria 21664
341 Ga0265316_10002957 3300031344 Bacteria 17386
342 Ga0265316_10025549 3300031344 Bacteria 4927
343 Ga0307509_10000050 3300031507 Bacteria 165692
344 Ga0265313_10000014 3300031595 Bacteria 156295
345 Ga0265313_10000463 3300031595 Bacteria 42820
346 Ga0265313_10001355 3300031595 Bacteria 23078
347 Ga0307508_10012217 3300031616 Bacteria 7853
348 Ga0316575_10022396 3300031665 Bacteria 2438
349 Ga0316575_10030687 3300031665 Bacteria 2102
350 Ga0316575_10042145 3300031665 Bacteria 1807
351 Ga0316579_10019220 3300031691 Unclassified 3016
352 Ga0265314_10002804 3300031711 Bacteria 17395
353 Ga0265314_10026291 3300031711 Bacteria 4374
354 Ga0265314_10050812 3300031711 Bacteria 2891
355 Ga0265342_10000471 3300031712 Bacteria 43707
356 Ga0316576_10165433 3300031727 Bacteria 1669
357 Ga0316576_10345156 3300031727 Bacteria 1108
358 Ga0316578_10005622 3300031728 Bacteria 6102
359 Ga0316577_10031090 3300031733 Bacteria 2982
360 Ga0316577_10102227 3300031733 Bacteria 1607
361 Ga0316577_10103453 3300031733 Unclassified 1597
362 Ga0307413_10006103 3300031824 Bacteria 5465
363 Ga0307410_10045714 3300031852 Bacteria 2917
364 Ga0307410_10412820 3300031852 Bacteria 1093
365 Ga0307407_10018264 3300031903 Bacteria 3543
366 Ga0307409_100002915 3300031995 Bacteria 9086
367 Ga0307409_101398764 3300031995 Bacteria 726
368 Ga0307414_10011674 3300032004 Bacteria 5163
369 Ga0307411_10056297 3300032005 Bacteria 2591
370 Ga0316585_10017604 3300032137 Unclassified 2162
371 Ga0316593_10000033 3300032168 Bacteria 14603
372 Ga0316593_10000918 3300032168 Bacteria 6043
373 Ga0316593_10001049 3300032168 Bacteria 5761
374 Ga0316593_10003675 3300032168 Unclassified 3840
375 Ga0316593_10004660 3300032168 Unclassified 3539
376 Ga0316593_10006758 3300032168 Bacteria 3116
377 Ga0316593_10012789 3300032168 Bacteria 2470
378 Ga0316593_10015794 3300032168 Bacteria 2279
379 Ga0316593_10018179 3300032168 Bacteria 2156
380 Ga0316593_10047659 3300032168 Bacteria 1441
381 Ga0316593_10049598 3300032168 Bacteria 1415
382 Ga0316593_10067209 3300032168 Bacteria 1235
383 Ga0316593_10104479 3300032168 Bacteria 1008
384 Ga0316593_10108027 3300032168 Bacteria 992
385 Ga0316593_10206853 3300032168 Bacteria 727
386 Ga0316592_1002213 3300033524 Bacteria 3321
387 Ga0316592_1005880 3300033524 Bacteria 2345
388 Ga0316592_1024655 3300033524 Bacteria 1294
389 Ga0316592_1029619 3300033524 Bacteria 1188
390 Ga0316586_1000676 3300033527 Bacteria 3435
391 Ga0316586_1025095 3300033527 Bacteria 1002
392 Ga0316588_1019197 3300033528 Bacteria 1538
393 Ga0316588_1020983 3300033528 Bacteria 1483
394 Ga0316587_1001803 3300033529 Bacteria 2737
395 Ga0316587_1005623 3300033529 Bacteria 1888
396 Ga0316596_1000026 3300033541 Bacteria 14495
397 Ga0316596_1000066 3300033541 Bacteria 12106
398 Ga0316596_1000070 3300033541 Bacteria 11847
399 Ga0316596_1000471 3300033541 Bacteria 6810
400 Ga0316596_1000625 3300033541 Bacteria 6297
401 Ga0316596_1001049 3300033541 Bacteria 5352
402 Ga0316596_1002786 3300033541 Bacteria 3773
403 Ga0316596_1004895 3300033541 Bacteria 3028
404 Ga0316596_1005854 3300033541 Bacteria 2831
405 Ga0316596_1012367 3300033541 Bacteria 2098
406 Ga0316596_1014403 3300033541 Bacteria 1960
407 Ga0316596_1015033 3300033541 Bacteria 1926
408 Ga0316596_1017959 3300033541 Bacteria 1785
409 Ga0316596_1040972 3300033541 Bacteria 1217
410 Ga0316596_1045135 3300033541 Bacteria 1162
411 Ga0316596_1053100 3300033541 Bacteria 1075
412 Ga0316596_1082693 3300033541 Bacteria 863
413 Ga0373923_0256444 3300035111 Bacteria 820
414 Ga0373932_0063413 3300035112 Bacteria 1129
415 Ga0373939_0095790 3300035114 Bacteria 1011
416 Ga0373945_0105373 3300035116 Bacteria 1108
417 Ga0373957_0212343 3300035120 Bacteria 809
418 Ga0373942_0006705 3300035207 Bacteria 2660
419 Ga0316574_0062077 3300035398 Bacteria 2348
420 Ga0316574_0063060 3300035398 Bacteria 2330
421 Ga0316574_0137317 3300035398 Bacteria 1574
422 Ga0316574_0223274 3300035398 Bacteria 1207
423 Ga0316574_0633897 3300035398 Unclassified 659
424 Ga0373931_0029997 3300035691 Bacteria 2797
425 Ga0373931_0043909 3300035691 Bacteria 2356
426 Ga0373933_0039894 3300035724 Bacteria 2764
427 Ga0373937_0077853 3300036401 Bacteria 3064
428 Ga0373937_0173592 3300036401 Bacteria 2023
429 Ga0373937_0209616 3300036401 Bacteria 1833
430 Ga0373937_0297971 3300036401 Bacteria 1524
431 Ga0373937_0841925 3300036401 Bacteria 865
432 Ga0316582_0068008 3300036647 Unclassified 2299
433 Ga0316582_0152125 3300036647 Bacteria 1564
434 Ga0316582_0263996 3300036647 Bacteria 1181
435 Ga0316582_0354377 3300036647 Bacteria 1010
436 Ga0316584_0013130 3300036712 Bacteria 5854
437 Ga0316584_0030879 3300036712 Bacteria 3960
438 Ga0316584_0194342 3300036712 Bacteria 1499
439 Ga0316584_0239538 3300036712 Unclassified 1328
440 Ga0373925_0020106 3300037068 Bacteria 4859
441 Ga0373925_0069352 3300037068 Bacteria 2663
442 Ga0395905_0025893 3300037471 Bacteria 5529
443 Ga0400490_35068 3300038726 Bacteria 1582
444 Ga0400483_077376 3300039062 Bacteria 8060
445 Ga0400483_281776 3300039062 Bacteria 7321
446 Ga0436365_0436410 3300039437 Bacteria 4067
447 Ga0436365_1455176 3300039437 Bacteria 1093
448 Ga0436361_0585669 3300039447 Bacteria 853
449 Ga0436363_0950845 3300039450 Bacteria 1017
450 Ga0436363_1686671 3300039450 Bacteria 1339
451 Ga0439465_0061391 3300041413 Bacteria 1246
452 Ga0439441_007228 3300042001 Bacteria 1782
453 Ga0450920_007791 3300042122 Bacteria 1945
454 Ga0450923_003639 3300042125 Bacteria 2351
455 Ga0439458_0049336 3300042157 Bacteria 1036
456 Ga0439444_0032101 3300042437 Unclassified 992
457 Ga0439460_0029385 3300042461 Bacteria 1556
458 Ga0439460_0036362 3300042461 Bacteria 1428
459 Ga0451577_0000019 3300042876 Bacteria 506976
460 Ga0451577_0000210 3300042876 Bacteria 122637
461 Ga0451577_0000328 3300042876 Bacteria 88518
462 Ga0451577_0002073 3300042876 Bacteria 24707
463 Ga0451577_0066183 3300042876 Bacteria 3223
464 Ga0451577_0117036 3300042876 Bacteria 2387
465 Ga0451577_0122252 3300042876 Bacteria 2332
466 Ga0451577_0164499 3300042876 Bacteria 1999
467 Ga0451577_0216667 3300042876 Bacteria 1730
468 Ga0451577_0273405 3300042876 Unclassified 1530
469 Ga0451577_0278907 3300042876 Bacteria 1514
470 Ga0451577_0392375 3300042876 Bacteria 1260
471 Ga0451577_1143079 3300042876 Bacteria 696
472 Ga0451577_1175054 3300042876 Bacteria 685
473 Ga0453683_0000002 3300044673 Bacteria 1244396
474 Ga0453683_0000114 3300044673 Bacteria 119864
475 Ga0453683_0000848 3300044673 Bacteria 29516
476 Ga0453683_0001684 3300044673 Bacteria 18427
477 Ga0453683_0004812 3300044673 Bacteria 9503
478 Ga0453683_0009861 3300044673 Bacteria 6363
479 Ga0453683_0026024 3300044673 Bacteria 3715
480 Ga0453683_0030691 3300044673 Bacteria 3397
481 Ga0453683_0036050 3300044673 Bacteria 3114
482 Ga0453683_0062279 3300044673 Bacteria 2332
483 Ga0453683_0073076 3300044673 Bacteria 2147
484 Ga0453683_0144403 3300044673 Bacteria 1502
485 Ga0453683_0152393 3300044673 Bacteria 1461
486 Ga0453683_0218926 3300044673 Unclassified 1210
487 Ga0466963_0391278 3300044694 Bacteria 980
488 Ga0453684_0000057 3300044712 Bacteria 506899
489 Ga0453684_0000258 3300044712 Bacteria 228312
490 Ga0453684_0000950 3300044712 Bacteria 95538
491 Ga0453684_0001302 3300044712 Bacteria 74077
492 Ga0453684_0002807 3300044712 Bacteria 41156
493 Ga0453684_0005204 3300044712 Bacteria 26125
494 Ga0453684_0006508 3300044712 Bacteria 22145
495 Ga0453684_0013962 3300044712 Bacteria 12943
496 Ga0453684_0025015 3300044712 Bacteria 8688
497 Ga0453684_0028025 3300044712 Bacteria 8053
498 Ga0453684_0032497 3300044712 Bacteria 7301
499 Ga0453684_0037215 3300044712 Bacteria 6682
500 Ga0453684_0056552 3300044712 Bacteria 5088
501 Ga0453684_0086711 3300044712 Bacteria 3883
502 Ga0453684_0104314 3300044712 Bacteria 3462
503 Ga0453684_0109000 3300044712 Bacteria 3369
504 Ga0453684_0114376 3300044712 Bacteria 3271
505 Ga0453684_0187707 3300044712 Bacteria 2421
506 Ga0453684_0268702 3300044712 Bacteria 1950
507 Ga0453684_0311563 3300044712 Bacteria 1786
508 Ga0453684_0364632 3300044712 Bacteria 1626
509 Ga0453684_0420707 3300044712 Bacteria 1492
510 Ga0453684_0560809 3300044712 Bacteria 1257
511 Ga0453684_0570366 3300044712 Bacteria 1244
512 Ga0453684_0638349 3300044712 Bacteria 1163
513 Ga0453684_0695571 3300044712 Bacteria 1105
514 Ga0453684_1300595 3300044712 Bacteria 759
515 Ga0453684_1542090 3300044712 Bacteria 684
516 Ga0451576_0000151 3300045051 Bacteria 176466
517 Ga0451576_0000741 3300045051 Bacteria 65303
518 Ga0451576_0005411 3300045051 Bacteria 16028
519 Ga0451576_0005912 3300045051 Bacteria 15170
520 Ga0451576_0016530 3300045051 Bacteria 8139
521 Ga0451576_0017930 3300045051 Bacteria 7771
522 Ga0451576_0032795 3300045051 Bacteria 5524
523 Ga0451576_0034109 3300045051 Bacteria 5406
524 Ga0451576_0042025 3300045051 Bacteria 4827
525 Ga0451576_0056978 3300045051 Bacteria 4085
526 Ga0451576_0113003 3300045051 Bacteria 2827
527 Ga0451576_0136821 3300045051 Bacteria 2555
528 Ga0451576_0185581 3300045051 Bacteria 2172
529 Ga0451576_0216516 3300045051 Bacteria 2000
530 Ga0451576_0256647 3300045051 Bacteria 1827
531 Ga0451576_0265670 3300045051 Bacteria 1794
532 Ga0451576_0340187 3300045051 Bacteria 1571
533 Ga0451576_0401175 3300045051 Bacteria 1438
534 Ga0451576_0405784 3300045051 Bacteria 1429
535 Ga0451576_0593372 3300045051 Bacteria 1164
536 Ga0451576_0595189 3300045051 Bacteria 1162
537 Ga0451576_0760977 3300045051 Bacteria 1017
538 Ga0451576_0841339 3300045051 Bacteria 963
539 Ga0451576_0872744 3300045051 Bacteria 944
540 Ga0495592_0063390 3300046454 Bacteria 2711
541 Ga0495592_0291642 3300046454 Bacteria 1063
542 Ga0495651_0191883 3300046462 Bacteria 1437
543 Ga0495664_0428339 3300046477 Bacteria 793
544 Ga0495607_0147031 3300046501 Bacteria 1210
545 Ga0495608_0005035 3300046511 Bacteria 9450
546 Ga0495608_0062545 3300046511 Bacteria 2445
547 Ga0495618_0171277 3300046514 Bacteria 1381
548 Ga0495618_0228924 3300046514 Bacteria 1171
549 Ga0495628_0008440 3300046516 Bacteria 8836
550 Ga0495628_0054682 3300046516 Bacteria 3146
551 Ga0495628_0188926 3300046516 Bacteria 1556
552 Ga0495630_0115328 3300046517 Bacteria 2036
553 Ga0495666_0209665 3300046526 Bacteria 894
554 Ga0495652_0282156 3300046529 Bacteria 1215
555 Ga0495640_0298762 3300046533 Bacteria 1000
556 Ga0495587_0120882 3300046536 Bacteria 1500
557 Ga0495667_0006088 3300046559 Bacteria 8166
558 Ga0495667_0069833 3300046559 Bacteria 2292
559 Ga0495667_0106590 3300046559 Bacteria 1811
560 Ga0495634_0367904 3300046642 Bacteria 858
561 Ga0495635_0047399 3300046663 Bacteria 2964
562 Ga0495657_0289073 3300046675 Bacteria 979
563 Ga0495646_0022367 3300046680 Bacteria 3989
564 Ga0495613_0008239 3300046689 Bacteria 7736
565 Ga0495613_0435722 3300046689 Bacteria 890
566 Ga0495589_0070097 3300046794 Bacteria 1714
567 Ga0495600_0336936 3300046809 Bacteria 946
568 Ga0495581_0053618 3300047315 Bacteria 2329
569 Ga0495604_0156149 3300047317 Bacteria 1616
570 Ga0495636_0000151 3300047318 Bacteria 27652
571 Ga0495636_0132596 3300047318 Bacteria 1109
572 Ga0495674_0063930 3300047319 Bacteria 3200
573 Ga0495674_0099683 3300047319 Bacteria 2473
574 Ga0495672_0021328 3300047320 Bacteria 4227
575 Ga0495676_0196760 3300047321 Bacteria 1403
576 Ga0495680_0182420 3300047322 Bacteria 1514
577 Ga0495675_0181396 3300047444 Bacteria 1289
578 Ga0495684_0006263 3300047471 Bacteria 9247
579 Ga0495684_0122850 3300047471 Bacteria 1954
580 Ga0496103_0217202 3300048906 Bacteria 1230
581 Ga0496104_0001101 3300048907 Bacteria 23115
582 Ga0496105_0000654 3300048908 Bacteria 23208
583 Ga0496105_0192710 3300048908 Bacteria 1666
584 Ga0496106_0151998 3300048909 Bacteria 1827
585 Ga0496106_0209014 3300048909 Bacteria 1554
586 Ga0496109_0496916 3300048912 Bacteria 1151
587 Ga0496112_0000007 3300048915 Bacteria 338850
588 Ga0496112_0108653 3300048915 Bacteria 2744
589 Ga0496115_0020996 3300048918 Bacteria 5039
590 Ga0496117_0000041 3300048920 Bacteria 317207
591 Ga0496121_0248562 3300048924 Bacteria 1235
592 Ga0501311_005863 3300049527 Bacteria 1364
593 Ga0501311_009241 3300049527 Unclassified 1173
594 Ga0501320_001132 3300049536 Bacteria 1853
595 Ga0501323_000262 3300049539 Bacteria 3548
596 Ga0501031_0394991 3300049568 Bacteria 894
597 Ga0501033_0140765 3300049570 Bacteria 1744
598 Ga0501033_0903131 3300049570 Bacteria 594
599 Ga0501034_0026488 3300049571 Bacteria 5905
600 Ga0501036_0145001 3300049572 Bacteria 2003
601 Ga0501036_0254258 3300049572 Bacteria 1472
602 Ga0501040_0003158 3300049576 Bacteria 10676
603 Ga0501040_0521808 3300049576 Bacteria 857
604 Ga0501041_0029976 3300049577 Bacteria 3283
605 Ga0501042_0044792 3300049578 Bacteria 3153
606 Ga0501047_0085715 3300049581 Bacteria 3027
607 Ga0501047_0326014 3300049581 Bacteria 1375
608 Ga0501048_0054255 3300049582 Bacteria 2847
609 Ga0501048_0358599 3300049582 Bacteria 1040
610 Ga0501067_0062062 3300049583 Bacteria 2069
611 Ga0501071_0093200 3300049587 Bacteria 2215
612 Ga0501072_0478457 3300049588 Bacteria 985
613 Ga0501073_0298486 3300049589 Bacteria 1111
614 Ga0501074_0002140 3300049590 Bacteria 13659
615 Ga0501074_0145812 3300049590 Bacteria 1693
616 Ga0501074_0195427 3300049590 Bacteria 1442
617 Ga0501075_0080818 3300049591 Bacteria 2460
618 Ga0501075_0121937 3300049591 Bacteria 1984
619 Ga0501075_0195225 3300049591 Bacteria 1544
620 Ga0501076_0016433 3300049592 Bacteria 5611
621 Ga0501076_0050446 3300049592 Bacteria 3292
622 Ga0501077_0172558 3300049593 Bacteria 1374
623 Ga0501077_0220789 3300049593 Bacteria 1204
624 Ga0501243_064064 3300049675 Bacteria 687
625 Ga0501079_0024440 3300049741 Bacteria 4636
626 Ga0501079_0037527 3300049741 Bacteria 3735
627 Ga0501080_0161826 3300049742 Bacteria 2067
628 Ga0501080_0733663 3300049742 Bacteria 870
629 Ga0501081_0019228 3300049743 Bacteria 4546
630 Ga0501081_0112025 3300049743 Bacteria 1937
631 Ga0501081_0519624 3300049743 Bacteria 888
632 Ga0501044_0054246 3300049823 Bacteria 4122
633 Ga0501044_0255019 3300049823 Bacteria 1694
634 Ga0501044_0562273 3300049823 Bacteria 1037
635 Ga0501044_1087883 3300049823 Bacteria 669
636 Ga0501045_0033905 3300049824 Bacteria 3704
637 Ga0501045_0745903 3300049824 Bacteria 722
638 nmdc:mga03n38_158250_c1 3300050490 Bacteria 1145
639 nmdc:mga07m45_467372_c1 3300050496 Bacteria 731
640 nmdc:mga05p37_255382_c1 3300050507 Bacteria 2100
641 nmdc:mga05p37_33875_c1 3300050507 Bacteria 6257
642 nmdc:mga05p37_446689_c1 3300050507 Unclassified 1498
643 nmdc:mga05p37_59933_c1 3300050507 Bacteria 4687
644 nmdc:mga05p37_66573_c1 3300050507 Bacteria 4431
645 nmdc:mga05p37_67990_c1 3300050507 Bacteria 4382
646 nmdc:mga05p37_73039_c1 3300050507 Bacteria 4221
647 nmdc:mga05p37_896465_c1 3300050507 Unclassified 957
648 nmdc:mga09592_318183_c1 3300050508 Bacteria 1348
649 nmdc:mga09592_319870_c1 3300050508 Bacteria 1344
650 nmdc:mga09592_473295_c1 3300050508 Bacteria 1080
651 nmdc:mga09592_817203_c1 3300050508 Bacteria 788
652 nmdc:mga0qj67_11591_c1 3300050509 Bacteria 6611
653 nmdc:mga0qj67_185592_c1 3300050509 Bacteria 1689
654 nmdc:mga0qj67_348205_c1 3300050509 Bacteria 1198
655 nmdc:mga0qj67_923306_c1 3300050509 Bacteria 687
656 nmdc:mga06r32_29887_c1 3300050510 Bacteria 4643
657 nmdc:mga06r32_381682_c1 3300050510 Bacteria 1392
658 nmdc:mga06r32_691002_c1 3300050510 Bacteria 986
659 nmdc:mga08y16_18218_c1 3300050511 Bacteria 7398
660 nmdc:mga08y16_201649_c1 3300050511 Bacteria 2062
661 nmdc:mga08y16_328203_c1 3300050511 Bacteria 1574
662 nmdc:mga08y16_407706_c1 3300050511 Bacteria 1390
663 nmdc:mga08y16_863142_c1 3300050511 Unclassified 894
664 nmdc:mga0n895_1032586_c1 3300050512 Unclassified 802
665 nmdc:mga0n895_186749_c1 3300050512 Bacteria 2104
666 nmdc:mga0n895_25782_c1 3300050512 Bacteria 5559
667 nmdc:mga0n895_396768_c1 3300050512 Bacteria 1395
668 nmdc:mga0n895_833860_c1 3300050512 Bacteria 911
669 nmdc:mga0rr50_199265_c1 3300050513 Bacteria 1644
670 nmdc:mga0rr50_346720_c1 3300050513 Unclassified 1248
671 nmdc:mga0rr50_670915_c1 3300050513 Bacteria 885
672 nmdc:mga0rr50_95662_c1 3300050513 Bacteria 2322
673 nmdc:mga08x19_101344_c1 3300050514 Bacteria 1911
674 nmdc:mga08x19_17_c1 3300050514 Bacteria 313678
675 nmdc:mga08x19_830508_c1 3300050514 Bacteria 656
676 nmdc:mga0a205_1228_c1 3300050515 Bacteria 21495
677 nmdc:mga0a205_195238_c1 3300050515 Bacteria 1915
678 nmdc:mga0a205_198386_c1 3300050515 Bacteria 1898
679 nmdc:mga0a205_201594_c1 3300050515 Bacteria 1880
680 nmdc:mga0a205_25790_c3 3300050515 Bacteria 4591
681 nmdc:mga0a205_29399_c1 3300050515 Bacteria 5258
682 nmdc:mga0a205_386433_c1 3300050515 Unclassified 1264
683 nmdc:mga0a205_542325_c1 3300050515 Unclassified 1019
684 nmdc:mga0a205_89147_c1 3300050515 Bacteria 2982
685 Ga0495619_0220317 3300053085 Bacteria 1314
686 Ga0500616_0063131 3300053153 Bacteria 1911
687 Ga0501084_0000461 3300054114 Bacteria 31395
688 Ga0501084_0083056 3300054114 Bacteria 2688
689 Ga0501084_0399402 3300054114 Bacteria 1162
690 Ga0501084_0916333 3300054114 Bacteria 737
691 Ga0587084_035876 3300059477 Bacteria 821
692 Ga0587083_0004115 3300059505 Bacteria 1993
693 Ga0587085_015328 3300059506 Bacteria 1094
694 Ga0587088_048261 3300059508 Bacteria 826
695 Ga0587091_076436 3300059511 Bacteria 743
696 Ga0587062_017757 3300059639 Bacteria 976
697 Ga0587069_029009 3300059642 Bacteria 882
698 Ga0501082_0061445 3300060353 Bacteria 3234
699 Ga0501082_0123778 3300060353 Bacteria 2242
700 Ga0466962_0134911 3300061719 Bacteria 1194
701 Ga0530510_0015081 3300061734 Bacteria 5459
702 Ga0530510_0056387 3300061734 Bacteria 2838
703 Ga0530510_0060067 3300061734 Bacteria 2751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10015944 Ga0081539_1001594411 132
2 3300009147 Ga0114129_10244086 Ga0114129_102440862 148
3 3300050507 nmdc:mga05p37_73039_c1 nmdc:mga05p37_73039_c1_2130_2681 148
4 3300005445 Ga0070708_100035227 Ga0070708_1000352277 166
5 3300005467 Ga0070706_100074590 Ga0070706_1000745904 166
6 3300005471 Ga0070698_100070375 Ga0070698_1000703752 166
7 3300025910 Ga0207684_10034991 Ga0207684_100349912 166
8 3300049589 Ga0501073_0298486 Ga0501073_0298486_87_725 166
9 3300005468 Ga0070707_100786433 Ga0070707_1007864332 167
10 3300005544 Ga0070686_100396679 Ga0070686_1003966792 167
11 3300005719 Ga0068861_100235347 Ga0068861_1002353473 167
12 3300025922 Ga0207646_10610322 Ga0207646_106103221 167
13 3300044673 Ga0453683_0218926 Ga0453683_0218926_27_629 167
14 3300045051 Ga0451576_0032795 Ga0451576_0032795_2005_2607 167
15 3300036401 Ga0373937_0077853 Ga0373937_0077853_2427_3032 168
16 3300005841 Ga0068863_100256165 Ga0068863_1002561653 169
17 3300009094 Ga0111539_11064106 Ga0111539_110641061 169
18 3300026088 Ga0207641_10070148 Ga0207641_100701483 169
19 3300046511 Ga0495608_0005035 Ga0495608_0005035_1480_2106 169
20 3300046514 Ga0495618_0228924 Ga0495618_0228924_214_840 169
21 3300046516 Ga0495628_0188926 Ga0495628_0188926_295_921 169
22 3300046559 Ga0495667_0006088 Ga0495667_0006088_3627_4253 169
23 3300048908 Ga0496105_0192710 Ga0496105_0192710_941_1468 169
24 3300050515 nmdc:mga0a205_201594_c1 nmdc:mga0a205_201594_c1_213_839 169
25 3300031344 Ga0265316_10025549 Ga0265316_100255492 170
26 3300031711 Ga0265314_10050812 Ga0265314_100508124 170
27 3300031733 Ga0316577_10031090 Ga0316577_100310902 170
28 3300033541 Ga0316596_1004895 Ga0316596_10048954 170
29 3300035398 Ga0316574_0137317 Ga0316574_0137317_259_789 170
30 3300006844 Ga0075428_100103500 Ga0075428_1001035003 171
31 3300044694 Ga0466963_0391278 Ga0466963_0391278_314_940 171
32 3300050509 nmdc:mga0qj67_185592_c1 nmdc:mga0qj67_185592_c1_954_1574 171
33 3300047320 Ga0495672_0021328 Ga0495672_0021328_350_979 173
34 3300048918 Ga0496115_0020996 Ga0496115_0020996_1910_2503 173
35 3300002774 JGI25150J39212_1007938 JGI25150J39212_10079383 174
36 3300003504 JGI26138J51218_100719 JGI26138J51218_1007192 174
37 3300003856 Ga0058692_1000048 Ga0058692_100004842 174
38 3300005288 Ga0065714_10071913 Ga0065714_100719134 174
39 3300005327 Ga0070658_10004878 Ga0070658_100048786 174
40 3300005339 Ga0070660_100252820 Ga0070660_1002528201 174
41 3300005563 Ga0068855_100025740 Ga0068855_1000257408 174
42 3300005842 Ga0068858_100063036 Ga0068858_1000630362 174
43 3300010375 Ga0105239_10515706 Ga0105239_105157062 174
44 3300013296 Ga0157374_10318285 Ga0157374_103182852 174
45 3300021384 Ga0213876_10042611 Ga0213876_100426114 174
46 3300025909 Ga0207705_10004481 Ga0207705_100044815 174
47 3300025919 Ga0207657_10107023 Ga0207657_101070232 174
48 3300026041 Ga0207639_10205235 Ga0207639_102052351 174
49 3300028558 Ga0265326_10004879 Ga0265326_100048794 174
50 3300028573 Ga0265334_10000005 Ga0265334_10000005193 174
51 3300028573 Ga0265334_10000272 Ga0265334_1000027217 174
52 3300028800 Ga0265338_10145149 Ga0265338_101451493 174
53 3300031250 Ga0265331_10014737 Ga0265331_100147373 174
54 3300031250 Ga0265331_10047618 Ga0265331_100476183 174
55 3300031251 Ga0265327_10001206 Ga0265327_1000120626 174
56 3300031251 Ga0265327_10003993 Ga0265327_100039933 174
57 3300031251 Ga0265327_10005519 Ga0265327_100055194 174
58 3300031251 Ga0265327_10029744 Ga0265327_100297445 174
59 3300031251 Ga0265327_10093049 Ga0265327_100930493 174
60 3300031344 Ga0265316_10001953 Ga0265316_1000195317 174
61 3300031595 Ga0265313_10000014 Ga0265313_10000014127 174
62 3300031665 Ga0316575_10030687 Ga0316575_100306872 174
63 3300032168 Ga0316593_10000918 Ga0316593_100009183 174
64 3300032168 Ga0316593_10004660 Ga0316593_100046604 174
65 3300032168 Ga0316593_10012789 Ga0316593_100127894 174
66 3300032168 Ga0316593_10015794 Ga0316593_100157942 174
67 3300032168 Ga0316593_10018179 Ga0316593_100181793 174
68 3300032168 Ga0316593_10067209 Ga0316593_100672092 174
69 3300032168 Ga0316593_10104479 Ga0316593_101044792 174
70 3300033524 Ga0316592_1024655 Ga0316592_10246553 174
71 3300033524 Ga0316592_1029619 Ga0316592_10296192 174
72 3300033527 Ga0316586_1000676 Ga0316586_10006765 174
73 3300033541 Ga0316596_1000026 Ga0316596_100002628 174
74 3300033541 Ga0316596_1000066 Ga0316596_10000663 174
75 3300033541 Ga0316596_1000625 Ga0316596_10006251 174
76 3300033541 Ga0316596_1002786 Ga0316596_10027864 174
77 3300033541 Ga0316596_1015033 Ga0316596_10150333 174
78 3300033541 Ga0316596_1017959 Ga0316596_10179593 174
79 3300033541 Ga0316596_1040972 Ga0316596_10409721 174
80 3300033541 Ga0316596_1053100 Ga0316596_10531002 174
81 3300036647 Ga0316582_0354377 Ga0316582_0354377_347_967 174
82 3300039437 Ga0436365_0436410 Ga0436365_0436410_1859_2479 174
83 3300042876 Ga0451577_0000019 Ga0451577_0000019_216799_217419 174
84 3300042876 Ga0451577_0000210 Ga0451577_0000210_109604_110224 174
85 3300042876 Ga0451577_0216667 Ga0451577_0216667_458_1078 174
86 3300044712 Ga0453684_0000057 Ga0453684_0000057_216722_217342 174
87 3300044712 Ga0453684_0002807 Ga0453684_0002807_30971_31591 174
88 3300044712 Ga0453684_0104314 Ga0453684_0104314_2004_2624 174
89 3300044712 Ga0453684_0187707 Ga0453684_0187707_1585_2208 174
90 3300044712 Ga0453684_0268702 Ga0453684_0268702_1160_1780 174
91 3300044712 Ga0453684_0364632 Ga0453684_0364632_974_1594 174
92 3300044712 Ga0453684_0570366 Ga0453684_0570366_406_1026 174
93 3300045051 Ga0451576_0000741 Ga0451576_0000741_32281_32901 174
94 3300045051 Ga0451576_0016530 Ga0451576_0016530_6441_7064 174
95 3300048920 Ga0496117_0000041 Ga0496117_0000041_286370_286990 174
96 3300049581 Ga0501047_0085715 Ga0501047_0085715_197_817 174
97 3300049581 Ga0501047_0326014 Ga0501047_0326014_302_922 174
98 3300049590 Ga0501074_0195427 Ga0501074_0195427_537_1157 174
99 3300049742 Ga0501080_0161826 Ga0501080_0161826_912_1532 174
100 3300049823 Ga0501044_0054246 Ga0501044_0054246_1034_1654 174
101 3300049823 Ga0501044_0255019 Ga0501044_0255019_200_820 174
102 3300050496 nmdc:mga07m45_467372_c1 nmdc:mga07m45_467372_c1_93_716 174
103 iso_pu_bacteria 2734482258 2735818123 174
104 iso_pu_bacteria 2881714928 2881716665 174
105 iso_pu_bacteria 2894510363 2894510830 174
106 iso_pu_bacteria 2919704043 2919708809 174
107 iso_pu_bacteria 2989392574 2989393104 174
108 iso_pu_bacteria 8001522603 8001524085 174
109 3300005288 Ga0065714_10078587 Ga0065714_100785873 175
110 3300005290 Ga0065712_10069958 Ga0065712_100699583 175
111 3300005331 Ga0070670_100004112 Ga0070670_10000411213 175
112 3300005334 Ga0068869_100054740 Ga0068869_1000547401 175
113 3300005364 Ga0070673_100305882 Ga0070673_1003058822 175
114 3300005365 Ga0070688_100010141 Ga0070688_1000101413 175
115 3300005438 Ga0070701_10041796 Ga0070701_100417963 175
116 3300005441 Ga0070700_100152864 Ga0070700_1001528642 175
117 3300005459 Ga0068867_100055178 Ga0068867_1000551785 175
118 3300005466 Ga0070685_10015888 Ga0070685_100158887 175
119 3300005617 Ga0068859_100023116 Ga0068859_1000231168 175
120 3300005618 Ga0068864_100282770 Ga0068864_1002827702 175
121 3300005840 Ga0068870_10018891 Ga0068870_100188914 175
122 3300006914 Ga0075436_100111404 Ga0075436_1001114042 175
123 3300006931 Ga0097620_100023118 Ga0097620_1000231184 175
124 3300009094 Ga0111539_11304446 Ga0111539_113044461 175
125 3300009176 Ga0105242_10006482 Ga0105242_100064822 175
126 3300013308 Ga0157375_10140366 Ga0157375_101403666 175
127 3300014326 Ga0157380_10010165 Ga0157380_100101654 175
128 3300014745 Ga0157377_10073583 Ga0157377_100735834 175
129 3300025925 Ga0207650_10025331 Ga0207650_100253314 175
130 3300025934 Ga0207686_10060186 Ga0207686_100601862 175
131 3300025936 Ga0207670_10054611 Ga0207670_100546112 175
132 3300025942 Ga0207689_10030894 Ga0207689_100308948 175
133 3300026075 Ga0207708_10151584 Ga0207708_101515843 175
134 3300026089 Ga0207648_10033790 Ga0207648_100337908 175
135 3300026095 Ga0207676_10401872 Ga0207676_104018722 175
136 3300031691 Ga0316579_10019220 Ga0316579_100192203 175
137 3300031728 Ga0316578_10005622 Ga0316578_100056223 175
138 3300031733 Ga0316577_10102227 Ga0316577_101022272 175
139 3300032137 Ga0316585_10017604 Ga0316585_100176042 175
140 3300032168 Ga0316593_10003675 Ga0316593_100036752 175
141 3300032168 Ga0316593_10006758 Ga0316593_100067584 175
142 3300032168 Ga0316593_10206853 Ga0316593_102068531 175
143 3300033524 Ga0316592_1002213 Ga0316592_10022135 175
144 3300033524 Ga0316592_1005880 Ga0316592_10058803 175
145 3300033527 Ga0316586_1025095 Ga0316586_10250952 175
146 3300033541 Ga0316596_1005854 Ga0316596_10058543 175
147 3300033541 Ga0316596_1012367 Ga0316596_10123673 175
148 3300035398 Ga0316574_0633897 Ga0316574_0633897_16_600 175
149 3300035691 Ga0373931_0043909 Ga0373931_0043909_1570_2199 175
150 3300036401 Ga0373937_0173592 Ga0373937_0173592_591_1220 175
151 3300036647 Ga0316582_0068008 Ga0316582_0068008_791_1444 175
152 3300036647 Ga0316582_0263996 Ga0316582_0263996_431_1084 175
153 3300036712 Ga0316584_0013130 Ga0316584_0013130_1008_1661 175
154 3300036712 Ga0316584_0030879 Ga0316584_0030879_1397_2050 175
155 3300037068 Ga0373925_0020106 Ga0373925_0020106_1823_2452 175
156 3300042461 Ga0439460_0036362 Ga0439460_0036362_711_1289 175
157 3300045051 Ga0451576_0056978 Ga0451576_0056978_333_962 175
158 3300046526 Ga0495666_0209665 Ga0495666_0209665_202_831 175
159 3300046689 Ga0495613_0008239 Ga0495613_0008239_4036_4665 175
160 3300047318 Ga0495636_0000151 Ga0495636_0000151_2082_2678 175
161 3300049570 Ga0501033_0140765 Ga0501033_0140765_235_816 175
162 3300049743 Ga0501081_0519624 Ga0501081_0519624_170_808 175
163 3300050513 nmdc:mga0rr50_670915_c1 nmdc:mga0rr50_670915_c1_235_864 175
164 3300050514 nmdc:mga08x19_101344_c1 nmdc:mga08x19_101344_c1_762_1391 175
165 3300059642 Ga0587069_029009 Ga0587069_029009_113_742 175
166 3300001991 JGI24743J22301_10017129 JGI24743J22301_100171293 176
167 3300003373 JGI25407J50210_10002202 JGI25407J50210_100022027 176
168 3300004800 Ga0058861_10010832 Ga0058861_100108321 176
169 3300005289 Ga0065704_10006414 Ga0065704_100064144 176
170 3300005290 Ga0065712_10325143 Ga0065712_103251431 176
171 3300005295 Ga0065707_10003866 Ga0065707_100038663 176
172 3300005295 Ga0065707_10087143 Ga0065707_100871437 176
173 3300005295 Ga0065707_10111745 Ga0065707_101117454 176
174 3300005330 Ga0070690_100004138 Ga0070690_10000413812 176
175 3300005334 Ga0068869_100164438 Ga0068869_1001644382 176
176 3300005334 Ga0068869_100731449 Ga0068869_1007314492 176
177 3300005336 Ga0070680_100807235 Ga0070680_1008072352 176
178 3300005338 Ga0068868_100657787 Ga0068868_1006577872 176
179 3300005343 Ga0070687_100266757 Ga0070687_1002667571 176
180 3300005354 Ga0070675_100908153 Ga0070675_1009081531 176
181 3300005365 Ga0070688_100021526 Ga0070688_1000215263 176
182 3300005406 Ga0070703_10000317 Ga0070703_1000031725 176
183 3300005406 Ga0070703_10019413 Ga0070703_100194134 176
184 3300005406 Ga0070703_10160179 Ga0070703_101601791 176
185 3300005434 Ga0070709_10000098 Ga0070709_1000009829 176
186 3300005434 Ga0070709_10486156 Ga0070709_104861562 176
187 3300005436 Ga0070713_100219189 Ga0070713_1002191892 176
188 3300005438 Ga0070701_10173950 Ga0070701_101739502 176
189 3300005439 Ga0070711_100000059 Ga0070711_10000005928 176
190 3300005439 Ga0070711_100656995 Ga0070711_1006569951 176
191 3300005440 Ga0070705_100012679 Ga0070705_1000126797 176
192 3300005440 Ga0070705_100129356 Ga0070705_1001293562 176
193 3300005440 Ga0070705_100148519 Ga0070705_1001485191 176
194 3300005440 Ga0070705_100365654 Ga0070705_1003656541 176
195 3300005441 Ga0070700_100338076 Ga0070700_1003380762 176
196 3300005444 Ga0070694_100146966 Ga0070694_1001469662 176
197 3300005444 Ga0070694_100297061 Ga0070694_1002970612 176
198 3300005444 Ga0070694_100519705 Ga0070694_1005197051 176
199 3300005445 Ga0070708_100000092 Ga0070708_10000009239 176
200 3300005445 Ga0070708_100005832 Ga0070708_10000583211 176
201 3300005445 Ga0070708_100015734 Ga0070708_1000157347 176
202 3300005445 Ga0070708_100068478 Ga0070708_1000684786 176
203 3300005445 Ga0070708_100127832 Ga0070708_1001278323 176
204 3300005445 Ga0070708_100685904 Ga0070708_1006859042 176
205 3300005445 Ga0070708_101191325 Ga0070708_1011913251 176
206 3300005457 Ga0070662_100261691 Ga0070662_1002616913 176
207 3300005458 Ga0070681_10046903 Ga0070681_100469033 176
208 3300005467 Ga0070706_100001316 Ga0070706_10000131624 176
209 3300005467 Ga0070706_100010237 Ga0070706_1000102372 176
210 3300005467 Ga0070706_100011787 Ga0070706_1000117876 176
211 3300005467 Ga0070706_100090228 Ga0070706_1000902285 176
212 3300005467 Ga0070706_100119837 Ga0070706_1001198373 176
213 3300005467 Ga0070706_100211298 Ga0070706_1002112981 176
214 3300005467 Ga0070706_100324516 Ga0070706_1003245162 176
215 3300005468 Ga0070707_100024115 Ga0070707_1000241156 176
216 3300005468 Ga0070707_100033784 Ga0070707_1000337842 176
217 3300005468 Ga0070707_100038225 Ga0070707_1000382257 176
218 3300005468 Ga0070707_100064600 Ga0070707_1000646002 176
219 3300005468 Ga0070707_100126568 Ga0070707_1001265682 176
220 3300005468 Ga0070707_100596360 Ga0070707_1005963601 176
221 3300005471 Ga0070698_100104288 Ga0070698_1001042885 176
222 3300005471 Ga0070698_100255597 Ga0070698_1002555972 176
223 3300005471 Ga0070698_100416971 Ga0070698_1004169712 176
224 3300005518 Ga0070699_100000009 Ga0070699_100000009231 176
225 3300005518 Ga0070699_100028609 Ga0070699_1000286096 176
226 3300005518 Ga0070699_100048892 Ga0070699_1000488922 176
227 3300005518 Ga0070699_100177476 Ga0070699_1001774762 176
228 3300005518 Ga0070699_100438516 Ga0070699_1004385162 176
229 3300005535 Ga0070684_100092545 Ga0070684_1000925456 176
230 3300005536 Ga0070697_100030323 Ga0070697_1000303235 176
231 3300005536 Ga0070697_100579808 Ga0070697_1005798082 176
232 3300005544 Ga0070686_100042639 Ga0070686_1000426392 176
233 3300005544 Ga0070686_100139579 Ga0070686_1001395793 176
234 3300005544 Ga0070686_100143805 Ga0070686_1001438052 176
235 3300005544 Ga0070686_100350479 Ga0070686_1003504792 176
236 3300005544 Ga0070686_100632492 Ga0070686_1006324921 176
237 3300005544 Ga0070686_100800728 Ga0070686_1008007281 176
238 3300005545 Ga0070695_100143193 Ga0070695_1001431932 176
239 3300005545 Ga0070695_100323897 Ga0070695_1003238972 176
240 3300005545 Ga0070695_100654972 Ga0070695_1006549722 176
241 3300005546 Ga0070696_100000153 Ga0070696_1000001532 176
242 3300005546 Ga0070696_100062684 Ga0070696_1000626843 176
243 3300005546 Ga0070696_100065752 Ga0070696_1000657522 176
244 3300005546 Ga0070696_100496134 Ga0070696_1004961342 176
245 3300005546 Ga0070696_100642281 Ga0070696_1006422811 176
246 3300005547 Ga0070693_100336844 Ga0070693_1003368442 176
247 3300005549 Ga0070704_100016174 Ga0070704_1000161747 176
248 3300005549 Ga0070704_100064036 Ga0070704_1000640365 176
249 3300005549 Ga0070704_100101329 Ga0070704_1001013293 176
250 3300005549 Ga0070704_100239973 Ga0070704_1002399732 176
251 3300005549 Ga0070704_101097632 Ga0070704_1010976321 176
252 3300005577 Ga0068857_100399521 Ga0068857_1003995212 176
253 3300005614 Ga0068856_100184992 Ga0068856_1001849924 176
254 3300005614 Ga0068856_100290876 Ga0068856_1002908762 176
255 3300005615 Ga0070702_100789825 Ga0070702_1007898251 176
256 3300005617 Ga0068859_100150725 Ga0068859_1001507252 176
257 3300005617 Ga0068859_100265391 Ga0068859_1002653912 176
258 3300005617 Ga0068859_100433433 Ga0068859_1004334332 176
259 3300005841 Ga0068863_100194310 Ga0068863_1001943104 176
260 3300005842 Ga0068858_100619064 Ga0068858_1006190642 176
261 3300005843 Ga0068860_100025069 Ga0068860_1000250696 176
262 3300005843 Ga0068860_100158587 Ga0068860_1001585872 176
263 3300005843 Ga0068860_101087734 Ga0068860_1010877342 176
264 3300005937 Ga0081455_10083326 Ga0081455_100833263 176
265 3300005937 Ga0081455_10127541 Ga0081455_101275412 176
266 3300005981 Ga0081538_10000250 Ga0081538_1000025033 176
267 3300005981 Ga0081538_10002371 Ga0081538_100023713 176
268 3300005981 Ga0081538_10042593 Ga0081538_100425932 176
269 3300006163 Ga0070715_10082397 Ga0070715_100823972 176
270 3300006173 Ga0070716_100013911 Ga0070716_1000139114 176
271 3300006175 Ga0070712_100046521 Ga0070712_1000465212 176
272 3300006175 Ga0070712_100620565 Ga0070712_1006205652 176
273 3300006237 Ga0097621_100923162 Ga0097621_1009231622 176
274 3300006353 Ga0075370_10035734 Ga0075370_100357343 176
275 3300006844 Ga0075428_100000694 Ga0075428_10000069424 176
276 3300006844 Ga0075428_100038782 Ga0075428_1000387823 176
277 3300006844 Ga0075428_100093827 Ga0075428_1000938273 176
278 3300006844 Ga0075428_100097922 Ga0075428_1000979221 176
279 3300006844 Ga0075428_100434303 Ga0075428_1004343032 176
280 3300006844 Ga0075428_100878427 Ga0075428_1008784272 176
281 3300006846 Ga0075430_100019248 Ga0075430_1000192485 176
282 3300006846 Ga0075430_100820096 Ga0075430_1008200961 176
283 3300006847 Ga0075431_100051274 Ga0075431_1000512744 176
284 3300006847 Ga0075431_100422689 Ga0075431_1004226892 176
285 3300006847 Ga0075431_100654931 Ga0075431_1006549311 176
286 3300006852 Ga0075433_10000980 Ga0075433_1000098026 176
287 3300006852 Ga0075433_10031678 Ga0075433_100316782 176
288 3300006852 Ga0075433_10037835 Ga0075433_100378354 176
289 3300006852 Ga0075433_10076682 Ga0075433_100766825 176
290 3300006852 Ga0075433_10116481 Ga0075433_101164812 176
291 3300006852 Ga0075433_10126725 Ga0075433_101267252 176
292 3300006852 Ga0075433_10220824 Ga0075433_102208242 176
293 3300006852 Ga0075433_10452365 Ga0075433_104523652 176
294 3300006871 Ga0075434_100028054 Ga0075434_10002805410 176
295 3300006871 Ga0075434_100129993 Ga0075434_1001299933 176
296 3300006871 Ga0075434_100365168 Ga0075434_1003651682 176
297 3300006871 Ga0075434_100440906 Ga0075434_1004409061 176
298 3300006871 Ga0075434_100771944 Ga0075434_1007719441 176
299 3300006871 Ga0075434_100942197 Ga0075434_1009421971 176
300 3300006871 Ga0075434_101069110 Ga0075434_1010691102 176
301 3300006880 Ga0075429_100319932 Ga0075429_1003199322 176
302 3300006880 Ga0075429_100396123 Ga0075429_1003961232 176
303 3300006880 Ga0075429_100964785 Ga0075429_1009647851 176
304 3300006914 Ga0075436_100021490 Ga0075436_1000214905 176
305 3300006914 Ga0075436_100109982 Ga0075436_1001099822 176
306 3300006914 Ga0075436_100180277 Ga0075436_1001802772 176
307 3300006914 Ga0075436_100293250 Ga0075436_1002932502 176
308 3300006931 Ga0097620_100150720 Ga0097620_1001507202 176
309 3300006931 Ga0097620_100265382 Ga0097620_1002653822 176
310 3300006931 Ga0097620_100433468 Ga0097620_1004334682 176
311 3300007076 Ga0075435_100039021 Ga0075435_1000390213 176
312 3300007076 Ga0075435_100167058 Ga0075435_1001670584 176
313 3300007076 Ga0075435_100212446 Ga0075435_1002124463 176
314 3300007076 Ga0075435_100322304 Ga0075435_1003223042 176
315 3300007076 Ga0075435_100379290 Ga0075435_1003792902 176
316 3300007265 Ga0099794_10000042 Ga0099794_1000004230 176
317 3300007265 Ga0099794_10001613 Ga0099794_1000161313 176
318 3300009094 Ga0111539_10006016 Ga0111539_100060163 176
319 3300009094 Ga0111539_10009725 Ga0111539_100097257 176
320 3300009094 Ga0111539_10024178 Ga0111539_100241785 176
321 3300009094 Ga0111539_10217901 Ga0111539_102179015 176
322 3300009094 Ga0111539_10234530 Ga0111539_102345302 176
323 3300009094 Ga0111539_10302060 Ga0111539_103020603 176
324 3300009098 Ga0105245_10048434 Ga0105245_100484345 176
325 3300009147 Ga0114129_10043050 Ga0114129_100430506 176
326 3300009147 Ga0114129_10139563 Ga0114129_101395631 176
327 3300009147 Ga0114129_10322163 Ga0114129_103221632 176
328 3300009147 Ga0114129_10355930 Ga0114129_103559302 176
329 3300009147 Ga0114129_10537326 Ga0114129_105373261 176
330 3300009147 Ga0114129_10863572 Ga0114129_108635721 176
331 3300009147 Ga0114129_11037715 Ga0114129_110377151 176
332 3300009148 Ga0105243_10152057 Ga0105243_101520572 176
333 3300009148 Ga0105243_10509721 Ga0105243_105097212 176
334 3300009174 Ga0105241_10561229 Ga0105241_105612291 176
335 3300009176 Ga0105242_10159590 Ga0105242_101595902 176
336 3300009176 Ga0105242_10191532 Ga0105242_101915323 176
337 3300009176 Ga0105242_10250786 Ga0105242_102507863 176
338 3300009177 Ga0105248_10146643 Ga0105248_101466432 176
339 3300009177 Ga0105248_10432757 Ga0105248_104327572 176
340 3300010159 Ga0099796_10039519 Ga0099796_100395192 176
341 3300010375 Ga0105239_10627179 Ga0105239_106271791 176
342 3300013296 Ga0157374_11570981 Ga0157374_115709811 176
343 3300013297 Ga0157378_10232549 Ga0157378_102325492 176
344 3300013297 Ga0157378_10323704 Ga0157378_103237042 176
345 3300013297 Ga0157378_10512851 Ga0157378_105128512 176
346 3300013306 Ga0163162_11402171 Ga0163162_114021711 176
347 3300013308 Ga0157375_10495920 Ga0157375_104959202 176
348 3300014325 Ga0163163_10014061 Ga0163163_100140617 176
349 3300014325 Ga0163163_10109954 Ga0163163_101099542 176
350 3300014325 Ga0163163_10125103 Ga0163163_101251035 176
351 3300014326 Ga0157380_10082874 Ga0157380_100828742 176
352 3300014326 Ga0157380_10793711 Ga0157380_107937112 176
353 3300014968 Ga0157379_10207601 Ga0157379_102076014 176
354 3300014968 Ga0157379_10267362 Ga0157379_102673622 176
355 3300014968 Ga0157379_10600456 Ga0157379_106004561 176
356 3300014969 Ga0157376_10297477 Ga0157376_102974772 176
357 3300014969 Ga0157376_11089257 Ga0157376_110892571 176
358 3300017792 Ga0163161_11103908 Ga0163161_111039081 176
359 3300020081 Ga0206354_11440846 Ga0206354_114408461 176
360 3300025885 Ga0207653_10000020 Ga0207653_1000002029 176
361 3300025885 Ga0207653_10082954 Ga0207653_100829542 176
362 3300025906 Ga0207699_10000005 Ga0207699_1000000528 176
363 3300025910 Ga0207684_10002118 Ga0207684_1000211828 176
364 3300025910 Ga0207684_10018534 Ga0207684_100185342 176
365 3300025910 Ga0207684_10116254 Ga0207684_101162542 176
366 3300025910 Ga0207684_10211624 Ga0207684_102116243 176
367 3300025910 Ga0207684_10229841 Ga0207684_102298412 176
368 3300025910 Ga0207684_10942593 Ga0207684_109425931 176
369 3300025913 Ga0207695_10923455 Ga0207695_109234551 176
370 3300025915 Ga0207693_10041454 Ga0207693_100414543 176
371 3300025915 Ga0207693_10622312 Ga0207693_106223122 176
372 3300025916 Ga0207663_10000004 Ga0207663_10000004125 176
373 3300025917 Ga0207660_10000002 Ga0207660_10000002332 176
374 3300025918 Ga0207662_10293550 Ga0207662_102935502 176
375 3300025918 Ga0207662_10370025 Ga0207662_103700252 176
376 3300025921 Ga0207652_10360838 Ga0207652_103608382 176
377 3300025922 Ga0207646_10028575 Ga0207646_100285752 176
378 3300025922 Ga0207646_10037146 Ga0207646_100371462 176
379 3300025922 Ga0207646_10210359 Ga0207646_102103593 176
380 3300025927 Ga0207687_10068636 Ga0207687_100686362 176
381 3300025928 Ga0207700_10270557 Ga0207700_102705572 176
382 3300025929 Ga0207664_10044350 Ga0207664_100443507 176
383 3300025932 Ga0207690_10249236 Ga0207690_102492362 176
384 3300025934 Ga0207686_10228561 Ga0207686_102285612 176
385 3300025934 Ga0207686_10748398 Ga0207686_107483981 176
386 3300025936 Ga0207670_10041931 Ga0207670_100419316 176
387 3300025936 Ga0207670_10712717 Ga0207670_107127171 176
388 3300025939 Ga0207665_10013618 Ga0207665_100136186 176
389 3300025941 Ga0207711_10466134 Ga0207711_104661342 176
390 3300025942 Ga0207689_10647854 Ga0207689_106478542 176
391 3300025944 Ga0207661_10187411 Ga0207661_101874112 176
392 3300026035 Ga0207703_10633985 Ga0207703_106339852 176
393 3300026075 Ga0207708_10153468 Ga0207708_101534682 176
394 3300026075 Ga0207708_10234993 Ga0207708_102349932 176
395 3300026078 Ga0207702_10158054 Ga0207702_101580544 176
396 3300026078 Ga0207702_10540642 Ga0207702_105406421 176
397 3300026078 Ga0207702_10576422 Ga0207702_105764221 176
398 3300026088 Ga0207641_10127085 Ga0207641_101270852 176
399 3300026088 Ga0207641_10440903 Ga0207641_104409032 176
400 3300026089 Ga0207648_10151012 Ga0207648_101510122 176
401 3300026118 Ga0207675_100168611 Ga0207675_1001686111 176
402 3300026118 Ga0207675_100269085 Ga0207675_1002690852 176
403 3300026118 Ga0207675_100422382 Ga0207675_1004223822 176
404 3300026118 Ga0207675_100676088 Ga0207675_1006760881 176
405 3300027671 Ga0209588_1000034 Ga0209588_100003428 176
406 3300027671 Ga0209588_1002219 Ga0209588_10022197 176
407 3300027876 Ga0209974_10018041 Ga0209974_100180413 176
408 3300027907 Ga0207428_10146257 Ga0207428_101462572 176
409 3300027907 Ga0207428_10242953 Ga0207428_102429532 176
410 3300028380 Ga0268265_10140439 Ga0268265_101404392 176
411 3300028381 Ga0268264_10011525 Ga0268264_100115255 176
412 3300028381 Ga0268264_10197545 Ga0268264_101975452 176
413 3300028381 Ga0268264_10320820 Ga0268264_103208202 176
414 3300028381 Ga0268264_10551028 Ga0268264_105510282 176
415 3300028381 Ga0268264_10783648 Ga0268264_107836482 176
416 3300028381 Ga0268264_11043258 Ga0268264_110432581 176
417 3300028563 Ga0265319_1000071 Ga0265319_100007128 176
418 3300028577 Ga0265318_10000273 Ga0265318_1000027327 176
419 3300028577 Ga0265318_10001387 Ga0265318_100013877 176
420 3300028800 Ga0265338_10513231 Ga0265338_105132312 176
421 3300029277 Ga0311001_1018981 Ga0311001_10189811 176
422 3300029285 Ga0310981_1071358 Ga0310981_10713582 176
423 3300031235 Ga0265330_10000998 Ga0265330_100009986 176
424 3300031238 Ga0265332_10000280 Ga0265332_1000028027 176
425 3300031239 Ga0265328_10016001 Ga0265328_100160015 176
426 3300031240 Ga0265320_10000485 Ga0265320_1000048516 176
427 3300031240 Ga0265320_10057563 Ga0265320_100575631 176
428 3300031241 Ga0265325_10001575 Ga0265325_1000157527 176
429 3300031242 Ga0265329_10000013 Ga0265329_1000001328 176
430 3300031247 Ga0265340_10000189 Ga0265340_1000018916 176
431 3300031247 Ga0265340_10019984 Ga0265340_100199842 176
432 3300031249 Ga0265339_10008773 Ga0265339_100087734 176
433 3300031249 Ga0265339_10111919 Ga0265339_101119192 176
434 3300031250 Ga0265331_10002207 Ga0265331_1000220716 176
435 3300031250 Ga0265331_10059653 Ga0265331_100596534 176
436 3300031251 Ga0265327_10052437 Ga0265327_100524372 176
437 3300031251 Ga0265327_10172328 Ga0265327_101723282 176
438 3300031344 Ga0265316_10001048 Ga0265316_1000104817 176
439 3300031344 Ga0265316_10002957 Ga0265316_100029576 176
440 3300031507 Ga0307509_10000050 Ga0307509_1000005071 176
441 3300031595 Ga0265313_10000463 Ga0265313_1000046327 176
442 3300031595 Ga0265313_10001355 Ga0265313_1000135524 176
443 3300031616 Ga0307508_10012217 Ga0307508_100122176 176
444 3300031665 Ga0316575_10022396 Ga0316575_100223962 176
445 3300031665 Ga0316575_10042145 Ga0316575_100421453 176
446 3300031711 Ga0265314_10002804 Ga0265314_1000280427 176
447 3300031711 Ga0265314_10026291 Ga0265314_100262917 176
448 3300031712 Ga0265342_10000471 Ga0265342_1000047128 176
449 3300031727 Ga0316576_10165433 Ga0316576_101654332 176
450 3300031727 Ga0316576_10345156 Ga0316576_103451562 176
451 3300031733 Ga0316577_10103453 Ga0316577_101034531 176
452 3300031824 Ga0307413_10006103 Ga0307413_100061033 176
453 3300031852 Ga0307410_10045714 Ga0307410_100457143 176
454 3300031852 Ga0307410_10412820 Ga0307410_104128202 176
455 3300031903 Ga0307407_10018264 Ga0307407_100182643 176
456 3300031995 Ga0307409_100002915 Ga0307409_1000029152 176
457 3300031995 Ga0307409_101398764 Ga0307409_1013987642 176
458 3300032004 Ga0307414_10011674 Ga0307414_100116744 176
459 3300032005 Ga0307411_10056297 Ga0307411_100562976 176
460 3300032168 Ga0316593_10000033 Ga0316593_1000003327 176
461 3300032168 Ga0316593_10001049 Ga0316593_100010492 176
462 3300032168 Ga0316593_10047659 Ga0316593_100476591 176
463 3300032168 Ga0316593_10049598 Ga0316593_100495982 176
464 3300032168 Ga0316593_10108027 Ga0316593_101080272 176
465 3300033528 Ga0316588_1019197 Ga0316588_10191972 176
466 3300033528 Ga0316588_1020983 Ga0316588_10209832 176
467 3300033529 Ga0316587_1001803 Ga0316587_10018033 176
468 3300033529 Ga0316587_1005623 Ga0316587_10056233 176
469 3300033541 Ga0316596_1000070 Ga0316596_100007024 176
470 3300033541 Ga0316596_1000471 Ga0316596_100047110 176
471 3300033541 Ga0316596_1001049 Ga0316596_10010496 176
472 3300033541 Ga0316596_1014403 Ga0316596_10144033 176
473 3300033541 Ga0316596_1045135 Ga0316596_10451352 176
474 3300033541 Ga0316596_1082693 Ga0316596_10826932 176
475 3300035111 Ga0373923_0256444 Ga0373923_0256444_23_649 176
476 3300035112 Ga0373932_0063413 Ga0373932_0063413_246_872 176
477 3300035114 Ga0373939_0095790 Ga0373939_0095790_284_910 176
478 3300035116 Ga0373945_0105373 Ga0373945_0105373_444_1019 176
479 3300035120 Ga0373957_0212343 Ga0373957_0212343_80_706 176
480 3300035207 Ga0373942_0006705 Ga0373942_0006705_916_1542 176
481 3300035398 Ga0316574_0062077 Ga0316574_0062077_372_950 176
482 3300035398 Ga0316574_0063060 Ga0316574_0063060_801_1379 176
483 3300035398 Ga0316574_0223274 Ga0316574_0223274_506_1129 176
484 3300035691 Ga0373931_0029997 Ga0373931_0029997_1638_2264 176
485 3300035724 Ga0373933_0039894 Ga0373933_0039894_672_1301 176
486 3300036401 Ga0373937_0209616 Ga0373937_0209616_246_875 176
487 3300036401 Ga0373937_0297971 Ga0373937_0297971_175_750 176
488 3300036401 Ga0373937_0841925 Ga0373937_0841925_86_712 176
489 3300036647 Ga0316582_0152125 Ga0316582_0152125_421_999 176
490 3300036712 Ga0316584_0194342 Ga0316584_0194342_629_1207 176
491 3300036712 Ga0316584_0239538 Ga0316584_0239538_339_1016 176
492 3300037068 Ga0373925_0069352 Ga0373925_0069352_1455_2081 176
493 3300037471 Ga0395905_0025893 Ga0395905_0025893_2009_2638 176
494 3300038726 Ga0400490_35068 Ga0400490_35068_848_1429 176
495 3300039062 Ga0400483_077376 Ga0400483_077376_5510_6091 176
496 3300039062 Ga0400483_281776 Ga0400483_281776_241_822 176
497 3300039437 Ga0436365_1455176 Ga0436365_1455176_57_683 176
498 3300039447 Ga0436361_0585669 Ga0436361_0585669_48_677 176
499 3300039450 Ga0436363_0950845 Ga0436363_0950845_41_667 176
500 3300039450 Ga0436363_1686671 Ga0436363_1686671_605_1231 176
501 3300041413 Ga0439465_0061391 Ga0439465_0061391_198_824 176
502 3300042001 Ga0439441_007228 Ga0439441_007228_76_702 176
503 3300042122 Ga0450920_007791 Ga0450920_007791_152_778 176
504 3300042125 Ga0450923_003639 Ga0450923_003639_507_1133 176
505 3300042157 Ga0439458_0049336 Ga0439458_0049336_243_824 176
506 3300042437 Ga0439444_0032101 Ga0439444_0032101_195_773 176
507 3300042461 Ga0439460_0029385 Ga0439460_0029385_506_1132 176
508 3300042876 Ga0451577_0000328 Ga0451577_0000328_6330_6908 176
509 3300042876 Ga0451577_0002073 Ga0451577_0002073_10139_10717 176
510 3300042876 Ga0451577_0066183 Ga0451577_0066183_1738_2316 176
511 3300042876 Ga0451577_0117036 Ga0451577_0117036_423_1049 176
512 3300042876 Ga0451577_0122252 Ga0451577_0122252_1635_2213 176
513 3300042876 Ga0451577_0164499 Ga0451577_0164499_588_1214 176
514 3300042876 Ga0451577_0273405 Ga0451577_0273405_508_1086 176
515 3300042876 Ga0451577_0278907 Ga0451577_0278907_105_683 176
516 3300042876 Ga0451577_0392375 Ga0451577_0392375_445_1071 176
517 3300042876 Ga0451577_1143079 Ga0451577_1143079_101_679 176
518 3300042876 Ga0451577_1175054 Ga0451577_1175054_11_589 176
519 3300044673 Ga0453683_0000002 Ga0453683_0000002_893158_893736 176
520 3300044673 Ga0453683_0000114 Ga0453683_0000114_1779_2357 176
521 3300044673 Ga0453683_0000848 Ga0453683_0000848_15557_16135 176
522 3300044673 Ga0453683_0001684 Ga0453683_0001684_13197_13769 176
523 3300044673 Ga0453683_0004812 Ga0453683_0004812_2481_3059 176
524 3300044673 Ga0453683_0009861 Ga0453683_0009861_1946_2518 176
525 3300044673 Ga0453683_0026024 Ga0453683_0026024_3040_3618 176
526 3300044673 Ga0453683_0030691 Ga0453683_0030691_2670_3248 176
527 3300044673 Ga0453683_0036050 Ga0453683_0036050_115_741 176
528 3300044673 Ga0453683_0062279 Ga0453683_0062279_219_791 176
529 3300044673 Ga0453683_0073076 Ga0453683_0073076_85_711 176
530 3300044673 Ga0453683_0144403 Ga0453683_0144403_600_1190 176
531 3300044673 Ga0453683_0152393 Ga0453683_0152393_531_1103 176
532 3300044712 Ga0453684_0000258 Ga0453684_0000258_214544_215116 176
533 3300044712 Ga0453684_0000950 Ga0453684_0000950_13242_13820 176
534 3300044712 Ga0453684_0001302 Ga0453684_0001302_12874_13452 176
535 3300044712 Ga0453684_0005204 Ga0453684_0005204_4200_4778 176
536 3300044712 Ga0453684_0006508 Ga0453684_0006508_11964_12590 176
537 3300044712 Ga0453684_0013962 Ga0453684_0013962_11709_12335 176
538 3300044712 Ga0453684_0025015 Ga0453684_0025015_7149_7721 176
539 3300044712 Ga0453684_0028025 Ga0453684_0028025_6923_7501 176
540 3300044712 Ga0453684_0032497 Ga0453684_0032497_48_626 176
541 3300044712 Ga0453684_0037215 Ga0453684_0037215_3823_4401 176
542 3300044712 Ga0453684_0056552 Ga0453684_0056552_1160_1756 176
543 3300044712 Ga0453684_0086711 Ga0453684_0086711_2383_2955 176
544 3300044712 Ga0453684_0109000 Ga0453684_0109000_915_1568 176
545 3300044712 Ga0453684_0114376 Ga0453684_0114376_1966_2538 176
546 3300044712 Ga0453684_0311563 Ga0453684_0311563_808_1380 176
547 3300044712 Ga0453684_0420707 Ga0453684_0420707_442_1014 176
548 3300044712 Ga0453684_0560809 Ga0453684_0560809_239_817 176
549 3300044712 Ga0453684_0638349 Ga0453684_0638349_17_595 176
550 3300044712 Ga0453684_0695571 Ga0453684_0695571_314_892 176
551 3300044712 Ga0453684_1300595 Ga0453684_1300595_50_622 176
552 3300044712 Ga0453684_1542090 Ga0453684_1542090_47_625 176
553 3300045051 Ga0451576_0000151 Ga0451576_0000151_163040_163618 176
554 3300045051 Ga0451576_0005411 Ga0451576_0005411_10953_11525 176
555 3300045051 Ga0451576_0005912 Ga0451576_0005912_12851_13429 176
556 3300045051 Ga0451576_0017930 Ga0451576_0017930_3103_3675 176
557 3300045051 Ga0451576_0034109 Ga0451576_0034109_1768_2394 176
558 3300045051 Ga0451576_0042025 Ga0451576_0042025_3887_4465 176
559 3300045051 Ga0451576_0113003 Ga0451576_0113003_2060_2638 176
560 3300045051 Ga0451576_0136821 Ga0451576_0136821_1911_2489 176
561 3300045051 Ga0451576_0185581 Ga0451576_0185581_1185_1811 176
562 3300045051 Ga0451576_0216516 Ga0451576_0216516_397_1023 176
563 3300045051 Ga0451576_0256647 Ga0451576_0256647_1024_1620 176
564 3300045051 Ga0451576_0265670 Ga0451576_0265670_312_893 176
565 3300045051 Ga0451576_0340187 Ga0451576_0340187_797_1423 176
566 3300045051 Ga0451576_0401175 Ga0451576_0401175_373_1002 176
567 3300045051 Ga0451576_0405784 Ga0451576_0405784_221_799 176
568 3300045051 Ga0451576_0593372 Ga0451576_0593372_250_828 176
569 3300045051 Ga0451576_0595189 Ga0451576_0595189_70_642 176
570 3300045051 Ga0451576_0760977 Ga0451576_0760977_36_662 176
571 3300045051 Ga0451576_0841339 Ga0451576_0841339_208_780 176
572 3300045051 Ga0451576_0872744 Ga0451576_0872744_183_761 176
573 3300046454 Ga0495592_0063390 Ga0495592_0063390_1968_2543 176
574 3300046454 Ga0495592_0291642 Ga0495592_0291642_319_939 176
575 3300046462 Ga0495651_0191883 Ga0495651_0191883_209_784 176
576 3300046477 Ga0495664_0428339 Ga0495664_0428339_202_777 176
577 3300046501 Ga0495607_0147031 Ga0495607_0147031_115_690 176
578 3300046511 Ga0495608_0062545 Ga0495608_0062545_259_882 176
579 3300046514 Ga0495618_0171277 Ga0495618_0171277_449_1024 176
580 3300046516 Ga0495628_0008440 Ga0495628_0008440_6337_6963 176
581 3300046516 Ga0495628_0054682 Ga0495628_0054682_1649_2224 176
582 3300046517 Ga0495630_0115328 Ga0495630_0115328_676_1302 176
583 3300046529 Ga0495652_0282156 Ga0495652_0282156_593_1168 176
584 3300046533 Ga0495640_0298762 Ga0495640_0298762_152_727 176
585 3300046536 Ga0495587_0120882 Ga0495587_0120882_326_949 176
586 3300046559 Ga0495667_0069833 Ga0495667_0069833_1498_2073 176
587 3300046559 Ga0495667_0106590 Ga0495667_0106590_172_747 176
588 3300046642 Ga0495634_0367904 Ga0495634_0367904_44_667 176
589 3300046663 Ga0495635_0047399 Ga0495635_0047399_1622_2197 176
590 3300046675 Ga0495657_0289073 Ga0495657_0289073_217_840 176
591 3300046680 Ga0495646_0022367 Ga0495646_0022367_2775_3350 176
592 3300046689 Ga0495613_0435722 Ga0495613_0435722_200_826 176
593 3300046794 Ga0495589_0070097 Ga0495589_0070097_901_1521 176
594 3300046809 Ga0495600_0336936 Ga0495600_0336936_264_890 176
595 3300047315 Ga0495581_0053618 Ga0495581_0053618_562_1188 176
596 3300047317 Ga0495604_0156149 Ga0495604_0156149_218_793 176
597 3300047318 Ga0495636_0132596 Ga0495636_0132596_116_742 176
598 3300047319 Ga0495674_0063930 Ga0495674_0063930_130_753 176
599 3300047319 Ga0495674_0099683 Ga0495674_0099683_1461_2036 176
600 3300047321 Ga0495676_0196760 Ga0495676_0196760_257_883 176
601 3300047322 Ga0495680_0182420 Ga0495680_0182420_424_1047 176
602 3300047444 Ga0495675_0181396 Ga0495675_0181396_565_1188 176
603 3300047471 Ga0495684_0006263 Ga0495684_0006263_1715_2341 176
604 3300047471 Ga0495684_0122850 Ga0495684_0122850_1297_1872 176
605 3300048906 Ga0496103_0217202 Ga0496103_0217202_57_683 176
606 3300048907 Ga0496104_0001101 Ga0496104_0001101_10658_11233 176
607 3300048908 Ga0496105_0000654 Ga0496105_0000654_15218_15793 176
608 3300048909 Ga0496106_0151998 Ga0496106_0151998_412_1038 176
609 3300048909 Ga0496106_0209014 Ga0496106_0209014_396_1022 176
610 3300048912 Ga0496109_0496916 Ga0496109_0496916_311_886 176
611 3300048915 Ga0496112_0000007 Ga0496112_0000007_14328_14954 176
612 3300048915 Ga0496112_0108653 Ga0496112_0108653_154_780 176
613 3300048924 Ga0496121_0248562 Ga0496121_0248562_642_1223 176
614 3300049527 Ga0501311_005863 Ga0501311_005863_137_796 176
615 3300049527 Ga0501311_009241 Ga0501311_009241_69_647 176
616 3300049536 Ga0501320_001132 Ga0501320_001132_1149_1730 176
617 3300049539 Ga0501323_000262 Ga0501323_000262_1615_2196 176
618 3300049568 Ga0501031_0394991 Ga0501031_0394991_182_772 176
619 3300049570 Ga0501033_0903131 Ga0501033_0903131_12_584 176
620 3300049571 Ga0501034_0026488 Ga0501034_0026488_271_903 176
621 3300049572 Ga0501036_0145001 Ga0501036_0145001_23_613 176
622 3300049572 Ga0501036_0254258 Ga0501036_0254258_151_777 176
623 3300049576 Ga0501040_0003158 Ga0501040_0003158_5062_5652 176
624 3300049576 Ga0501040_0521808 Ga0501040_0521808_152_781 176
625 3300049577 Ga0501041_0029976 Ga0501041_0029976_579_1169 176
626 3300049578 Ga0501042_0044792 Ga0501042_0044792_2031_2621 176
627 3300049582 Ga0501048_0054255 Ga0501048_0054255_633_1223 176
628 3300049582 Ga0501048_0358599 Ga0501048_0358599_217_843 176
629 3300049583 Ga0501067_0062062 Ga0501067_0062062_852_1478 176
630 3300049587 Ga0501071_0093200 Ga0501071_0093200_1036_1662 176
631 3300049588 Ga0501072_0478457 Ga0501072_0478457_146_772 176
632 3300049590 Ga0501074_0002140 Ga0501074_0002140_926_1525 176
633 3300049590 Ga0501074_0145812 Ga0501074_0145812_742_1332 176
634 3300049591 Ga0501075_0080818 Ga0501075_0080818_1169_1819 176
635 3300049591 Ga0501075_0121937 Ga0501075_0121937_1110_1682 176
636 3300049591 Ga0501075_0195225 Ga0501075_0195225_195_821 176
637 3300049592 Ga0501076_0016433 Ga0501076_0016433_1396_2046 176
638 3300049592 Ga0501076_0050446 Ga0501076_0050446_1783_2373 176
639 3300049593 Ga0501077_0172558 Ga0501077_0172558_25_651 176
640 3300049593 Ga0501077_0220789 Ga0501077_0220789_460_1050 176
641 3300049675 Ga0501243_064064 Ga0501243_064064_69_647 176
642 3300049741 Ga0501079_0024440 Ga0501079_0024440_2551_3201 176
643 3300049741 Ga0501079_0037527 Ga0501079_0037527_1462_2052 176
644 3300049742 Ga0501080_0733663 Ga0501080_0733663_83_709 176
645 3300049743 Ga0501081_0019228 Ga0501081_0019228_2860_3450 176
646 3300049743 Ga0501081_0112025 Ga0501081_0112025_965_1555 176
647 3300049823 Ga0501044_0562273 Ga0501044_0562273_21_611 176
648 3300049823 Ga0501044_1087883 Ga0501044_1087883_81_653 176
649 3300049824 Ga0501045_0033905 Ga0501045_0033905_2545_3135 176
650 3300049824 Ga0501045_0745903 Ga0501045_0745903_49_675 176
651 3300050490 nmdc:mga03n38_158250_c1 nmdc:mga03n38_158250_c1_443_1072 176
652 3300050507 nmdc:mga05p37_255382_c1 nmdc:mga05p37_255382_c1_28_654 176
653 3300050507 nmdc:mga05p37_33875_c1 nmdc:mga05p37_33875_c1_3717_4343 176
654 3300050507 nmdc:mga05p37_446689_c1 nmdc:mga05p37_446689_c1_413_1006 176
655 3300050507 nmdc:mga05p37_59933_c1 nmdc:mga05p37_59933_c1_2704_3294 176
656 3300050507 nmdc:mga05p37_66573_c1 nmdc:mga05p37_66573_c1_3709_4290 176
657 3300050507 nmdc:mga05p37_67990_c1 nmdc:mga05p37_67990_c1_3736_4362 176
658 3300050507 nmdc:mga05p37_896465_c1 nmdc:mga05p37_896465_c1_116_706 176
659 3300050508 nmdc:mga09592_318183_c1 nmdc:mga09592_318183_c1_684_1310 176
660 3300050508 nmdc:mga09592_319870_c1 nmdc:mga09592_319870_c1_222_848 176
661 3300050508 nmdc:mga09592_473295_c1 nmdc:mga09592_473295_c1_349_921 176
662 3300050508 nmdc:mga09592_817203_c1 nmdc:mga09592_817203_c1_79_660 176
663 3300050509 nmdc:mga0qj67_11591_c1 nmdc:mga0qj67_11591_c1_2701_3279 176
664 3300050509 nmdc:mga0qj67_348205_c1 nmdc:mga0qj67_348205_c1_226_798 176
665 3300050509 nmdc:mga0qj67_923306_c1 nmdc:mga0qj67_923306_c1_49_675 176
666 3300050510 nmdc:mga06r32_29887_c1 nmdc:mga06r32_29887_c1_2617_3195 176
667 3300050510 nmdc:mga06r32_381682_c1 nmdc:mga06r32_381682_c1_176_802 176
668 3300050510 nmdc:mga06r32_691002_c1 nmdc:mga06r32_691002_c1_100_726 176
669 3300050511 nmdc:mga08y16_18218_c1 nmdc:mga08y16_18218_c1_3244_3870 176
670 3300050511 nmdc:mga08y16_201649_c1 nmdc:mga08y16_201649_c1_1111_1692 176
671 3300050511 nmdc:mga08y16_328203_c1 nmdc:mga08y16_328203_c1_51_677 176
672 3300050511 nmdc:mga08y16_407706_c1 nmdc:mga08y16_407706_c1_640_1266 176
673 3300050511 nmdc:mga08y16_863142_c1 nmdc:mga08y16_863142_c1_195_788 176
674 3300050512 nmdc:mga0n895_1032586_c1 nmdc:mga0n895_1032586_c1_10_600 176
675 3300050512 nmdc:mga0n895_186749_c1 nmdc:mga0n895_186749_c1_799_1425 176
676 3300050512 nmdc:mga0n895_25782_c1 nmdc:mga0n895_25782_c1_4558_5139 176
677 3300050512 nmdc:mga0n895_396768_c1 nmdc:mga0n895_396768_c1_554_1180 176
678 3300050512 nmdc:mga0n895_833860_c1 nmdc:mga0n895_833860_c1_88_714 176
679 3300050513 nmdc:mga0rr50_199265_c1 nmdc:mga0rr50_199265_c1_834_1460 176
680 3300050513 nmdc:mga0rr50_346720_c1 nmdc:mga0rr50_346720_c1_181_762 176
681 3300050513 nmdc:mga0rr50_95662_c1 nmdc:mga0rr50_95662_c1_1069_1662 176
682 3300050514 nmdc:mga08x19_17_c1 nmdc:mga08x19_17_c1_23674_24264 176
683 3300050514 nmdc:mga08x19_830508_c1 nmdc:mga08x19_830508_c1_11_637 176
684 3300050515 nmdc:mga0a205_1228_c1 nmdc:mga0a205_1228_c1_11280_11861 176
685 3300050515 nmdc:mga0a205_195238_c1 nmdc:mga0a205_195238_c1_189_779 176
686 3300050515 nmdc:mga0a205_198386_c1 nmdc:mga0a205_198386_c1_1028_1618 176
687 3300050515 nmdc:mga0a205_25790_c3 nmdc:mga0a205_25790_c3_360_953 176
688 3300050515 nmdc:mga0a205_29399_c1 nmdc:mga0a205_29399_c1_1563_2189 176
689 3300050515 nmdc:mga0a205_386433_c1 nmdc:mga0a205_386433_c1_430_1020 176
690 3300050515 nmdc:mga0a205_542325_c1 nmdc:mga0a205_542325_c1_425_1006 176
691 3300050515 nmdc:mga0a205_89147_c1 nmdc:mga0a205_89147_c1_83_709 176
692 3300053085 Ga0495619_0220317 Ga0495619_0220317_512_1087 176
693 3300053153 Ga0500616_0063131 Ga0500616_0063131_89_715 176
694 3300054114 Ga0501084_0000461 Ga0501084_0000461_6068_6697 176
695 3300054114 Ga0501084_0083056 Ga0501084_0083056_275_865 176
696 3300054114 Ga0501084_0399402 Ga0501084_0399402_140_766 176
697 3300054114 Ga0501084_0916333 Ga0501084_0916333_120_713 176
698 3300059477 Ga0587084_035876 Ga0587084_035876_61_690 176
699 3300059505 Ga0587083_0004115 Ga0587083_0004115_1193_1822 176
700 3300059506 Ga0587085_015328 Ga0587085_015328_413_1039 176
701 3300059508 Ga0587088_048261 Ga0587088_048261_170_796 176
702 3300059511 Ga0587091_076436 Ga0587091_076436_96_725 176
703 3300059639 Ga0587062_017757 Ga0587062_017757_93_713 176
704 3300060353 Ga0501082_0061445 Ga0501082_0061445_1755_2345 176
705 3300060353 Ga0501082_0123778 Ga0501082_0123778_1272_1922 176
706 3300061719 Ga0466962_0134911 Ga0466962_0134911_511_1083 176
707 3300061734 Ga0530510_0015081 Ga0530510_0015081_2515_3087 176
708 3300061734 Ga0530510_0056387 Ga0530510_0056387_1557_2183 176
709 3300061734 Ga0530510_0060067 Ga0530510_0060067_1702_2292 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

128

175

0.99

PF00163

Ribosomal_S4

Ribosomal protein S4/S9 N-terminal domain

32

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.968 23 121
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9581 18 176
7p48-assembly1.cif.gz_d staphylococcus aureus ribosome in complex with sal(b) 0.9529 17 176
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.9522 18 176
6yef-assembly1.cif.gz_d 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9479 17 176
ID Description Score Start End Superfamily
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9898 67 110 3.10.290.10
af_P02355_88_184_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9772 67 161 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9694 67 117 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9515 67 117 3.10.290.10
af_P02355_88_184_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9478 67 161 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A7V9VR11-F1-model_v4 deleted 0.9807 36 176
AF-A0A838N3C0-F1-model_v4 Small ribosomal subunit protein uS4 0.9795 34 176 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A4P5YPR9-F1-model_v4 Small ribosomal subunit protein uS4 0.9757 26 176 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274
AF-A0A7V9VR11-F1-model_v4 deleted 0.9739 36 176
AF-A0A6N6P898-F1-model_v4 Small ribosomal subunit protein uS4 0.9738 21 176 GO:0003735
GO:0006412
GO:0015935
GO:0019843
GO:0042274

Feature Viewer

pLDDT pTM Quality
90.17 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map