F476412
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 705 | 393 | 645 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0366702|Ga0395899_0366702_261_833 |
| Length | 190 |
| Sequence | LVSLPYDLAMTTRVPDAGWRLTHLGRLLGHAARRFDERVLELMAHDIEVPLALANLAARGQVSAAHVHITRHVALEGSRLTDLARQAGMTKQAMGDLVDQCEAWGLVTRDPDPRDARGRVVRFTPAGLAWLQAFKDAVAQAETEFRQEVGDEVATVVQLGLEAYAGAWGAAPEGASRRKPTPTMNSRRGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 14 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 15 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 16 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 17 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 18 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 19 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 20 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 21 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 22 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 23 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 24 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 25 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 26 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 27 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 28 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 29 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 30 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 31 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 32 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 33 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 34 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 35 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 36 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 37 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 38 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 39 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 40 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 41 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 42 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 43 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 44 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 45 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 46 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 47 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 48 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 49 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 50 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 51 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 52 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 53 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 54 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 55 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 56 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 57 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 58 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 59 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 60 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 61 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 62 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 65 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 66 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 77 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 96 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 106 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 127 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 128 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 200 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 201 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 202 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 203 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 204 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 205 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 206 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 215 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 238 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 239 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 240 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 248 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 249 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 250 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 251 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 252 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 253 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 254 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 255 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 256 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 257 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 258 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 259 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 260 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 261 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 262 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 263 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 264 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 265 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 266 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 267 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 268 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 269 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 270 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 271 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 272 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 273 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 274 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 275 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 276 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 277 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 278 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 285 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 294 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 340 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 341 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 342 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 345 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 373 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 374 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 376 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 379 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 392 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.92 |
| Metatranscriptomes | 0.57 |
| Isolates | 8.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.11 |
| Nodule | 0.71 |
| Rhizoplane | 2.7 |
| Rhizosphere | 58.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10019155 | 3300001989 | Bacteria | 2453 |
| 2 | JGI25159J45721_1046946 | 3300002987 | Bacteria | 605 |
| 3 | JGI25151J46595_10034863 | 3300003187 | Bacteria | 1918 |
| 4 | rootH1_10010984 | 3300003316 | Bacteria | 1666 |
| 5 | Ga0006562J51391_1036397 | 3300003578 | Bacteria | 6670 |
| 6 | Ga0006562J51391_1036398 | 3300003578 | Bacteria | 5370 |
| 7 | Ga0006562J51391_1042796 | 3300003578 | Bacteria | 1085 |
| 8 | Ga0006562J51391_1042797 | 3300003578 | Bacteria | 3240 |
| 9 | Ga0055527_1009905 | 3300003760 | Bacteria | 1108 |
| 10 | Ga0055535_1000185 | 3300003761 | Bacteria | 66514 |
| 11 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 12 | Ga0055536_1014588 | 3300003781 | Bacteria | 2744 |
| 13 | Ga0055534_1001656 | 3300003784 | Bacteria | 8585 |
| 14 | Ga0055534_1008870 | 3300003784 | Bacteria | 2235 |
| 15 | Ga0055534_1016875 | 3300003784 | Bacteria | 1301 |
| 16 | Ga0055528_1033773 | 3300003790 | Bacteria | 1274 |
| 17 | Ga0055530_10021074 | 3300003791 | Bacteria | 1930 |
| 18 | Ga0055540_1006578 | 3300003792 | Bacteria | 4578 |
| 19 | Ga0055540_1008854 | 3300003792 | Bacteria | 3566 |
| 20 | Ga0055540_1019512 | 3300003792 | Bacteria | 1822 |
| 21 | Ga0055531_10001518 | 3300003794 | Bacteria | 17029 |
| 22 | Ga0055531_10027994 | 3300003794 | Bacteria | 1957 |
| 23 | Ga0055531_10029498 | 3300003794 | Bacteria | 1867 |
| 24 | Ga0065714_10004635 | 3300005288 | Bacteria | 4640 |
| 25 | Ga0065704_10084500 | 3300005289 | Bacteria | 3328 |
| 26 | Ga0070676_10347716 | 3300005328 | Bacteria | 1018 |
| 27 | Ga0070670_100077256 | 3300005331 | Bacteria | 2861 |
| 28 | Ga0070677_10610832 | 3300005333 | Bacteria | 605 |
| 29 | Ga0068869_100254596 | 3300005334 | Bacteria | 1403 |
| 30 | Ga0070680_100058388 | 3300005336 | Bacteria | 3155 |
| 31 | Ga0070680_100330402 | 3300005336 | Bacteria | 1295 |
| 32 | Ga0070660_100131245 | 3300005339 | Bacteria | 2005 |
| 33 | Ga0070668_100153959 | 3300005347 | Bacteria | 1861 |
| 34 | Ga0070669_100187802 | 3300005353 | Bacteria | 1620 |
| 35 | Ga0070675_100781420 | 3300005354 | Bacteria | 872 |
| 36 | Ga0070674_100287507 | 3300005356 | Bacteria | 1306 |
| 37 | Ga0070659_100232218 | 3300005366 | Bacteria | 1525 |
| 38 | Ga0070667_100316065 | 3300005367 | Bacteria | 1409 |
| 39 | Ga0070714_100588153 | 3300005435 | Bacteria | 1068 |
| 40 | Ga0070662_100054362 | 3300005457 | Bacteria | 2901 |
| 41 | Ga0068867_100381124 | 3300005459 | Bacteria | 1184 |
| 42 | Ga0068867_100742868 | 3300005459 | Bacteria | 870 |
| 43 | Ga0070679_100045747 | 3300005530 | Bacteria | 4361 |
| 44 | Ga0070679_100084028 | 3300005530 | Bacteria | 3172 |
| 45 | Ga0068853_100257720 | 3300005539 | Bacteria | 1602 |
| 46 | Ga0070665_100198421 | 3300005548 | Bacteria | 2007 |
| 47 | Ga0070665_100476381 | 3300005548 | Bacteria | 1259 |
| 48 | Ga0070665_100684529 | 3300005548 | Bacteria | 1038 |
| 49 | Ga0070665_100727244 | 3300005548 | Bacteria | 1006 |
| 50 | Ga0068855_100300509 | 3300005563 | Bacteria | 1777 |
| 51 | Ga0070664_100009654 | 3300005564 | Bacteria | 7828 |
| 52 | Ga0068854_100105296 | 3300005578 | Bacteria | 2120 |
| 53 | Ga0068852_100400241 | 3300005616 | Bacteria | 1350 |
| 54 | Ga0068852_100591218 | 3300005616 | Bacteria | 1113 |
| 55 | Ga0068852_100676482 | 3300005616 | Bacteria | 1041 |
| 56 | Ga0068852_101595441 | 3300005616 | Bacteria | 675 |
| 57 | Ga0068864_100100952 | 3300005618 | Bacteria | 2559 |
| 58 | Ga0068864_100471246 | 3300005618 | Bacteria | 1204 |
| 59 | Ga0068861_101220120 | 3300005719 | Bacteria | 728 |
| 60 | Ga0068851_10002203 | 3300005834 | Bacteria | 8569 |
| 61 | Ga0068863_100040189 | 3300005841 | Bacteria | 4448 |
| 62 | Ga0068862_100140296 | 3300005844 | Bacteria | 2145 |
| 63 | Ga0075365_10006832 | 3300006038 | Bacteria | 6325 |
| 64 | Ga0075365_10122938 | 3300006038 | Bacteria | 1792 |
| 65 | Ga0075363_100085120 | 3300006048 | Bacteria | 1734 |
| 66 | Ga0075363_100098472 | 3300006048 | Bacteria | 1616 |
| 67 | Ga0075363_100392777 | 3300006048 | Bacteria | 814 |
| 68 | Ga0075363_100605577 | 3300006048 | Bacteria | 657 |
| 69 | Ga0075364_10668030 | 3300006051 | Bacteria | 709 |
| 70 | Ga0075362_10012458 | 3300006177 | Bacteria | 3379 |
| 71 | Ga0075362_10027962 | 3300006177 | Bacteria | 2418 |
| 72 | Ga0075362_10048119 | 3300006177 | Bacteria | 1901 |
| 73 | Ga0075362_10268775 | 3300006177 | Bacteria | 841 |
| 74 | Ga0075362_10334849 | 3300006177 | Bacteria | 755 |
| 75 | Ga0075367_10075113 | 3300006178 | Bacteria | 2038 |
| 76 | Ga0075367_10304368 | 3300006178 | Bacteria | 1004 |
| 77 | Ga0075369_10072866 | 3300006186 | Bacteria | 1514 |
| 78 | Ga0075366_10012228 | 3300006195 | Bacteria | 4866 |
| 79 | Ga0075366_10013797 | 3300006195 | Bacteria | 4606 |
| 80 | Ga0075366_10169783 | 3300006195 | Bacteria | 1323 |
| 81 | Ga0075366_10199836 | 3300006195 | Bacteria | 1216 |
| 82 | Ga0075366_10453407 | 3300006195 | Bacteria | 791 |
| 83 | Ga0075366_10490251 | 3300006195 | Bacteria | 759 |
| 84 | Ga0075366_10498901 | 3300006195 | Bacteria | 752 |
| 85 | Ga0075370_10004750 | 3300006353 | Bacteria | 6645 |
| 86 | Ga0075370_10042241 | 3300006353 | Bacteria | 2576 |
| 87 | Ga0075370_10085117 | 3300006353 | Bacteria | 1820 |
| 88 | Ga0075370_10109614 | 3300006353 | Bacteria | 1602 |
| 89 | Ga0075370_10172051 | 3300006353 | Bacteria | 1273 |
| 90 | Ga0075370_10290068 | 3300006353 | Bacteria | 972 |
| 91 | Ga0075370_10325611 | 3300006353 | Bacteria | 916 |
| 92 | Ga0075370_10412621 | 3300006353 | Bacteria | 811 |
| 93 | Ga0075370_10424483 | 3300006353 | Bacteria | 799 |
| 94 | Ga0075370_10432189 | 3300006353 | Bacteria | 791 |
| 95 | Ga0075370_10438553 | 3300006353 | Bacteria | 785 |
| 96 | Ga0075370_10470517 | 3300006353 | Bacteria | 757 |
| 97 | Ga0075370_10491070 | 3300006353 | Bacteria | 740 |
| 98 | Ga0068871_100457443 | 3300006358 | Bacteria | 1145 |
| 99 | Ga0075430_100037061 | 3300006846 | Bacteria | 4133 |
| 100 | Ga0079104_1000027 | 3300006946 | Bacteria | 212641 |
| 101 | Ga0099826_10024823 | 3300006948 | Bacteria | 4450 |
| 102 | Ga0105244_10021367 | 3300009036 | Bacteria | 3580 |
| 103 | Ga0105250_10000066 | 3300009092 | Bacteria | 100012 |
| 104 | Ga0105240_10044773 | 3300009093 | Bacteria | 5619 |
| 105 | Ga0105240_10866582 | 3300009093 | Bacteria | 974 |
| 106 | Ga0105243_10006239 | 3300009148 | Bacteria | 9212 |
| 107 | Ga0105243_10031178 | 3300009148 | Bacteria | 4109 |
| 108 | Ga0105243_10734063 | 3300009148 | Bacteria | 966 |
| 109 | Ga0105242_10000434 | 3300009176 | Bacteria | 33374 |
| 110 | Ga0105242_10234151 | 3300009176 | Bacteria | 1647 |
| 111 | Ga0105248_11147409 | 3300009177 | Bacteria | 878 |
| 112 | Ga0105237_10097372 | 3300009545 | Bacteria | 2932 |
| 113 | Ga0105238_10372500 | 3300009551 | Bacteria | 1418 |
| 114 | Ga0105238_10461287 | 3300009551 | Bacteria | 1268 |
| 115 | Ga0105238_10726325 | 3300009551 | Bacteria | 1006 |
| 116 | Ga0105238_11687689 | 3300009551 | Bacteria | 664 |
| 117 | Ga0105239_10778653 | 3300010375 | Bacteria | 1096 |
| 118 | Ga0105239_11150057 | 3300010375 | Bacteria | 894 |
| 119 | Ga0105246_10135775 | 3300011119 | Bacteria | 1843 |
| 120 | Ga0105246_10204304 | 3300011119 | Bacteria | 1538 |
| 121 | Ga0105246_10306065 | 3300011119 | Bacteria | 1285 |
| 122 | Ga0157322_1013657 | 3300012490 | Bacteria | 700 |
| 123 | Ga0157347_1001667 | 3300012502 | Bacteria | 1788 |
| 124 | Ga0157347_1004962 | 3300012502 | Bacteria | 1255 |
| 125 | Ga0157347_1028748 | 3300012502 | Bacteria | 687 |
| 126 | Ga0157339_1000815 | 3300012505 | Bacteria | 1716 |
| 127 | Ga0157373_10022558 | 3300013100 | Bacteria | 4566 |
| 128 | Ga0157373_10184960 | 3300013100 | Bacteria | 1468 |
| 129 | Ga0157371_10030125 | 3300013102 | Bacteria | 3916 |
| 130 | Ga0157370_10023750 | 3300013104 | Bacteria | 6084 |
| 131 | Ga0157370_10176975 | 3300013104 | Bacteria | 1983 |
| 132 | Ga0157370_10456404 | 3300013104 | Bacteria | 1175 |
| 133 | Ga0157369_10094259 | 3300013105 | Bacteria | 3196 |
| 134 | Ga0157378_10692548 | 3300013297 | Bacteria | 1038 |
| 135 | Ga0157378_11855496 | 3300013297 | Bacteria | 651 |
| 136 | Ga0163162_10314310 | 3300013306 | Bacteria | 1699 |
| 137 | Ga0163162_10546576 | 3300013306 | Bacteria | 1287 |
| 138 | Ga0157372_12072851 | 3300013307 | Bacteria | 654 |
| 139 | Ga0157375_10636985 | 3300013308 | Bacteria | 1223 |
| 140 | Ga0157375_10834797 | 3300013308 | Bacteria | 1069 |
| 141 | Ga0182008_10000678 | 3300014497 | Bacteria | 24604 |
| 142 | Ga0182008_10013895 | 3300014497 | Bacteria | 4226 |
| 143 | Ga0182008_10016633 | 3300014497 | Bacteria | 3820 |
| 144 | Ga0182008_10153357 | 3300014497 | Bacteria | 1156 |
| 145 | Ga0182008_10247719 | 3300014497 | Bacteria | 918 |
| 146 | Ga0157376_11012115 | 3300014969 | Bacteria | 854 |
| 147 | Ga0182006_1004961 | 3300015261 | Bacteria | 6427 |
| 148 | Ga0182006_1046371 | 3300015261 | Bacteria | 1688 |
| 149 | Ga0182006_1168623 | 3300015261 | Bacteria | 734 |
| 150 | Ga0182007_10005210 | 3300015262 | Bacteria | 5745 |
| 151 | Ga0182007_10016821 | 3300015262 | Bacteria | 2688 |
| 152 | Ga0182007_10133678 | 3300015262 | Bacteria | 836 |
| 153 | Ga0163161_10004734 | 3300017792 | Bacteria | 9464 |
| 154 | Ga0163161_10039115 | 3300017792 | Bacteria | 3403 |
| 155 | Ga0163161_10071218 | 3300017792 | Bacteria | 2543 |
| 156 | Ga0163161_10261274 | 3300017792 | Bacteria | 1352 |
| 157 | Ga0163161_10494540 | 3300017792 | Bacteria | 995 |
| 158 | Ga0163161_10918413 | 3300017792 | Bacteria | 743 |
| 159 | Ga0213872_10006498 | 3300021361 | Bacteria | 5857 |
| 160 | Ga0209672_100279 | 3300025228 | Bacteria | 37019 |
| 161 | Ga0209147_101464 | 3300025229 | Bacteria | 8476 |
| 162 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 163 | Ga0207425_1010199 | 3300025245 | Bacteria | 2298 |
| 164 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 165 | Ga0209129_1000160 | 3300025258 | Bacteria | 102457 |
| 166 | Ga0209129_1021955 | 3300025258 | Bacteria | 1160 |
| 167 | Ga0209129_1025122 | 3300025258 | Bacteria | 1041 |
| 168 | Ga0209565_1000236 | 3300025263 | Bacteria | 60311 |
| 169 | Ga0209565_1000762 | 3300025263 | Bacteria | 18882 |
| 170 | Ga0209565_1002449 | 3300025263 | Bacteria | 6684 |
| 171 | Ga0209673_1000286 | 3300025273 | Bacteria | 94581 |
| 172 | Ga0209673_1000556 | 3300025273 | Bacteria | 59978 |
| 173 | Ga0209673_1010331 | 3300025273 | Bacteria | 3942 |
| 174 | Ga0209673_1049559 | 3300025273 | Bacteria | 1122 |
| 175 | Ga0209130_1000760 | 3300025284 | Bacteria | 27940 |
| 176 | Ga0209130_1001309 | 3300025284 | Bacteria | 17028 |
| 177 | Ga0209130_1006552 | 3300025284 | Bacteria | 3762 |
| 178 | Ga0209675_1000987 | 3300025291 | Bacteria | 18009 |
| 179 | Ga0209675_1001227 | 3300025291 | Bacteria | 15467 |
| 180 | Ga0209675_1001556 | 3300025291 | Bacteria | 13030 |
| 181 | Ga0209675_1029576 | 3300025291 | Bacteria | 1317 |
| 182 | Ga0209676_1000074 | 3300025292 | Bacteria | 305770 |
| 183 | Ga0209676_1000660 | 3300025292 | Bacteria | 49420 |
| 184 | Ga0209676_1007069 | 3300025292 | Bacteria | 5377 |
| 185 | Ga0209676_1009793 | 3300025292 | Bacteria | 4082 |
| 186 | Ga0209676_1024158 | 3300025292 | Bacteria | 1975 |
| 187 | Ga0209676_1049399 | 3300025292 | Bacteria | 1117 |
| 188 | Ga0209025_1000269 | 3300025294 | Bacteria | 121642 |
| 189 | Ga0209025_1000349 | 3300025294 | Bacteria | 100055 |
| 190 | Ga0209025_1000846 | 3300025294 | Bacteria | 48468 |
| 191 | Ga0209025_1015579 | 3300025294 | Bacteria | 4567 |
| 192 | Ga0209564_1000294 | 3300025295 | Bacteria | 100958 |
| 193 | Ga0209564_1001177 | 3300025295 | Bacteria | 30362 |
| 194 | Ga0209758_1000039 | 3300025297 | Bacteria | 428951 |
| 195 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 196 | Ga0209050_1008576 | 3300025298 | Bacteria | 5420 |
| 197 | Ga0209256_1000136 | 3300025299 | Bacteria | 159047 |
| 198 | Ga0209256_1000230 | 3300025299 | Bacteria | 100958 |
| 199 | Ga0207426_1000108 | 3300025302 | Bacteria | 242257 |
| 200 | Ga0207426_1000130 | 3300025302 | Bacteria | 210271 |
| 201 | Ga0207426_1001644 | 3300025302 | Bacteria | 17444 |
| 202 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 203 | Ga0209051_1000508 | 3300025303 | Bacteria | 49345 |
| 204 | Ga0209051_1001982 | 3300025303 | Bacteria | 15729 |
| 205 | Ga0209051_1006199 | 3300025303 | Bacteria | 6780 |
| 206 | Ga0209051_1006759 | 3300025303 | Bacteria | 6400 |
| 207 | Ga0209051_1007004 | 3300025303 | Bacteria | 6247 |
| 208 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 209 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 210 | Ga0209257_1000582 | 3300025304 | Bacteria | 61499 |
| 211 | Ga0209257_1016051 | 3300025304 | Bacteria | 3058 |
| 212 | Ga0207656_10006596 | 3300025321 | Bacteria | 4186 |
| 213 | Ga0207655_1030413 | 3300025728 | Bacteria | 2511 |
| 214 | Ga0207688_10297728 | 3300025901 | Bacteria | 986 |
| 215 | Ga0207645_10172775 | 3300025907 | Bacteria | 1417 |
| 216 | Ga0207705_10091665 | 3300025909 | Bacteria | 2226 |
| 217 | Ga0207695_10046357 | 3300025913 | Bacteria | 4608 |
| 218 | Ga0207695_10156165 | 3300025913 | Bacteria | 2216 |
| 219 | Ga0207671_10124182 | 3300025914 | Bacteria | 1976 |
| 220 | Ga0207657_10115072 | 3300025919 | Bacteria | 2217 |
| 221 | Ga0207652_10029413 | 3300025921 | Bacteria | 4593 |
| 222 | Ga0207652_10067117 | 3300025921 | Bacteria | 3110 |
| 223 | Ga0207681_10147296 | 3300025923 | Bacteria | 1760 |
| 224 | Ga0207694_10532113 | 3300025924 | Bacteria | 985 |
| 225 | Ga0207694_10845533 | 3300025924 | Bacteria | 773 |
| 226 | Ga0207690_10311350 | 3300025932 | Bacteria | 1235 |
| 227 | Ga0207690_10479976 | 3300025932 | Bacteria | 1003 |
| 228 | Ga0207706_10006769 | 3300025933 | Bacteria | 10596 |
| 229 | Ga0207686_10000514 | 3300025934 | Bacteria | 25109 |
| 230 | Ga0207709_10000196 | 3300025935 | Bacteria | 80952 |
| 231 | Ga0207709_10001898 | 3300025935 | Bacteria | 13785 |
| 232 | Ga0207669_10217354 | 3300025937 | Bacteria | 1400 |
| 233 | Ga0207669_10495096 | 3300025937 | Bacteria | 977 |
| 234 | Ga0207691_10124859 | 3300025940 | Bacteria | 2278 |
| 235 | Ga0207691_11057825 | 3300025940 | Bacteria | 676 |
| 236 | Ga0207679_10010437 | 3300025945 | Bacteria | 5981 |
| 237 | Ga0207667_10079242 | 3300025949 | Bacteria | 3404 |
| 238 | Ga0207667_10312346 | 3300025949 | Bacteria | 1605 |
| 239 | Ga0207667_10382272 | 3300025949 | Bacteria | 1434 |
| 240 | Ga0207651_10522677 | 3300025960 | Bacteria | 1029 |
| 241 | Ga0207668_10438309 | 3300025972 | Bacteria | 1112 |
| 242 | Ga0207640_10112498 | 3300025981 | Bacteria | 1933 |
| 243 | Ga0207640_10535080 | 3300025981 | Bacteria | 982 |
| 244 | Ga0207658_10080539 | 3300025986 | Bacteria | 2494 |
| 245 | Ga0207658_10978435 | 3300025986 | Bacteria | 772 |
| 246 | Ga0207677_10689201 | 3300026023 | Bacteria | 905 |
| 247 | Ga0207639_10507779 | 3300026041 | Bacteria | 1102 |
| 248 | Ga0207639_10914176 | 3300026041 | Bacteria | 820 |
| 249 | Ga0207641_10046119 | 3300026088 | Bacteria | 3673 |
| 250 | Ga0207648_10249653 | 3300026089 | Bacteria | 1582 |
| 251 | Ga0207648_10327190 | 3300026089 | Bacteria | 1378 |
| 252 | Ga0207676_10374011 | 3300026095 | Bacteria | 1324 |
| 253 | Ga0207674_10620974 | 3300026116 | Bacteria | 1044 |
| 254 | Ga0207683_10013814 | 3300026121 | Bacteria | 6885 |
| 255 | Ga0207698_10606857 | 3300026142 | Bacteria | 1079 |
| 256 | Ga0207698_10857888 | 3300026142 | Bacteria | 913 |
| 257 | Ga0207698_11851123 | 3300026142 | Bacteria | 618 |
| 258 | Ga0209282_1014933 | 3300027666 | Bacteria | 4946 |
| 259 | Ga0209974_10028637 | 3300027876 | Bacteria | 1845 |
| 260 | Ga0268266_10506274 | 3300028379 | Bacteria | 1153 |
| 261 | Ga0268266_10707712 | 3300028379 | Bacteria | 971 |
| 262 | Ga0268266_11226052 | 3300028379 | Bacteria | 725 |
| 263 | Ga0268266_11529798 | 3300028379 | Bacteria | 643 |
| 264 | Ga0268265_10032859 | 3300028380 | Bacteria | 3765 |
| 265 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 266 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 267 | Ga0307515_10000222 | 3300028794 | Bacteria | 140902 |
| 268 | Ga0307515_10001166 | 3300028794 | Bacteria | 60153 |
| 269 | Ga0307515_10019026 | 3300028794 | Bacteria | 12392 |
| 270 | Ga0307515_10367645 | 3300028794 | Bacteria | 1076 |
| 271 | Ga0307512_10052380 | 3300030522 | Bacteria | 3255 |
| 272 | Ga0307512_10144232 | 3300030522 | Bacteria | 1446 |
| 273 | Ga0316177_1160851 | 3300030731 | Bacteria | 978 |
| 274 | Ga0314311_1136520 | 3300030733 | Bacteria | 2391 |
| 275 | Ga0316179_1021038 | 3300030734 | Bacteria | 4613 |
| 276 | Ga0316178_1049500 | 3300030735 | Bacteria | 5544 |
| 277 | Ga0316180_1114921 | 3300030736 | Bacteria | 3130 |
| 278 | Ga0316180_1124794 | 3300030736 | Bacteria | 706 |
| 279 | Ga0316183_1095156 | 3300030742 | Bacteria | 2315 |
| 280 | Ga0316181_1044905 | 3300030744 | Bacteria | 1242 |
| 281 | Ga0316182_1067661 | 3300030745 | Bacteria | 3539 |
| 282 | Ga0265330_10036383 | 3300031235 | Bacteria | 2195 |
| 283 | Ga0265332_10016400 | 3300031238 | Bacteria | 3268 |
| 284 | Ga0265331_10024909 | 3300031250 | Bacteria | 3023 |
| 285 | Ga0265327_10281719 | 3300031251 | Bacteria | 734 |
| 286 | Ga0307513_10030880 | 3300031456 | Bacteria | 6078 |
| 287 | Ga0307513_10240433 | 3300031456 | Bacteria | 1616 |
| 288 | Ga0307513_10282848 | 3300031456 | Bacteria | 1435 |
| 289 | Ga0307513_10569827 | 3300031456 | Bacteria | 843 |
| 290 | Ga0307513_10718889 | 3300031456 | Bacteria | 704 |
| 291 | Ga0307509_10027035 | 3300031507 | Bacteria | 6389 |
| 292 | Ga0307408_100001559 | 3300031548 | Bacteria | 16942 |
| 293 | Ga0307408_100253553 | 3300031548 | Bacteria | 1452 |
| 294 | Ga0307408_100497447 | 3300031548 | Bacteria | 1066 |
| 295 | Ga0307408_100674336 | 3300031548 | Bacteria | 927 |
| 296 | Ga0307408_101145858 | 3300031548 | Bacteria | 723 |
| 297 | Ga0307508_10000122 | 3300031616 | Bacteria | 92612 |
| 298 | Ga0307514_10004149 | 3300031649 | Bacteria | 13427 |
| 299 | Ga0307514_10006235 | 3300031649 | Bacteria | 10443 |
| 300 | Ga0307514_10046039 | 3300031649 | Bacteria | 3409 |
| 301 | Ga0265314_10003183 | 3300031711 | Bacteria | 16071 |
| 302 | Ga0307516_10005879 | 3300031730 | Bacteria | 14519 |
| 303 | Ga0307405_10175874 | 3300031731 | Bacteria | 1531 |
| 304 | Ga0307405_10253973 | 3300031731 | Bacteria | 1309 |
| 305 | Ga0307405_10342983 | 3300031731 | Bacteria | 1149 |
| 306 | Ga0307405_10521143 | 3300031731 | Bacteria | 956 |
| 307 | Ga0307405_10643483 | 3300031731 | Bacteria | 871 |
| 308 | Ga0307410_10738796 | 3300031852 | Bacteria | 832 |
| 309 | Ga0307406_10001398 | 3300031901 | Bacteria | 13412 |
| 310 | Ga0307406_10015213 | 3300031901 | Bacteria | 4447 |
| 311 | Ga0307406_10231614 | 3300031901 | Bacteria | 1380 |
| 312 | Ga0307406_10254655 | 3300031901 | Bacteria | 1324 |
| 313 | Ga0307406_10294655 | 3300031901 | Bacteria | 1243 |
| 314 | Ga0307407_10060640 | 3300031903 | Bacteria | 2208 |
| 315 | Ga0307412_10008099 | 3300031911 | Bacteria | 5988 |
| 316 | Ga0307412_10016738 | 3300031911 | Bacteria | 4374 |
| 317 | Ga0307412_10029604 | 3300031911 | Bacteria | 3438 |
| 318 | Ga0307412_10499467 | 3300031911 | Bacteria | 1012 |
| 319 | Ga0307412_11040098 | 3300031911 | Bacteria | 725 |
| 320 | Ga0307416_100021408 | 3300032002 | Bacteria | 4641 |
| 321 | Ga0307414_10077610 | 3300032004 | Bacteria | 2418 |
| 322 | Ga0307411_10019572 | 3300032005 | Bacteria | 3914 |
| 323 | Ga0307411_10172885 | 3300032005 | Bacteria | 1631 |
| 324 | Ga0307411_10361232 | 3300032005 | Bacteria | 1187 |
| 325 | Ga0307411_10468346 | 3300032005 | Bacteria | 1058 |
| 326 | Ga0307411_10542760 | 3300032005 | Bacteria | 990 |
| 327 | Ga0307411_10685810 | 3300032005 | Bacteria | 891 |
| 328 | Ga0307510_10380831 | 3300033180 | Bacteria | 856 |
| 329 | Ga0307510_10495024 | 3300033180 | Bacteria | 665 |
| 330 | Ga0373959_0089916 | 3300034820 | Bacteria | 719 |
| 331 | Ga0373931_0199514 | 3300035691 | Bacteria | 1194 |
| 332 | Ga0373935_0469992 | 3300035692 | Bacteria | 910 |
| 333 | Ga0373937_0851268 | 3300036401 | Bacteria | 860 |
| 334 | Ga0395899_0003496 | 3300037312 | Bacteria | 12446 |
| 335 | Ga0395899_0100694 | 3300037312 | Bacteria | 2086 |
| 336 | Ga0395899_0222578 | 3300037312 | Bacteria | 1306 |
| 337 | Ga0395899_0230848 | 3300037312 | Bacteria | 1278 |
| 338 | Ga0395899_0366702 | 3300037312 | Bacteria | 960 |
| 339 | Ga0395900_0003724 | 3300037418 | Bacteria | 16375 |
| 340 | Ga0395900_0007772 | 3300037418 | Bacteria | 11059 |
| 341 | Ga0395900_0039681 | 3300037418 | Bacteria | 4850 |
| 342 | Ga0395900_0075042 | 3300037418 | Bacteria | 3476 |
| 343 | Ga0395900_0344920 | 3300037418 | Bacteria | 1464 |
| 344 | Ga0395900_0427098 | 3300037418 | Bacteria | 1285 |
| 345 | Ga0395898_0032951 | 3300037466 | Bacteria | 5171 |
| 346 | Ga0395898_0094243 | 3300037466 | Bacteria | 2877 |
| 347 | Ga0395898_1405677 | 3300037466 | Bacteria | 625 |
| 348 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 349 | Ga0395905_0002887 | 3300037471 | Bacteria | 18776 |
| 350 | Ga0395905_0003130 | 3300037471 | Bacteria | 17834 |
| 351 | Ga0395905_0005429 | 3300037471 | Bacteria | 13023 |
| 352 | Ga0395905_0046785 | 3300037471 | Bacteria | 4056 |
| 353 | Ga0395905_0058827 | 3300037471 | Bacteria | 3593 |
| 354 | Ga0395905_0118050 | 3300037471 | Bacteria | 2493 |
| 355 | Ga0395905_0228188 | 3300037471 | Bacteria | 1741 |
| 356 | Ga0395905_0520308 | 3300037471 | Bacteria | 1090 |
| 357 | Ga0395905_0525943 | 3300037471 | Bacteria | 1083 |
| 358 | Ga0395905_0708814 | 3300037471 | Bacteria | 909 |
| 359 | Ga0395905_0798895 | 3300037471 | Bacteria | 846 |
| 360 | Ga0395901_0007882 | 3300038443 | Bacteria | 10743 |
| 361 | Ga0395901_0014407 | 3300038443 | Bacteria | 8048 |
| 362 | Ga0395901_0096529 | 3300038443 | Bacteria | 3098 |
| 363 | Ga0395901_0118358 | 3300038443 | Bacteria | 2783 |
| 364 | Ga0395901_0310823 | 3300038443 | Bacteria | 1632 |
| 365 | Ga0395901_0484309 | 3300038443 | Bacteria | 1261 |
| 366 | Ga0395901_1136356 | 3300038443 | Bacteria | 750 |
| 367 | Ga0436361_0752278 | 3300039447 | Bacteria | 8215 |
| 368 | Ga0439436_0010239 | 3300041404 | Bacteria | 2863 |
| 369 | Ga0439436_0029839 | 3300041404 | Bacteria | 1587 |
| 370 | Ga0439436_0043042 | 3300041404 | Bacteria | 1289 |
| 371 | Ga0439436_0116821 | 3300041404 | Bacteria | 745 |
| 372 | Ga0439439_0021934 | 3300041406 | Bacteria | 1593 |
| 373 | Ga0439439_0179706 | 3300041406 | Bacteria | 609 |
| 374 | Ga0439447_027490 | 3300041407 | Bacteria | 1451 |
| 375 | Ga0439453_0033802 | 3300041408 | Bacteria | 979 |
| 376 | Ga0439466_0004652 | 3300041411 | Bacteria | 5272 |
| 377 | Ga0439466_0016643 | 3300041411 | Bacteria | 2655 |
| 378 | Ga0439466_0033329 | 3300041411 | Bacteria | 1750 |
| 379 | Ga0439465_0013074 | 3300041413 | Bacteria | 2592 |
| 380 | Ga0439465_0047663 | 3300041413 | Bacteria | 1397 |
| 381 | Ga0451793_0908423 | 3300041452 | Bacteria | 797 |
| 382 | Ga0451795_1355545 | 3300041456 | Bacteria | 644 |
| 383 | Ga0451800_0814143 | 3300041459 | Bacteria | 1277 |
| 384 | Ga0451804_0012504 | 3300041463 | Bacteria | 1036 |
| 385 | Ga0451833_1303881 | 3300041491 | Bacteria | 838 |
| 386 | Ga0451849_0371145 | 3300041505 | Bacteria | 788 |
| 387 | Ga0451843_0464067 | 3300041509 | Bacteria | 570 |
| 388 | Ga0439433_0018480 | 3300041999 | Bacteria | 1553 |
| 389 | Ga0439433_0020920 | 3300041999 | Bacteria | 1461 |
| 390 | Ga0439433_0026023 | 3300041999 | Bacteria | 1323 |
| 391 | Ga0439442_002482 | 3300042002 | Bacteria | 3621 |
| 392 | Ga0439442_010805 | 3300042002 | Bacteria | 1854 |
| 393 | Ga0439443_106844 | 3300042003 | Bacteria | 540 |
| 394 | Ga0439445_0007766 | 3300042004 | Bacteria | 2497 |
| 395 | Ga0439432_012486 | 3300042006 | Bacteria | 2904 |
| 396 | Ga0439432_097085 | 3300042006 | Bacteria | 883 |
| 397 | Ga0439432_118344 | 3300042006 | Bacteria | 785 |
| 398 | Ga0439449_0015271 | 3300042007 | Bacteria | 2884 |
| 399 | Ga0439449_0066857 | 3300042007 | Bacteria | 1325 |
| 400 | Ga0439449_0115149 | 3300042007 | Bacteria | 997 |
| 401 | Ga0439452_027246 | 3300042010 | Bacteria | 1436 |
| 402 | Ga0439452_037736 | 3300042010 | Bacteria | 1150 |
| 403 | Ga0439457_017730 | 3300042014 | Bacteria | 1580 |
| 404 | Ga0439462_0003296 | 3300042015 | Bacteria | 3860 |
| 405 | Ga0439462_0006865 | 3300042015 | Bacteria | 2839 |
| 406 | Ga0439462_0007334 | 3300042015 | Bacteria | 2758 |
| 407 | Ga0450911_000194 | 3300042115 | Bacteria | 23939 |
| 408 | Ga0450919_005996 | 3300042121 | Bacteria | 1447 |
| 409 | Ga0450920_029078 | 3300042122 | Bacteria | 1084 |
| 410 | Ga0450921_004453 | 3300042123 | Bacteria | 1023 |
| 411 | Ga0450922_012905 | 3300042124 | Bacteria | 813 |
| 412 | Ga0450923_001463 | 3300042125 | Bacteria | 3137 |
| 413 | Ga0450923_003973 | 3300042125 | Bacteria | 2285 |
| 414 | Ga0450888_062793 | 3300042126 | Bacteria | 547 |
| 415 | Ga0450890_012472 | 3300042127 | Bacteria | 1103 |
| 416 | Ga0450890_015202 | 3300042127 | Bacteria | 1012 |
| 417 | Ga0450897_011181 | 3300042128 | Bacteria | 872 |
| 418 | Ga0450891_004527 | 3300042129 | Bacteria | 1297 |
| 419 | Ga0450898_019800 | 3300042134 | Bacteria | 1175 |
| 420 | Ga0450899_012102 | 3300042135 | Bacteria | 968 |
| 421 | Ga0450903_036422 | 3300042138 | Bacteria | 734 |
| 422 | Ga0450905_015920 | 3300042142 | Bacteria | 1081 |
| 423 | Ga0450906_001977 | 3300042145 | Bacteria | 4482 |
| 424 | Ga0450906_006491 | 3300042145 | Bacteria | 2361 |
| 425 | Ga0450906_092812 | 3300042145 | Bacteria | 549 |
| 426 | Ga0450907_014026 | 3300042146 | Bacteria | 1337 |
| 427 | Ga0450910_001170 | 3300042147 | Bacteria | 3254 |
| 428 | Ga0450910_022332 | 3300042147 | Bacteria | 962 |
| 429 | Ga0439446_0016081 | 3300042156 | Bacteria | 2081 |
| 430 | Ga0439446_0055804 | 3300042156 | Bacteria | 1186 |
| 431 | Ga0439446_0116802 | 3300042156 | Bacteria | 855 |
| 432 | Ga0450908_001728 | 3300042184 | Bacteria | 4256 |
| 433 | Ga0450908_069573 | 3300042184 | Bacteria | 624 |
| 434 | Ga0450909_002487 | 3300042185 | Bacteria | 2610 |
| 435 | Ga0450909_027013 | 3300042185 | Bacteria | 866 |
| 436 | Ga0439434_0025840 | 3300042435 | Bacteria | 1773 |
| 437 | Ga0439434_0030060 | 3300042435 | Bacteria | 1648 |
| 438 | Ga0439434_0128389 | 3300042435 | Bacteria | 830 |
| 439 | Ga0439459_0066734 | 3300042438 | Bacteria | 824 |
| 440 | Ga0439464_0013756 | 3300042439 | Bacteria | 2171 |
| 441 | Ga0450893_0011078 | 3300042532 | Bacteria | 1487 |
| 442 | Ga0450893_0036100 | 3300042532 | Bacteria | 893 |
| 443 | Ga0450893_0042541 | 3300042532 | Bacteria | 835 |
| 444 | Ga0450893_0084924 | 3300042532 | Bacteria | 630 |
| 445 | Ga0466969_0019653 | 3300044656 | Bacteria | 3508 |
| 446 | Ga0466965_0064383 | 3300044683 | Bacteria | 1835 |
| 447 | Ga0466965_0096018 | 3300044683 | Bacteria | 1512 |
| 448 | Ga0466966_0192436 | 3300044684 | Bacteria | 1236 |
| 449 | Ga0466966_0201642 | 3300044684 | Bacteria | 1204 |
| 450 | Ga0466961_0009025 | 3300044693 | Bacteria | 6360 |
| 451 | Ga0466961_0086979 | 3300044693 | Bacteria | 1975 |
| 452 | Ga0466961_0193257 | 3300044693 | Bacteria | 1261 |
| 453 | Ga0453684_0480221 | 3300044712 | Bacteria | 1379 |
| 454 | Ga0466968_0154142 | 3300044735 | Bacteria | 1057 |
| 455 | Ga0466970_0625688 | 3300044765 | Bacteria | 625 |
| 456 | Ga0466957_0157446 | 3300044842 | Bacteria | 1473 |
| 457 | Ga0466957_0259494 | 3300044842 | Bacteria | 1158 |
| 458 | Ga0466960_0062941 | 3300044901 | Bacteria | 1825 |
| 459 | Ga0466959_0060150 | 3300045049 | Bacteria | 2764 |
| 460 | Ga0466959_0409718 | 3300045049 | Bacteria | 921 |
| 461 | Ga0466959_0527351 | 3300045049 | Bacteria | 797 |
| 462 | Ga0466959_0803756 | 3300045049 | Bacteria | 629 |
| 463 | Ga0451576_0142051 | 3300045051 | Bacteria | 2503 |
| 464 | Ga0451576_0258453 | 3300045051 | Bacteria | 1820 |
| 465 | Ga0451576_1044719 | 3300045051 | Bacteria | 856 |
| 466 | Ga0466958_0250888 | 3300045836 | Bacteria | 1132 |
| 467 | Ga0466958_0386579 | 3300045836 | Bacteria | 903 |
| 468 | Ga0466967_0602903 | 3300045976 | Bacteria | 1084 |
| 469 | Ga0466967_0604087 | 3300045976 | Bacteria | 1083 |
| 470 | Ga0466967_0785398 | 3300045976 | Bacteria | 945 |
| 471 | Ga0495627_054851 | 3300046453 | Bacteria | 1190 |
| 472 | Ga0495629_0217985 | 3300046459 | Bacteria | 1317 |
| 473 | Ga0495650_0026896 | 3300046471 | Bacteria | 2667 |
| 474 | Ga0495639_0084494 | 3300046475 | Bacteria | 1482 |
| 475 | Ga0495610_0016240 | 3300046512 | Bacteria | 4295 |
| 476 | Ga0495610_0019169 | 3300046512 | Bacteria | 3836 |
| 477 | Ga0495616_0012846 | 3300046513 | Bacteria | 4737 |
| 478 | Ga0495620_0006122 | 3300046515 | Bacteria | 6641 |
| 479 | Ga0495620_0158380 | 3300046515 | Bacteria | 880 |
| 480 | Ga0495631_0000256 | 3300046518 | Bacteria | 36913 |
| 481 | Ga0495632_0100674 | 3300046519 | Bacteria | 1362 |
| 482 | Ga0495637_0051611 | 3300046520 | Bacteria | 1720 |
| 483 | Ga0495637_0068665 | 3300046520 | Bacteria | 1435 |
| 484 | Ga0495642_0119476 | 3300046528 | Bacteria | 1130 |
| 485 | Ga0495654_0000621 | 3300046530 | Bacteria | 28258 |
| 486 | Ga0495654_0106953 | 3300046530 | Bacteria | 1280 |
| 487 | Ga0495654_0229266 | 3300046530 | Bacteria | 782 |
| 488 | Ga0495640_0621146 | 3300046533 | Bacteria | 652 |
| 489 | Ga0495621_0082081 | 3300046539 | Bacteria | 1203 |
| 490 | Ga0495621_0105777 | 3300046539 | Bacteria | 1075 |
| 491 | Ga0495621_0116679 | 3300046539 | Bacteria | 1028 |
| 492 | Ga0495645_0481213 | 3300046543 | Bacteria | 779 |
| 493 | Ga0495622_0076921 | 3300046557 | Bacteria | 1538 |
| 494 | Ga0495633_0005245 | 3300046558 | Bacteria | 7994 |
| 495 | Ga0495656_0038312 | 3300046615 | Bacteria | 1985 |
| 496 | Ga0495656_0050762 | 3300046615 | Bacteria | 1772 |
| 497 | Ga0495668_0128526 | 3300046616 | Bacteria | 1387 |
| 498 | Ga0495625_0002053 | 3300046660 | Bacteria | 22597 |
| 499 | Ga0495625_0006884 | 3300046660 | Bacteria | 10036 |
| 500 | Ga0495625_0053668 | 3300046660 | Bacteria | 2881 |
| 501 | Ga0495625_0300430 | 3300046660 | Bacteria | 1027 |
| 502 | Ga0495659_0276850 | 3300046664 | Bacteria | 704 |
| 503 | Ga0495588_0045339 | 3300046674 | Bacteria | 2253 |
| 504 | Ga0495657_0677688 | 3300046675 | Bacteria | 593 |
| 505 | Ga0495658_0034626 | 3300046683 | Bacteria | 2772 |
| 506 | Ga0495624_0237747 | 3300046690 | Bacteria | 1103 |
| 507 | Ga0495670_0138460 | 3300046691 | Bacteria | 1272 |
| 508 | Ga0495671_0011758 | 3300046692 | Bacteria | 4799 |
| 509 | Ga0495600_0418592 | 3300046809 | Bacteria | 832 |
| 510 | Ga0495581_0378657 | 3300047315 | Bacteria | 826 |
| 511 | Ga0495676_0019988 | 3300047321 | Bacteria | 5882 |
| 512 | Ga0495676_0598398 | 3300047321 | Bacteria | 718 |
| 513 | Ga0495677_0369791 | 3300047445 | Bacteria | 566 |
| 514 | Ga0495681_0071440 | 3300047470 | Bacteria | 1572 |
| 515 | Ga0495602_0483104 | 3300048088 | Bacteria | 869 |
| 516 | Ga0495614_0079526 | 3300048089 | Bacteria | 1419 |
| 517 | Ga0496100_0445213 | 3300048903 | Bacteria | 992 |
| 518 | Ga0496101_0031565 | 3300048904 | Bacteria | 3725 |
| 519 | Ga0496102_0004774 | 3300048905 | Bacteria | 11465 |
| 520 | Ga0496102_0126808 | 3300048905 | Bacteria | 2386 |
| 521 | Ga0496102_0408316 | 3300048905 | Bacteria | 1276 |
| 522 | Ga0496103_0280252 | 3300048906 | Bacteria | 1072 |
| 523 | Ga0496103_0281559 | 3300048906 | Bacteria | 1069 |
| 524 | Ga0496104_0231117 | 3300048907 | Bacteria | 1761 |
| 525 | Ga0496105_0008359 | 3300048908 | Bacteria | 8042 |
| 526 | Ga0496108_0098179 | 3300048911 | Bacteria | 2496 |
| 527 | Ga0496109_0547658 | 3300048912 | Bacteria | 1091 |
| 528 | Ga0496113_0832371 | 3300048916 | Bacteria | 732 |
| 529 | Ga0496116_0051765 | 3300048919 | Bacteria | 2725 |
| 530 | Ga0496116_0198431 | 3300048919 | Bacteria | 1053 |
| 531 | Ga0496117_0017454 | 3300048920 | Bacteria | 5992 |
| 532 | Ga0496117_0478385 | 3300048920 | Bacteria | 609 |
| 533 | Ga0496118_0013419 | 3300048921 | Bacteria | 7752 |
| 534 | Ga0496118_0179237 | 3300048921 | Bacteria | 1282 |
| 535 | Ga0496118_0236035 | 3300048921 | Bacteria | 1051 |
| 536 | Ga0496118_0440882 | 3300048921 | Bacteria | 664 |
| 537 | Ga0496119_0107545 | 3300048922 | Bacteria | 1555 |
| 538 | Ga0496121_0036944 | 3300048924 | Bacteria | 4345 |
| 539 | Ga0496121_0098101 | 3300048924 | Bacteria | 2268 |
| 540 | Ga0496121_0185498 | 3300048924 | Bacteria | 1496 |
| 541 | Ga0496122_0004040 | 3300048925 | Bacteria | 18651 |
| 542 | Ga0496122_0116737 | 3300048925 | Bacteria | 1734 |
| 543 | Ga0496122_0155898 | 3300048925 | Bacteria | 1401 |
| 544 | Ga0496122_0209463 | 3300048925 | Bacteria | 1131 |
| 545 | Ga0496122_0379276 | 3300048925 | Bacteria | 726 |
| 546 | Ga0496123_0000299 | 3300048926 | Bacteria | 96749 |
| 547 | Ga0496123_0037156 | 3300048926 | Bacteria | 3443 |
| 548 | Ga0496123_0133813 | 3300048926 | Bacteria | 1368 |
| 549 | Ga0496123_0136599 | 3300048926 | Bacteria | 1348 |
| 550 | Ga0496123_0305665 | 3300048926 | Bacteria | 757 |
| 551 | Ga0496124_0097061 | 3300048927 | Bacteria | 2393 |
| 552 | Ga0496124_0108668 | 3300048927 | Bacteria | 2236 |
| 553 | Ga0496124_0226336 | 3300048927 | Bacteria | 1402 |
| 554 | Ga0496124_0354573 | 3300048927 | Bacteria | 1036 |
| 555 | Ga0496124_0480354 | 3300048927 | Bacteria | 839 |
| 556 | Ga0496125_0022015 | 3300048928 | Bacteria | 5927 |
| 557 | Ga0496125_0026207 | 3300048928 | Bacteria | 5318 |
| 558 | Ga0496125_0067718 | 3300048928 | Bacteria | 2812 |
| 559 | Ga0496125_0068872 | 3300048928 | Bacteria | 2780 |
| 560 | Ga0496125_0225817 | 3300048928 | Bacteria | 1202 |
| 561 | Ga0496125_0339003 | 3300048928 | Bacteria | 903 |
| 562 | Ga0496126_0099531 | 3300048929 | Bacteria | 2546 |
| 563 | Ga0496126_0428956 | 3300048929 | Bacteria | 1067 |
| 564 | Ga0501034_0292532 | 3300049571 | Bacteria | 1566 |
| 565 | Ga0501038_0336009 | 3300049574 | Bacteria | 1179 |
| 566 | Ga0501039_0483327 | 3300049575 | Bacteria | 973 |
| 567 | Ga0501043_0061521 | 3300049579 | Bacteria | 2949 |
| 568 | Ga0501043_0250893 | 3300049579 | Bacteria | 1363 |
| 569 | Ga0501046_0200600 | 3300049580 | Bacteria | 1484 |
| 570 | Ga0501047_0204289 | 3300049581 | Bacteria | 1835 |
| 571 | Ga0501047_0353983 | 3300049581 | Bacteria | 1305 |
| 572 | Ga0501074_0297251 | 3300049590 | Bacteria | 1147 |
| 573 | Ga0501249_005873 | 3300049679 | Bacteria | 2512 |
| 574 | Ga0501249_095343 | 3300049679 | Bacteria | 709 |
| 575 | Ga0501080_0099858 | 3300049742 | Bacteria | 2693 |
| 576 | Ga0501262_007342 | 3300049759 | Bacteria | 1332 |
| 577 | Ga0501044_0837133 | 3300049823 | Bacteria | 797 |
| 578 | nmdc:mga03683_109197_c1 | 3300050489 | Bacteria | 1222 |
| 579 | nmdc:mga03683_120838_c1 | 3300050489 | Bacteria | 1165 |
| 580 | nmdc:mga03683_220982_c1 | 3300050489 | Bacteria | 874 |
| 581 | nmdc:mga03683_326494_c1 | 3300050489 | Bacteria | 723 |
| 582 | nmdc:mga03683_353056_c1 | 3300050489 | Bacteria | 696 |
| 583 | nmdc:mga03683_425217_c1 | 3300050489 | Bacteria | 637 |
| 584 | nmdc:mga03683_49428_c1 | 3300050489 | Bacteria | 1106 |
| 585 | nmdc:mga03683_85827_c1 | 3300050489 | Bacteria | 1366 |
| 586 | nmdc:mga03n38_154531_c1 | 3300050490 | Bacteria | 1157 |
| 587 | nmdc:mga03n38_171949_c1 | 3300050490 | Bacteria | 1104 |
| 588 | nmdc:mga0yw44_440297_c1 | 3300050492 | Bacteria | 883 |
| 589 | nmdc:mga0yw44_54490_c1 | 3300050492 | Bacteria | 2431 |
| 590 | nmdc:mga0k408_141598_c1 | 3300050493 | Bacteria | 1431 |
| 591 | nmdc:mga0k408_210946_c1 | 3300050493 | Bacteria | 1160 |
| 592 | nmdc:mga0k408_275868_c1 | 3300050493 | Bacteria | 1004 |
| 593 | nmdc:mga0k408_548170_c1 | 3300050493 | Bacteria | 684 |
| 594 | nmdc:mga0k408_95474_c1 | 3300050493 | Bacteria | 1750 |
| 595 | nmdc:mga06z11_347519_c1 | 3300050494 | Bacteria | 887 |
| 596 | nmdc:mga06z11_704160_c1 | 3300050494 | Bacteria | 615 |
| 597 | nmdc:mga04h51_185002_c1 | 3300050495 | Bacteria | 812 |
| 598 | nmdc:mga04h51_308460_c1 | 3300050495 | Bacteria | 646 |
| 599 | nmdc:mga07m45_123785_c1 | 3300050496 | Bacteria | 1494 |
| 600 | nmdc:mga07m45_129869_c1 | 3300050496 | Bacteria | 1458 |
| 601 | nmdc:mga07m45_145183_c1 | 3300050496 | Bacteria | 1375 |
| 602 | nmdc:mga07m45_207258_c1 | 3300050496 | Bacteria | 1141 |
| 603 | nmdc:mga07m45_249156_c1 | 3300050496 | Bacteria | 1033 |
| 604 | nmdc:mga07m45_33050_c1 | 3300050496 | Bacteria | 2872 |
| 605 | nmdc:mga07m45_33830_c1 | 3300050496 | Bacteria | 2840 |
| 606 | nmdc:mga07m45_351292_c1 | 3300050496 | Bacteria | 857 |
| 607 | nmdc:mga07m45_445738_c1 | 3300050496 | Bacteria | 751 |
| 608 | nmdc:mga07m45_451254_c1 | 3300050496 | Bacteria | 746 |
| 609 | nmdc:mga07m45_58284_c1 | 3300050496 | Bacteria | 2185 |
| 610 | nmdc:mga07m45_9309_c3 | 3300050496 | Bacteria | 1556 |
| 611 | nmdc:mga0qj67_294050_c1 | 3300050509 | Bacteria | 1316 |
| 612 | nmdc:mga0sz30_106998_c1 | 3300050516 | Bacteria | 1224 |
| 613 | Ga0500610_0058278 | 3300053079 | Bacteria | 2016 |
| 614 | Ga0500610_0110658 | 3300053079 | Bacteria | 1412 |
| 615 | Ga0500610_0150115 | 3300053079 | Bacteria | 1168 |
| 616 | Ga0500635_0083626 | 3300053080 | Bacteria | 1151 |
| 617 | Ga0500651_0000224 | 3300053093 | Bacteria | 35276 |
| 618 | Ga0500562_019544 | 3300053108 | Bacteria | 1753 |
| 619 | Ga0500569_084456 | 3300053109 | Bacteria | 1020 |
| 620 | Ga0500571_000057 | 3300053110 | Bacteria | 34612 |
| 621 | Ga0500593_072603 | 3300053117 | Bacteria | 1490 |
| 622 | Ga0500594_0021688 | 3300053118 | Bacteria | 1613 |
| 623 | Ga0500594_0059555 | 3300053118 | Bacteria | 1097 |
| 624 | Ga0500597_121806 | 3300053120 | Bacteria | 1130 |
| 625 | Ga0500607_016271 | 3300053121 | Bacteria | 4267 |
| 626 | Ga0500608_071133 | 3300053122 | Bacteria | 1654 |
| 627 | Ga0500626_099685 | 3300053128 | Bacteria | 1267 |
| 628 | Ga0500655_000250 | 3300053133 | Bacteria | 12616 |
| 629 | Ga0500658_0007603 | 3300053134 | Bacteria | 4003 |
| 630 | Ga0500559_0001099 | 3300053136 | Bacteria | 16348 |
| 631 | Ga0500559_0092987 | 3300053136 | Bacteria | 1382 |
| 632 | Ga0500568_0090412 | 3300053139 | Bacteria | 1154 |
| 633 | Ga0500573_0108765 | 3300053140 | Bacteria | 1553 |
| 634 | Ga0500616_0070652 | 3300053153 | Bacteria | 1781 |
| 635 | Ga0500627_0051141 | 3300053158 | Bacteria | 1801 |
| 636 | Ga0500634_0003846 | 3300053161 | Bacteria | 6799 |
| 637 | Ga0500634_0015287 | 3300053161 | Bacteria | 4073 |
| 638 | Ga0500645_005572 | 3300053730 | Bacteria | 4610 |
| 639 | Ga0500645_034756 | 3300053730 | Bacteria | 1505 |
| 640 | Ga0500645_054454 | 3300053730 | Bacteria | 1163 |
| 641 | Ga0500645_084264 | 3300053730 | Bacteria | 905 |
| 642 | Ga0500596_019836 | 3300053735 | Bacteria | 1010 |
| 643 | Ga0500587_009223 | 3300053739 | Bacteria | 1262 |
| 644 | Ga0590077_037320 | 3300059426 | Bacteria | 1073 |
| 645 | Ga0466962_0086759 | 3300061719 | Bacteria | 1499 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005616 | Ga0068852_101595441 | Ga0068852_1015954412 | 134 |
| 2 | 3300005336 | Ga0070680_100330402 | Ga0070680_1003304021 | 146 |
| 3 | 3300006353 | Ga0075370_10470517 | Ga0075370_104705171 | 146 |
| 4 | 3300031548 | Ga0307408_100001559 | Ga0307408_10000155915 | 146 |
| 5 | 3300031901 | Ga0307406_10001398 | Ga0307406_100013985 | 146 |
| 6 | 3300042142 | Ga0450905_015920 | Ga0450905_015920_16_522 | 148 |
| 7 | iso_pu_bacteria | 2643221611 | 2644073250 | 149 |
| 8 | 3300044712 | Ga0453684_0480221 | Ga0453684_0480221_646_1131 | 150 |
| 9 | iso_pu_bacteria | 2738543013 | 2739247699 | 152 |
| 10 | 3300025949 | Ga0207667_10312346 | Ga0207667_103123462 | 153 |
| 11 | 3300027876 | Ga0209974_10028637 | Ga0209974_100286372 | 153 |
| 12 | 3300031456 | Ga0307513_10718889 | Ga0307513_107188891 | 153 |
| 13 | 3300037312 | Ga0395899_0100694 | Ga0395899_0100694_362_856 | 153 |
| 14 | 3300037418 | Ga0395900_0003724 | Ga0395900_0003724_7179_7673 | 153 |
| 15 | 3300037418 | Ga0395900_0075042 | Ga0395900_0075042_1502_2005 | 153 |
| 16 | 3300037466 | Ga0395898_0032951 | Ga0395898_0032951_3579_4073 | 153 |
| 17 | 3300037471 | Ga0395905_0046785 | Ga0395905_0046785_2693_3187 | 153 |
| 18 | 3300037471 | Ga0395905_0520308 | Ga0395905_0520308_285_788 | 153 |
| 19 | 3300037471 | Ga0395905_0708814 | Ga0395905_0708814_132_644 | 153 |
| 20 | 3300038443 | Ga0395901_0007882 | Ga0395901_0007882_7135_7629 | 153 |
| 21 | 3300038443 | Ga0395901_0484309 | Ga0395901_0484309_96_599 | 153 |
| 22 | iso_pu_bacteria | 2881101125 | 2881104424 | 153 |
| 23 | iso_pu_bacteria | 2928115317 | 2928120069 | 153 |
| 24 | 3300006048 | Ga0075363_100085120 | Ga0075363_1000851202 | 154 |
| 25 | 3300013307 | Ga0157372_12072851 | Ga0157372_120728511 | 154 |
| 26 | 3300031235 | Ga0265330_10036383 | Ga0265330_100363833 | 154 |
| 27 | 3300031238 | Ga0265332_10016400 | Ga0265332_100164002 | 154 |
| 28 | 3300031250 | Ga0265331_10024909 | Ga0265331_100249094 | 154 |
| 29 | 3300031711 | Ga0265314_10003183 | Ga0265314_100031836 | 154 |
| 30 | 3300037418 | Ga0395900_0427098 | Ga0395900_0427098_465_947 | 154 |
| 31 | 3300037466 | Ga0395898_1405677 | Ga0395898_1405677_145_615 | 154 |
| 32 | 3300037471 | Ga0395905_0798895 | Ga0395905_0798895_257_772 | 154 |
| 33 | 3300041459 | Ga0451800_0814143 | Ga0451800_0814143_109_591 | 154 |
| 34 | 3300044684 | Ga0466966_0192436 | Ga0466966_0192436_712_1185 | 154 |
| 35 | 3300045049 | Ga0466959_0803756 | Ga0466959_0803756_74_559 | 154 |
| 36 | 3300045836 | Ga0466958_0250888 | Ga0466958_0250888_265_750 | 154 |
| 37 | 3300049571 | Ga0501034_0292532 | Ga0501034_0292532_340_837 | 154 |
| 38 | 3300049574 | Ga0501038_0336009 | Ga0501038_0336009_441_938 | 154 |
| 39 | 3300049579 | Ga0501043_0061521 | Ga0501043_0061521_305_802 | 154 |
| 40 | 3300049580 | Ga0501046_0200600 | Ga0501046_0200600_562_1059 | 154 |
| 41 | 3300049581 | Ga0501047_0204289 | Ga0501047_0204289_704_1201 | 154 |
| 42 | 3300049590 | Ga0501074_0297251 | Ga0501074_0297251_334_831 | 154 |
| 43 | 3300049742 | Ga0501080_0099858 | Ga0501080_0099858_1636_2133 | 154 |
| 44 | 3300050490 | nmdc:mga03n38_154531_c1 | nmdc:mga03n38_154531_c1_210_689 | 154 |
| 45 | iso_pu_bacteria | 2585428062 | 2587757844 | 154 |
| 46 | 3300005548 | Ga0070665_100727244 | Ga0070665_1007272442 | 155 |
| 47 | 3300037471 | Ga0395905_0525943 | Ga0395905_0525943_129_647 | 155 |
| 48 | 3300038443 | Ga0395901_1136356 | Ga0395901_1136356_50_592 | 155 |
| 49 | 3300044684 | Ga0466966_0201642 | Ga0466966_0201642_43_531 | 155 |
| 50 | 3300044693 | Ga0466961_0086979 | Ga0466961_0086979_1036_1524 | 155 |
| 51 | 3300044765 | Ga0466970_0625688 | Ga0466970_0625688_21_509 | 155 |
| 52 | 3300045049 | Ga0466959_0527351 | Ga0466959_0527351_22_510 | 155 |
| 53 | 3300048905 | Ga0496102_0004774 | Ga0496102_0004774_10276_10788 | 155 |
| 54 | 3300048905 | Ga0496102_0408316 | Ga0496102_0408316_559_1032 | 155 |
| 55 | 3300061719 | Ga0466962_0086759 | Ga0466962_0086759_743_1231 | 155 |
| 56 | iso_pu_bacteria | 2511231002 | 2511245426 | 155 |
| 57 | 3300003784 | Ga0055534_1016875 | Ga0055534_10168751 | 156 |
| 58 | 3300003792 | Ga0055540_1006578 | Ga0055540_10065785 | 156 |
| 59 | 3300003794 | Ga0055531_10001518 | Ga0055531_1000151812 | 156 |
| 60 | 3300005328 | Ga0070676_10347716 | Ga0070676_103477162 | 156 |
| 61 | 3300005331 | Ga0070670_100077256 | Ga0070670_1000772563 | 156 |
| 62 | 3300005333 | Ga0070677_10610832 | Ga0070677_106108321 | 156 |
| 63 | 3300005336 | Ga0070680_100058388 | Ga0070680_1000583884 | 156 |
| 64 | 3300005339 | Ga0070660_100131245 | Ga0070660_1001312453 | 156 |
| 65 | 3300005347 | Ga0070668_100153959 | Ga0070668_1001539592 | 156 |
| 66 | 3300005435 | Ga0070714_100588153 | Ga0070714_1005881532 | 156 |
| 67 | 3300005530 | Ga0070679_100045747 | Ga0070679_1000457475 | 156 |
| 68 | 3300005530 | Ga0070679_100084028 | Ga0070679_1000840281 | 156 |
| 69 | 3300005548 | Ga0070665_100684529 | Ga0070665_1006845292 | 156 |
| 70 | 3300005618 | Ga0068864_100100952 | Ga0068864_1001009522 | 156 |
| 71 | 3300005618 | Ga0068864_100471246 | Ga0068864_1004712462 | 156 |
| 72 | 3300005719 | Ga0068861_101220120 | Ga0068861_1012201202 | 156 |
| 73 | 3300005841 | Ga0068863_100040189 | Ga0068863_1000401892 | 156 |
| 74 | 3300006038 | Ga0075365_10122938 | Ga0075365_101229382 | 156 |
| 75 | 3300006048 | Ga0075363_100605577 | Ga0075363_1006055772 | 156 |
| 76 | 3300006178 | Ga0075367_10304368 | Ga0075367_103043682 | 156 |
| 77 | 3300006195 | Ga0075366_10199836 | Ga0075366_101998362 | 156 |
| 78 | 3300006195 | Ga0075366_10453407 | Ga0075366_104534071 | 156 |
| 79 | 3300006195 | Ga0075366_10498901 | Ga0075366_104989011 | 156 |
| 80 | 3300006353 | Ga0075370_10325611 | Ga0075370_103256111 | 156 |
| 81 | 3300006353 | Ga0075370_10424483 | Ga0075370_104244832 | 156 |
| 82 | 3300006353 | Ga0075370_10432189 | Ga0075370_104321891 | 156 |
| 83 | 3300006353 | Ga0075370_10491070 | Ga0075370_104910701 | 156 |
| 84 | 3300006846 | Ga0075430_100037061 | Ga0075430_1000370614 | 156 |
| 85 | 3300009093 | Ga0105240_10044773 | Ga0105240_100447736 | 156 |
| 86 | 3300009551 | Ga0105238_10726325 | Ga0105238_107263252 | 156 |
| 87 | 3300011119 | Ga0105246_10204304 | Ga0105246_102043042 | 156 |
| 88 | 3300012490 | Ga0157322_1013657 | Ga0157322_10136571 | 156 |
| 89 | 3300013297 | Ga0157378_10692548 | Ga0157378_106925482 | 156 |
| 90 | 3300013306 | Ga0163162_10314310 | Ga0163162_103143102 | 156 |
| 91 | 3300013308 | Ga0157375_10834797 | Ga0157375_108347972 | 156 |
| 92 | 3300014497 | Ga0182008_10016633 | Ga0182008_100166336 | 156 |
| 93 | 3300014969 | Ga0157376_11012115 | Ga0157376_110121152 | 156 |
| 94 | 3300015262 | Ga0182007_10016821 | Ga0182007_100168213 | 156 |
| 95 | 3300017792 | Ga0163161_10039115 | Ga0163161_100391152 | 156 |
| 96 | 3300017792 | Ga0163161_10261274 | Ga0163161_102612742 | 156 |
| 97 | 3300025273 | Ga0209673_1049559 | Ga0209673_10495592 | 156 |
| 98 | 3300025284 | Ga0209130_1006552 | Ga0209130_10065524 | 156 |
| 99 | 3300025291 | Ga0209675_1000987 | Ga0209675_10009877 | 156 |
| 100 | 3300025291 | Ga0209675_1029576 | Ga0209675_10295762 | 156 |
| 101 | 3300025292 | Ga0209676_1007069 | Ga0209676_10070691 | 156 |
| 102 | 3300025292 | Ga0209676_1009793 | Ga0209676_10097931 | 156 |
| 103 | 3300025303 | Ga0209051_1001982 | Ga0209051_10019825 | 156 |
| 104 | 3300025303 | Ga0209051_1006199 | Ga0209051_10061997 | 156 |
| 105 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015305 | 156 |
| 106 | 3300025304 | Ga0209257_1016051 | Ga0209257_10160514 | 156 |
| 107 | 3300025901 | Ga0207688_10297728 | Ga0207688_102977282 | 156 |
| 108 | 3300025907 | Ga0207645_10172775 | Ga0207645_101727752 | 156 |
| 109 | 3300025909 | Ga0207705_10091665 | Ga0207705_100916652 | 156 |
| 110 | 3300025913 | Ga0207695_10046357 | Ga0207695_100463572 | 156 |
| 111 | 3300025919 | Ga0207657_10115072 | Ga0207657_101150723 | 156 |
| 112 | 3300025921 | Ga0207652_10029413 | Ga0207652_100294135 | 156 |
| 113 | 3300025921 | Ga0207652_10067117 | Ga0207652_100671173 | 156 |
| 114 | 3300025937 | Ga0207669_10495096 | Ga0207669_104950961 | 156 |
| 115 | 3300025949 | Ga0207667_10079242 | Ga0207667_100792422 | 156 |
| 116 | 3300025972 | Ga0207668_10438309 | Ga0207668_104383092 | 156 |
| 117 | 3300025986 | Ga0207658_10080539 | Ga0207658_100805392 | 156 |
| 118 | 3300026023 | Ga0207677_10689201 | Ga0207677_106892011 | 156 |
| 119 | 3300026088 | Ga0207641_10046119 | Ga0207641_100461195 | 156 |
| 120 | 3300026089 | Ga0207648_10327190 | Ga0207648_103271902 | 156 |
| 121 | 3300026095 | Ga0207676_10374011 | Ga0207676_103740112 | 156 |
| 122 | 3300026121 | Ga0207683_10013814 | Ga0207683_100138142 | 156 |
| 123 | 3300028379 | Ga0268266_10707712 | Ga0268266_107077122 | 156 |
| 124 | 3300028794 | Ga0307515_10000179 | Ga0307515_10000179119 | 156 |
| 125 | 3300028794 | Ga0307515_10000222 | Ga0307515_1000022297 | 156 |
| 126 | 3300028794 | Ga0307515_10001166 | Ga0307515_1000116633 | 156 |
| 127 | 3300028794 | Ga0307515_10019026 | Ga0307515_100190264 | 156 |
| 128 | 3300030522 | Ga0307512_10052380 | Ga0307512_100523804 | 156 |
| 129 | 3300030736 | Ga0316180_1124794 | Ga0316180_11247941 | 156 |
| 130 | 3300031251 | Ga0265327_10281719 | Ga0265327_102817192 | 156 |
| 131 | 3300031456 | Ga0307513_10030880 | Ga0307513_100308802 | 156 |
| 132 | 3300031507 | Ga0307509_10027035 | Ga0307509_100270355 | 156 |
| 133 | 3300031616 | Ga0307508_10000122 | Ga0307508_1000012261 | 156 |
| 134 | 3300031649 | Ga0307514_10004149 | Ga0307514_100041497 | 156 |
| 135 | 3300031649 | Ga0307514_10006235 | Ga0307514_100062357 | 156 |
| 136 | 3300031730 | Ga0307516_10005879 | Ga0307516_100058799 | 156 |
| 137 | 3300032005 | Ga0307411_10685810 | Ga0307411_106858102 | 156 |
| 138 | 3300033180 | Ga0307510_10380831 | Ga0307510_103808312 | 156 |
| 139 | 3300033180 | Ga0307510_10495024 | Ga0307510_104950241 | 156 |
| 140 | 3300034820 | Ga0373959_0089916 | Ga0373959_0089916_193_666 | 156 |
| 141 | 3300035691 | Ga0373931_0199514 | Ga0373931_0199514_653_1126 | 156 |
| 142 | 3300035692 | Ga0373935_0469992 | Ga0373935_0469992_66_539 | 156 |
| 143 | 3300037312 | Ga0395899_0222578 | Ga0395899_0222578_439_918 | 156 |
| 144 | 3300037312 | Ga0395899_0230848 | Ga0395899_0230848_38_514 | 156 |
| 145 | 3300037312 | Ga0395899_0366702 | Ga0395899_0366702_261_833 | 156 |
| 146 | 3300037418 | Ga0395900_0039681 | Ga0395900_0039681_2813_3292 | 156 |
| 147 | 3300037466 | Ga0395898_0094243 | Ga0395898_0094243_250_729 | 156 |
| 148 | 3300037471 | Ga0395905_0058827 | Ga0395905_0058827_3008_3484 | 156 |
| 149 | 3300037471 | Ga0395905_0118050 | Ga0395905_0118050_1445_1918 | 156 |
| 150 | 3300038443 | Ga0395901_0096529 | Ga0395901_0096529_2231_2710 | 156 |
| 151 | 3300038443 | Ga0395901_0118358 | Ga0395901_0118358_1705_2277 | 156 |
| 152 | 3300041404 | Ga0439436_0029839 | Ga0439436_0029839_569_1045 | 156 |
| 153 | 3300041408 | Ga0439453_0033802 | Ga0439453_0033802_365_841 | 156 |
| 154 | 3300041452 | Ga0451793_0908423 | Ga0451793_0908423_58_531 | 156 |
| 155 | 3300041463 | Ga0451804_0012504 | Ga0451804_0012504_528_1016 | 156 |
| 156 | 3300041491 | Ga0451833_1303881 | Ga0451833_1303881_148_624 | 156 |
| 157 | 3300041505 | Ga0451849_0371145 | Ga0451849_0371145_53_613 | 156 |
| 158 | 3300041999 | Ga0439433_0018480 | Ga0439433_0018480_229_705 | 156 |
| 159 | 3300042127 | Ga0450890_012472 | Ga0450890_012472_117_593 | 156 |
| 160 | 3300042128 | Ga0450897_011181 | Ga0450897_011181_80_556 | 156 |
| 161 | 3300042138 | Ga0450903_036422 | Ga0450903_036422_223_699 | 156 |
| 162 | 3300042185 | Ga0450909_002487 | Ga0450909_002487_264_740 | 156 |
| 163 | 3300042435 | Ga0439434_0030060 | Ga0439434_0030060_761_1237 | 156 |
| 164 | 3300042438 | Ga0439459_0066734 | Ga0439459_0066734_88_564 | 156 |
| 165 | 3300042439 | Ga0439464_0013756 | Ga0439464_0013756_1236_1712 | 156 |
| 166 | 3300042532 | Ga0450893_0042541 | Ga0450893_0042541_263_739 | 156 |
| 167 | 3300044693 | Ga0466961_0193257 | Ga0466961_0193257_321_803 | 156 |
| 168 | 3300044842 | Ga0466957_0157446 | Ga0466957_0157446_678_1157 | 156 |
| 169 | 3300044842 | Ga0466957_0259494 | Ga0466957_0259494_368_850 | 156 |
| 170 | 3300045049 | Ga0466959_0409718 | Ga0466959_0409718_261_743 | 156 |
| 171 | 3300045051 | Ga0451576_0142051 | Ga0451576_0142051_520_996 | 156 |
| 172 | 3300045836 | Ga0466958_0386579 | Ga0466958_0386579_178_657 | 156 |
| 173 | 3300045976 | Ga0466967_0602903 | Ga0466967_0602903_335_817 | 156 |
| 174 | 3300045976 | Ga0466967_0604087 | Ga0466967_0604087_24_503 | 156 |
| 175 | 3300045976 | Ga0466967_0785398 | Ga0466967_0785398_180_656 | 156 |
| 176 | 3300046475 | Ga0495639_0084494 | Ga0495639_0084494_570_1040 | 156 |
| 177 | 3300046512 | Ga0495610_0016240 | Ga0495610_0016240_3204_3692 | 156 |
| 178 | 3300046519 | Ga0495632_0100674 | Ga0495632_0100674_139_627 | 156 |
| 179 | 3300046528 | Ga0495642_0119476 | Ga0495642_0119476_166_636 | 156 |
| 180 | 3300046533 | Ga0495640_0621146 | Ga0495640_0621146_75_545 | 156 |
| 181 | 3300046539 | Ga0495621_0082081 | Ga0495621_0082081_371_847 | 156 |
| 182 | 3300046539 | Ga0495621_0105777 | Ga0495621_0105777_372_842 | 156 |
| 183 | 3300046615 | Ga0495656_0038312 | Ga0495656_0038312_1137_1607 | 156 |
| 184 | 3300046660 | Ga0495625_0006884 | Ga0495625_0006884_807_1298 | 156 |
| 185 | 3300046664 | Ga0495659_0276850 | Ga0495659_0276850_38_508 | 156 |
| 186 | 3300046675 | Ga0495657_0677688 | Ga0495657_0677688_39_509 | 156 |
| 187 | 3300046683 | Ga0495658_0034626 | Ga0495658_0034626_138_626 | 156 |
| 188 | 3300046690 | Ga0495624_0237747 | Ga0495624_0237747_234_704 | 156 |
| 189 | 3300046691 | Ga0495670_0138460 | Ga0495670_0138460_533_1003 | 156 |
| 190 | 3300046809 | Ga0495600_0418592 | Ga0495600_0418592_143_613 | 156 |
| 191 | 3300047315 | Ga0495581_0378657 | Ga0495581_0378657_304_774 | 156 |
| 192 | 3300048088 | Ga0495602_0483104 | Ga0495602_0483104_283_753 | 156 |
| 193 | 3300048903 | Ga0496100_0445213 | Ga0496100_0445213_122_592 | 156 |
| 194 | 3300048905 | Ga0496102_0126808 | Ga0496102_0126808_1881_2351 | 156 |
| 195 | 3300048906 | Ga0496103_0280252 | Ga0496103_0280252_19_492 | 156 |
| 196 | 3300048907 | Ga0496104_0231117 | Ga0496104_0231117_390_860 | 156 |
| 197 | 3300048908 | Ga0496105_0008359 | Ga0496105_0008359_875_1345 | 156 |
| 198 | 3300048911 | Ga0496108_0098179 | Ga0496108_0098179_1229_1699 | 156 |
| 199 | 3300048912 | Ga0496109_0547658 | Ga0496109_0547658_514_984 | 156 |
| 200 | 3300048916 | Ga0496113_0832371 | Ga0496113_0832371_48_518 | 156 |
| 201 | 3300049575 | Ga0501039_0483327 | Ga0501039_0483327_273_749 | 156 |
| 202 | 3300049579 | Ga0501043_0250893 | Ga0501043_0250893_555_1031 | 156 |
| 203 | 3300049581 | Ga0501047_0353983 | Ga0501047_0353983_165_641 | 156 |
| 204 | 3300049823 | Ga0501044_0837133 | Ga0501044_0837133_162_638 | 156 |
| 205 | 3300050489 | nmdc:mga03683_425217_c1 | nmdc:mga03683_425217_c1_128_610 | 156 |
| 206 | 3300050493 | nmdc:mga0k408_275868_c1 | nmdc:mga0k408_275868_c1_373_861 | 156 |
| 207 | 3300050493 | nmdc:mga0k408_95474_c1 | nmdc:mga0k408_95474_c1_680_1195 | 156 |
| 208 | 3300050494 | nmdc:mga06z11_347519_c1 | nmdc:mga06z11_347519_c1_135_617 | 156 |
| 209 | 3300050495 | nmdc:mga04h51_308460_c1 | nmdc:mga04h51_308460_c1_120_596 | 156 |
| 210 | 3300050496 | nmdc:mga07m45_123785_c1 | nmdc:mga07m45_123785_c1_640_1116 | 156 |
| 211 | 3300050496 | nmdc:mga07m45_207258_c1 | nmdc:mga07m45_207258_c1_264_752 | 156 |
| 212 | 3300050496 | nmdc:mga07m45_249156_c1 | nmdc:mga07m45_249156_c1_258_749 | 156 |
| 213 | 3300050496 | nmdc:mga07m45_351292_c1 | nmdc:mga07m45_351292_c1_145_660 | 156 |
| 214 | 3300050496 | nmdc:mga07m45_451254_c1 | nmdc:mga07m45_451254_c1_77_565 | 156 |
| 215 | 3300050509 | nmdc:mga0qj67_294050_c1 | nmdc:mga0qj67_294050_c1_421_897 | 156 |
| 216 | 3300053080 | Ga0500635_0083626 | Ga0500635_0083626_430_903 | 156 |
| 217 | 3300053730 | Ga0500645_084264 | Ga0500645_084264_194_667 | 156 |
| 218 | 3300053739 | Ga0500587_009223 | Ga0500587_009223_550_1038 | 156 |
| 219 | iso_pu_bacteria | 2643221658 | 2644327154 | 156 |
| 220 | iso_pu_bacteria | 2842747753 | 2842750247 | 156 |
| 221 | iso_pu_bacteria | 2894023352 | 2894027801 | 156 |
| 222 | iso_pu_bacteria | 2932422444 | 2932422566 | 156 |
| 223 | 3300005548 | Ga0070665_100476381 | Ga0070665_1004763812 | 157 |
| 224 | 3300005616 | Ga0068852_100400241 | Ga0068852_1004002412 | 157 |
| 225 | 3300006177 | Ga0075362_10027962 | Ga0075362_100279621 | 157 |
| 226 | 3300013306 | Ga0163162_10546576 | Ga0163162_105465762 | 157 |
| 227 | 3300025937 | Ga0207669_10217354 | Ga0207669_102173542 | 157 |
| 228 | 3300028379 | Ga0268266_11226052 | Ga0268266_112260521 | 157 |
| 229 | 3300031548 | Ga0307408_100674336 | Ga0307408_1006743361 | 157 |
| 230 | 3300031901 | Ga0307406_10231614 | Ga0307406_102316141 | 157 |
| 231 | 3300031911 | Ga0307412_10499467 | Ga0307412_104994672 | 157 |
| 232 | 3300032005 | Ga0307411_10172885 | Ga0307411_101728852 | 157 |
| 233 | 3300037312 | Ga0395899_0003496 | Ga0395899_0003496_9456_9968 | 157 |
| 234 | 3300037418 | Ga0395900_0007772 | Ga0395900_0007772_5800_6312 | 157 |
| 235 | 3300037418 | Ga0395900_0344920 | Ga0395900_0344920_364_891 | 157 |
| 236 | 3300037471 | Ga0395905_0000047 | Ga0395905_0000047_150006_150533 | 157 |
| 237 | 3300037471 | Ga0395905_0002887 | Ga0395905_0002887_11020_11517 | 157 |
| 238 | 3300037471 | Ga0395905_0003130 | Ga0395905_0003130_2454_2966 | 157 |
| 239 | 3300037471 | Ga0395905_0005429 | Ga0395905_0005429_8538_9050 | 157 |
| 240 | 3300037471 | Ga0395905_0228188 | Ga0395905_0228188_393_920 | 157 |
| 241 | 3300038443 | Ga0395901_0014407 | Ga0395901_0014407_6179_6691 | 157 |
| 242 | 3300038443 | Ga0395901_0310823 | Ga0395901_0310823_479_1006 | 157 |
| 243 | 3300041456 | Ga0451795_1355545 | Ga0451795_1355545_105_578 | 157 |
| 244 | 3300041509 | Ga0451843_0464067 | Ga0451843_0464067_63_536 | 157 |
| 245 | 3300042003 | Ga0439443_106844 | Ga0439443_106844_29_517 | 157 |
| 246 | 3300042115 | Ga0450911_000194 | Ga0450911_000194_3525_4001 | 157 |
| 247 | 3300042126 | Ga0450888_062793 | Ga0450888_062793_32_520 | 157 |
| 248 | 3300042129 | Ga0450891_004527 | Ga0450891_004527_215_727 | 157 |
| 249 | 3300042532 | Ga0450893_0011078 | Ga0450893_0011078_523_1011 | 157 |
| 250 | 3300044656 | Ga0466969_0019653 | Ga0466969_0019653_449_976 | 157 |
| 251 | 3300044683 | Ga0466965_0096018 | Ga0466965_0096018_694_1221 | 157 |
| 252 | 3300044693 | Ga0466961_0009025 | Ga0466961_0009025_353_880 | 157 |
| 253 | 3300044735 | Ga0466968_0154142 | Ga0466968_0154142_101_628 | 157 |
| 254 | 3300044901 | Ga0466960_0062941 | Ga0466960_0062941_80_607 | 157 |
| 255 | 3300045049 | Ga0466959_0060150 | Ga0466959_0060150_772_1299 | 157 |
| 256 | 3300045051 | Ga0451576_0258453 | Ga0451576_0258453_908_1411 | 157 |
| 257 | 3300048924 | Ga0496121_0098101 | Ga0496121_0098101_348_824 | 157 |
| 258 | 3300048927 | Ga0496124_0480354 | Ga0496124_0480354_185_661 | 157 |
| 259 | 3300048928 | Ga0496125_0026207 | Ga0496125_0026207_3708_4184 | 157 |
| 260 | 3300048928 | Ga0496125_0068872 | Ga0496125_0068872_1803_2279 | 157 |
| 261 | 3300050489 | nmdc:mga03683_353056_c1 | nmdc:mga03683_353056_c1_80_559 | 157 |
| 262 | 3300059426 | Ga0590077_037320 | Ga0590077_037320_39_521 | 157 |
| 263 | iso_pu_bacteria | 2513020051 | 2513226875 | 157 |
| 264 | iso_pu_bacteria | 2547132374 | 2548500413 | 157 |
| 265 | iso_pu_bacteria | 2599185214 | 2599621665 | 157 |
| 266 | iso_pu_bacteria | 2599185226 | 2599670651 | 157 |
| 267 | iso_pu_bacteria | 2599185227 | 2599679141 | 157 |
| 268 | iso_pu_bacteria | 2599185229 | 2599691176 | 157 |
| 269 | iso_pu_bacteria | 2643221628 | 2644163618 | 157 |
| 270 | iso_pu_bacteria | 2643221672 | 2644398958 | 157 |
| 271 | iso_pu_bacteria | 2643221683 | 2644465818 | 157 |
| 272 | iso_pu_bacteria | 2643221717 | 2644647040 | 157 |
| 273 | iso_pu_bacteria | 2738541277 | 2738721745 | 157 |
| 274 | iso_pu_bacteria | 2738543012 | 2739244449 | 157 |
| 275 | iso_pu_bacteria | 2738543019 | 2739282109 | 157 |
| 276 | iso_pu_bacteria | 2816332133 | 2816469892 | 157 |
| 277 | iso_pu_bacteria | 2818991446 | 2819597851 | 157 |
| 278 | iso_pu_bacteria | 2831265667 | 2831268821 | 157 |
| 279 | iso_pu_bacteria | 2838054893 | 2838058247 | 157 |
| 280 | iso_pu_bacteria | 2842677519 | 2842678190 | 157 |
| 281 | iso_pu_bacteria | 2842733646 | 2842737006 | 157 |
| 282 | iso_pu_bacteria | 2885192300 | 2885194481 | 157 |
| 283 | iso_pu_bacteria | 2885198086 | 2885204016 | 157 |
| 284 | iso_pu_bacteria | 2885211737 | 2885217650 | 157 |
| 285 | iso_pu_bacteria | 2899924645 | 2899929267 | 157 |
| 286 | iso_pu_bacteria | 2904449895 | 2904451231 | 157 |
| 287 | iso_pu_bacteria | 2904456579 | 2904458093 | 157 |
| 288 | iso_pu_bacteria | 2904479285 | 2904481238 | 157 |
| 289 | iso_pu_bacteria | 2904541872 | 2904542870 | 157 |
| 290 | iso_pu_bacteria | 2919462493 | 2919465568 | 157 |
| 291 | iso_pu_bacteria | 2928037797 | 2928040292 | 157 |
| 292 | iso_pu_bacteria | 2928044640 | 2928046959 | 157 |
| 293 | iso_pu_bacteria | 2928051484 | 2928057840 | 157 |
| 294 | iso_pu_bacteria | 2928064002 | 2928067785 | 157 |
| 295 | iso_pu_bacteria | 2928070936 | 2928072328 | 157 |
| 296 | iso_pu_bacteria | 2928084124 | 2928085537 | 157 |
| 297 | iso_pu_bacteria | 2929160207 | 2929166286 | 157 |
| 298 | iso_pu_bacteria | 2929520902 | 2929526301 | 157 |
| 299 | iso_pu_bacteria | 2945909444 | 2945915127 | 157 |
| 300 | iso_pu_bacteria | 2945945610 | 2945950853 | 157 |
| 301 | iso_pu_bacteria | 2945972063 | 2945974517 | 157 |
| 302 | iso_pu_bacteria | 2945984333 | 2945989461 | 157 |
| 303 | iso_pu_bacteria | 2954767861 | 2954769747 | 157 |
| 304 | iso_pu_bacteria | 2974320154 | 2974321713 | 157 |
| 305 | 3300005354 | Ga0070675_100781420 | Ga0070675_1007814202 | 158 |
| 306 | 3300005548 | Ga0070665_100198421 | Ga0070665_1001984212 | 158 |
| 307 | 3300025940 | Ga0207691_11057825 | Ga0207691_110578251 | 158 |
| 308 | 3300028379 | Ga0268266_10506274 | Ga0268266_105062742 | 158 |
| 309 | 3300031456 | Ga0307513_10569827 | Ga0307513_105698271 | 158 |
| 310 | 3300046471 | Ga0495650_0026896 | Ga0495650_0026896_1959_2435 | 158 |
| 311 | iso_pu_bacteria | 2721755523 | 2722886293 | 158 |
| 312 | iso_pu_bacteria | 2839138175 | 2839141926 | 158 |
| 313 | iso_pu_bacteria | 2842718218 | 2842720845 | 158 |
| 314 | 3300021361 | Ga0213872_10006498 | Ga0213872_100064981 | 159 |
| 315 | 3300036401 | Ga0373937_0851268 | Ga0373937_0851268_49_552 | 159 |
| 316 | 3300039447 | Ga0436361_0752278 | Ga0436361_0752278_2391_2873 | 159 |
| 317 | 3300045051 | Ga0451576_1044719 | Ga0451576_1044719_165_668 | 159 |
| 318 | 3300046530 | Ga0495654_0000621 | Ga0495654_0000621_737_1309 | 159 |
| 319 | 3300046558 | Ga0495633_0005245 | Ga0495633_0005245_6879_7367 | 159 |
| 320 | 3300048925 | Ga0496122_0209463 | Ga0496122_0209463_613_1101 | 159 |
| 321 | 3300048926 | Ga0496123_0305665 | Ga0496123_0305665_191_679 | 159 |
| 322 | 3300048928 | Ga0496125_0225817 | Ga0496125_0225817_628_1164 | 159 |
| 323 | 3300053161 | Ga0500634_0015287 | Ga0500634_0015287_401_883 | 159 |
| 324 | 3300053730 | Ga0500645_005572 | Ga0500645_005572_3102_3584 | 159 |
| 325 | 3300053730 | Ga0500645_054454 | Ga0500645_054454_312_821 | 159 |
| 326 | 3300005289 | Ga0065704_10084500 | Ga0065704_100845002 | 160 |
| 327 | 3300005353 | Ga0070669_100187802 | Ga0070669_1001878022 | 160 |
| 328 | 3300005616 | Ga0068852_100676482 | Ga0068852_1006764822 | 160 |
| 329 | 3300006048 | Ga0075363_100098472 | Ga0075363_1000984722 | 160 |
| 330 | 3300006177 | Ga0075362_10048119 | Ga0075362_100481192 | 160 |
| 331 | 3300006195 | Ga0075366_10012228 | Ga0075366_100122282 | 160 |
| 332 | 3300006353 | Ga0075370_10172051 | Ga0075370_101720512 | 160 |
| 333 | 3300006946 | Ga0079104_1000027 | Ga0079104_1000027184 | 160 |
| 334 | 3300009092 | Ga0105250_10000066 | Ga0105250_1000006650 | 160 |
| 335 | 3300009148 | Ga0105243_10031178 | Ga0105243_100311784 | 160 |
| 336 | 3300014497 | Ga0182008_10000678 | Ga0182008_100006782 | 160 |
| 337 | 3300014497 | Ga0182008_10247719 | Ga0182008_102477191 | 160 |
| 338 | 3300025923 | Ga0207681_10147296 | Ga0207681_101472962 | 160 |
| 339 | 3300026142 | Ga0207698_11851123 | Ga0207698_118511231 | 160 |
| 340 | 3300042015 | Ga0439462_0006865 | Ga0439462_0006865_1741_2259 | 160 |
| 341 | 3300047470 | Ga0495681_0071440 | Ga0495681_0071440_568_1050 | 160 |
| 342 | 3300048920 | Ga0496117_0478385 | Ga0496117_0478385_108_590 | 160 |
| 343 | 3300048921 | Ga0496118_0440882 | Ga0496118_0440882_61_543 | 160 |
| 344 | 3300048925 | Ga0496122_0004040 | Ga0496122_0004040_669_1151 | 160 |
| 345 | 3300048925 | Ga0496122_0116737 | Ga0496122_0116737_402_905 | 160 |
| 346 | 3300048926 | Ga0496123_0000299 | Ga0496123_0000299_16091_16573 | 160 |
| 347 | 3300048926 | Ga0496123_0037156 | Ga0496123_0037156_1532_2035 | 160 |
| 348 | 3300048927 | Ga0496124_0108668 | Ga0496124_0108668_1224_1706 | 160 |
| 349 | 3300048928 | Ga0496125_0067718 | Ga0496125_0067718_1971_2474 | 160 |
| 350 | 3300048929 | Ga0496126_0099531 | Ga0496126_0099531_2031_2534 | 160 |
| 351 | 3300048929 | Ga0496126_0428956 | Ga0496126_0428956_355_858 | 160 |
| 352 | 3300049679 | Ga0501249_095343 | Ga0501249_095343_194_697 | 160 |
| 353 | 3300050489 | nmdc:mga03683_109197_c1 | nmdc:mga03683_109197_c1_707_1189 | 160 |
| 354 | 3300050493 | nmdc:mga0k408_210946_c1 | nmdc:mga0k408_210946_c1_601_1083 | 160 |
| 355 | 3300050494 | nmdc:mga06z11_704160_c1 | nmdc:mga06z11_704160_c1_109_591 | 160 |
| 356 | 3300050496 | nmdc:mga07m45_129869_c1 | nmdc:mga07m45_129869_c1_727_1209 | 160 |
| 357 | 3300053118 | Ga0500594_0059555 | Ga0500594_0059555_273_755 | 160 |
| 358 | 3300053136 | Ga0500559_0001099 | Ga0500559_0001099_714_1196 | 160 |
| 359 | 3300053140 | Ga0500573_0108765 | Ga0500573_0108765_601_1083 | 160 |
| 360 | iso_pu_bacteria | 2643221570 | 2643864517 | 160 |
| 361 | iso_pu_bacteria | 2643221596 | 2643992870 | 160 |
| 362 | iso_pu_bacteria | 2643221652 | 2644291792 | 160 |
| 363 | iso_pu_bacteria | 2738541307 | 2738881904 | 160 |
| 364 | iso_pu_bacteria | 2990710928 | 2990715096 | 160 |
| 365 | 3300001989 | JGI24739J22299_10019155 | JGI24739J22299_100191552 | 161 |
| 366 | 3300002987 | JGI25159J45721_1046946 | JGI25159J45721_10469461 | 161 |
| 367 | 3300003187 | JGI25151J46595_10034863 | JGI25151J46595_100348632 | 161 |
| 368 | 3300003316 | rootH1_10010984 | rootH1_100109841 | 161 |
| 369 | 3300003578 | Ga0006562J51391_1036397 | Ga0006562J51391_10363972 | 161 |
| 370 | 3300003578 | Ga0006562J51391_1036398 | Ga0006562J51391_10363986 | 161 |
| 371 | 3300003578 | Ga0006562J51391_1042796 | Ga0006562J51391_10427961 | 161 |
| 372 | 3300003578 | Ga0006562J51391_1042797 | Ga0006562J51391_10427971 | 161 |
| 373 | 3300003760 | Ga0055527_1009905 | Ga0055527_10099052 | 161 |
| 374 | 3300003761 | Ga0055535_1000185 | Ga0055535_100018560 | 161 |
| 375 | 3300003762 | Ga0055542_1000003 | Ga0055542_1000003228 | 161 |
| 376 | 3300003781 | Ga0055536_1014588 | Ga0055536_10145883 | 161 |
| 377 | 3300003784 | Ga0055534_1001656 | Ga0055534_10016568 | 161 |
| 378 | 3300003784 | Ga0055534_1008870 | Ga0055534_10088703 | 161 |
| 379 | 3300003790 | Ga0055528_1033773 | Ga0055528_10337732 | 161 |
| 380 | 3300003791 | Ga0055530_10021074 | Ga0055530_100210742 | 161 |
| 381 | 3300003792 | Ga0055540_1008854 | Ga0055540_10088543 | 161 |
| 382 | 3300003792 | Ga0055540_1019512 | Ga0055540_10195122 | 161 |
| 383 | 3300003794 | Ga0055531_10027994 | Ga0055531_100279942 | 161 |
| 384 | 3300003794 | Ga0055531_10029498 | Ga0055531_100294982 | 161 |
| 385 | 3300005288 | Ga0065714_10004635 | Ga0065714_100046352 | 161 |
| 386 | 3300005334 | Ga0068869_100254596 | Ga0068869_1002545961 | 161 |
| 387 | 3300005356 | Ga0070674_100287507 | Ga0070674_1002875072 | 161 |
| 388 | 3300005366 | Ga0070659_100232218 | Ga0070659_1002322182 | 161 |
| 389 | 3300005367 | Ga0070667_100316065 | Ga0070667_1003160652 | 161 |
| 390 | 3300005457 | Ga0070662_100054362 | Ga0070662_1000543622 | 161 |
| 391 | 3300005459 | Ga0068867_100381124 | Ga0068867_1003811242 | 161 |
| 392 | 3300005459 | Ga0068867_100742868 | Ga0068867_1007428681 | 161 |
| 393 | 3300005539 | Ga0068853_100257720 | Ga0068853_1002577202 | 161 |
| 394 | 3300005563 | Ga0068855_100300509 | Ga0068855_1003005092 | 161 |
| 395 | 3300005564 | Ga0070664_100009654 | Ga0070664_1000096543 | 161 |
| 396 | 3300005578 | Ga0068854_100105296 | Ga0068854_1001052963 | 161 |
| 397 | 3300005616 | Ga0068852_100591218 | Ga0068852_1005912182 | 161 |
| 398 | 3300005834 | Ga0068851_10002203 | Ga0068851_100022038 | 161 |
| 399 | 3300005844 | Ga0068862_100140296 | Ga0068862_1001402962 | 161 |
| 400 | 3300006038 | Ga0075365_10006832 | Ga0075365_100068328 | 161 |
| 401 | 3300006048 | Ga0075363_100392777 | Ga0075363_1003927772 | 161 |
| 402 | 3300006051 | Ga0075364_10668030 | Ga0075364_106680302 | 161 |
| 403 | 3300006177 | Ga0075362_10012458 | Ga0075362_100124583 | 161 |
| 404 | 3300006177 | Ga0075362_10268775 | Ga0075362_102687752 | 161 |
| 405 | 3300006177 | Ga0075362_10334849 | Ga0075362_103348492 | 161 |
| 406 | 3300006178 | Ga0075367_10075113 | Ga0075367_100751133 | 161 |
| 407 | 3300006186 | Ga0075369_10072866 | Ga0075369_100728662 | 161 |
| 408 | 3300006195 | Ga0075366_10013797 | Ga0075366_100137976 | 161 |
| 409 | 3300006195 | Ga0075366_10169783 | Ga0075366_101697831 | 161 |
| 410 | 3300006195 | Ga0075366_10490251 | Ga0075366_104902511 | 161 |
| 411 | 3300006353 | Ga0075370_10004750 | Ga0075370_100047508 | 161 |
| 412 | 3300006353 | Ga0075370_10042241 | Ga0075370_100422413 | 161 |
| 413 | 3300006353 | Ga0075370_10085117 | Ga0075370_100851172 | 161 |
| 414 | 3300006353 | Ga0075370_10109614 | Ga0075370_101096143 | 161 |
| 415 | 3300006353 | Ga0075370_10290068 | Ga0075370_102900681 | 161 |
| 416 | 3300006353 | Ga0075370_10412621 | Ga0075370_104126212 | 161 |
| 417 | 3300006353 | Ga0075370_10438553 | Ga0075370_104385532 | 161 |
| 418 | 3300006358 | Ga0068871_100457443 | Ga0068871_1004574432 | 161 |
| 419 | 3300006948 | Ga0099826_10024823 | Ga0099826_100248232 | 161 |
| 420 | 3300009036 | Ga0105244_10021367 | Ga0105244_100213672 | 161 |
| 421 | 3300009093 | Ga0105240_10866582 | Ga0105240_108665821 | 161 |
| 422 | 3300009148 | Ga0105243_10006239 | Ga0105243_100062392 | 161 |
| 423 | 3300009148 | Ga0105243_10734063 | Ga0105243_107340632 | 161 |
| 424 | 3300009176 | Ga0105242_10000434 | Ga0105242_100004341 | 161 |
| 425 | 3300009176 | Ga0105242_10234151 | Ga0105242_102341512 | 161 |
| 426 | 3300009177 | Ga0105248_11147409 | Ga0105248_111474092 | 161 |
| 427 | 3300009545 | Ga0105237_10097372 | Ga0105237_100973722 | 161 |
| 428 | 3300009551 | Ga0105238_10372500 | Ga0105238_103725002 | 161 |
| 429 | 3300009551 | Ga0105238_10461287 | Ga0105238_104612872 | 161 |
| 430 | 3300009551 | Ga0105238_11687689 | Ga0105238_116876891 | 161 |
| 431 | 3300010375 | Ga0105239_10778653 | Ga0105239_107786532 | 161 |
| 432 | 3300010375 | Ga0105239_11150057 | Ga0105239_111500572 | 161 |
| 433 | 3300011119 | Ga0105246_10135775 | Ga0105246_101357752 | 161 |
| 434 | 3300011119 | Ga0105246_10306065 | Ga0105246_103060652 | 161 |
| 435 | 3300012502 | Ga0157347_1001667 | Ga0157347_10016673 | 161 |
| 436 | 3300012502 | Ga0157347_1004962 | Ga0157347_10049622 | 161 |
| 437 | 3300012502 | Ga0157347_1028748 | Ga0157347_10287481 | 161 |
| 438 | 3300012505 | Ga0157339_1000815 | Ga0157339_10008151 | 161 |
| 439 | 3300013100 | Ga0157373_10022558 | Ga0157373_100225586 | 161 |
| 440 | 3300013100 | Ga0157373_10184960 | Ga0157373_101849602 | 161 |
| 441 | 3300013102 | Ga0157371_10030125 | Ga0157371_100301254 | 161 |
| 442 | 3300013104 | Ga0157370_10023750 | Ga0157370_100237508 | 161 |
| 443 | 3300013104 | Ga0157370_10176975 | Ga0157370_101769752 | 161 |
| 444 | 3300013104 | Ga0157370_10456404 | Ga0157370_104564042 | 161 |
| 445 | 3300013105 | Ga0157369_10094259 | Ga0157369_100942592 | 161 |
| 446 | 3300013297 | Ga0157378_11855496 | Ga0157378_118554961 | 161 |
| 447 | 3300013308 | Ga0157375_10636985 | Ga0157375_106369852 | 161 |
| 448 | 3300014497 | Ga0182008_10013895 | Ga0182008_100138952 | 161 |
| 449 | 3300014497 | Ga0182008_10153357 | Ga0182008_101533572 | 161 |
| 450 | 3300015261 | Ga0182006_1004961 | Ga0182006_10049612 | 161 |
| 451 | 3300015261 | Ga0182006_1046371 | Ga0182006_10463712 | 161 |
| 452 | 3300015261 | Ga0182006_1168623 | Ga0182006_11686231 | 161 |
| 453 | 3300015262 | Ga0182007_10005210 | Ga0182007_100052102 | 161 |
| 454 | 3300015262 | Ga0182007_10133678 | Ga0182007_101336781 | 161 |
| 455 | 3300017792 | Ga0163161_10004734 | Ga0163161_100047342 | 161 |
| 456 | 3300017792 | Ga0163161_10071218 | Ga0163161_100712183 | 161 |
| 457 | 3300017792 | Ga0163161_10494540 | Ga0163161_104945401 | 161 |
| 458 | 3300017792 | Ga0163161_10918413 | Ga0163161_109184131 | 161 |
| 459 | 3300025228 | Ga0209672_100279 | Ga0209672_10027932 | 161 |
| 460 | 3300025229 | Ga0209147_101464 | Ga0209147_1014642 | 161 |
| 461 | 3300025242 | Ga0209258_100015 | Ga0209258_100015347 | 161 |
| 462 | 3300025245 | Ga0207425_1010199 | Ga0207425_10101992 | 161 |
| 463 | 3300025254 | Ga0209148_1000028 | Ga0209148_1000028322 | 161 |
| 464 | 3300025258 | Ga0209129_1000160 | Ga0209129_100016084 | 161 |
| 465 | 3300025258 | Ga0209129_1021955 | Ga0209129_10219552 | 161 |
| 466 | 3300025258 | Ga0209129_1025122 | Ga0209129_10251222 | 161 |
| 467 | 3300025263 | Ga0209565_1000236 | Ga0209565_100023661 | 161 |
| 468 | 3300025263 | Ga0209565_1000762 | Ga0209565_10007628 | 161 |
| 469 | 3300025263 | Ga0209565_1002449 | Ga0209565_10024492 | 161 |
| 470 | 3300025273 | Ga0209673_1000286 | Ga0209673_100028675 | 161 |
| 471 | 3300025273 | Ga0209673_1000556 | Ga0209673_100055661 | 161 |
| 472 | 3300025273 | Ga0209673_1010331 | Ga0209673_10103314 | 161 |
| 473 | 3300025284 | Ga0209130_1000760 | Ga0209130_100076024 | 161 |
| 474 | 3300025284 | Ga0209130_1001309 | Ga0209130_100130914 | 161 |
| 475 | 3300025291 | Ga0209675_1001227 | Ga0209675_10012278 | 161 |
| 476 | 3300025291 | Ga0209675_1001556 | Ga0209675_10015567 | 161 |
| 477 | 3300025292 | Ga0209676_1000074 | Ga0209676_1000074109 | 161 |
| 478 | 3300025292 | Ga0209676_1000660 | Ga0209676_10006602 | 161 |
| 479 | 3300025292 | Ga0209676_1024158 | Ga0209676_10241582 | 161 |
| 480 | 3300025292 | Ga0209676_1049399 | Ga0209676_10493992 | 161 |
| 481 | 3300025294 | Ga0209025_1000269 | Ga0209025_100026934 | 161 |
| 482 | 3300025294 | Ga0209025_1000349 | Ga0209025_100034910 | 161 |
| 483 | 3300025294 | Ga0209025_1000846 | Ga0209025_100084651 | 161 |
| 484 | 3300025294 | Ga0209025_1015579 | Ga0209025_10155795 | 161 |
| 485 | 3300025295 | Ga0209564_1000294 | Ga0209564_100029410 | 161 |
| 486 | 3300025295 | Ga0209564_1001177 | Ga0209564_100117722 | 161 |
| 487 | 3300025297 | Ga0209758_1000039 | Ga0209758_1000039326 | 161 |
| 488 | 3300025298 | Ga0209050_1000015 | Ga0209050_1000015361 | 161 |
| 489 | 3300025298 | Ga0209050_1008576 | Ga0209050_10085766 | 161 |
| 490 | 3300025299 | Ga0209256_1000136 | Ga0209256_100013678 | 161 |
| 491 | 3300025299 | Ga0209256_1000230 | Ga0209256_100023010 | 161 |
| 492 | 3300025302 | Ga0207426_1000108 | Ga0207426_100010864 | 161 |
| 493 | 3300025302 | Ga0207426_1000130 | Ga0207426_100013040 | 161 |
| 494 | 3300025302 | Ga0207426_1001644 | Ga0207426_10016443 | 161 |
| 495 | 3300025303 | Ga0209051_1000010 | Ga0209051_1000010361 | 161 |
| 496 | 3300025303 | Ga0209051_1000508 | Ga0209051_100050853 | 161 |
| 497 | 3300025303 | Ga0209051_1006759 | Ga0209051_10067592 | 161 |
| 498 | 3300025303 | Ga0209051_1007004 | Ga0209051_10070042 | 161 |
| 499 | 3300025304 | Ga0209257_1000026 | Ga0209257_1000026316 | 161 |
| 500 | 3300025304 | Ga0209257_1000582 | Ga0209257_10005827 | 161 |
| 501 | 3300025321 | Ga0207656_10006596 | Ga0207656_100065962 | 161 |
| 502 | 3300025728 | Ga0207655_1030413 | Ga0207655_10304133 | 161 |
| 503 | 3300025913 | Ga0207695_10156165 | Ga0207695_101561653 | 161 |
| 504 | 3300025914 | Ga0207671_10124182 | Ga0207671_101241821 | 161 |
| 505 | 3300025924 | Ga0207694_10532113 | Ga0207694_105321132 | 161 |
| 506 | 3300025924 | Ga0207694_10845533 | Ga0207694_108455332 | 161 |
| 507 | 3300025932 | Ga0207690_10311350 | Ga0207690_103113502 | 161 |
| 508 | 3300025932 | Ga0207690_10479976 | Ga0207690_104799762 | 161 |
| 509 | 3300025933 | Ga0207706_10006769 | Ga0207706_1000676911 | 161 |
| 510 | 3300025934 | Ga0207686_10000514 | Ga0207686_100005149 | 161 |
| 511 | 3300025935 | Ga0207709_10000196 | Ga0207709_1000019664 | 161 |
| 512 | 3300025935 | Ga0207709_10001898 | Ga0207709_100018987 | 161 |
| 513 | 3300025940 | Ga0207691_10124859 | Ga0207691_101248593 | 161 |
| 514 | 3300025945 | Ga0207679_10010437 | Ga0207679_100104377 | 161 |
| 515 | 3300025949 | Ga0207667_10382272 | Ga0207667_103822722 | 161 |
| 516 | 3300025960 | Ga0207651_10522677 | Ga0207651_105226771 | 161 |
| 517 | 3300025981 | Ga0207640_10112498 | Ga0207640_101124982 | 161 |
| 518 | 3300025981 | Ga0207640_10535080 | Ga0207640_105350802 | 161 |
| 519 | 3300025986 | Ga0207658_10978435 | Ga0207658_109784351 | 161 |
| 520 | 3300026041 | Ga0207639_10507779 | Ga0207639_105077792 | 161 |
| 521 | 3300026041 | Ga0207639_10914176 | Ga0207639_109141762 | 161 |
| 522 | 3300026089 | Ga0207648_10249653 | Ga0207648_102496532 | 161 |
| 523 | 3300026116 | Ga0207674_10620974 | Ga0207674_106209741 | 161 |
| 524 | 3300026142 | Ga0207698_10606857 | Ga0207698_106068572 | 161 |
| 525 | 3300026142 | Ga0207698_10857888 | Ga0207698_108578882 | 161 |
| 526 | 3300027666 | Ga0209282_1014933 | Ga0209282_10149332 | 161 |
| 527 | 3300028379 | Ga0268266_11529798 | Ga0268266_115297981 | 161 |
| 528 | 3300028380 | Ga0268265_10032859 | Ga0268265_100328592 | 161 |
| 529 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034160 | 161 |
| 530 | 3300028794 | Ga0307515_10367645 | Ga0307515_103676452 | 161 |
| 531 | 3300030522 | Ga0307512_10144232 | Ga0307512_101442322 | 161 |
| 532 | 3300030731 | Ga0316177_1160851 | Ga0316177_11608512 | 161 |
| 533 | 3300030733 | Ga0314311_1136520 | Ga0314311_11365203 | 161 |
| 534 | 3300030734 | Ga0316179_1021038 | Ga0316179_10210386 | 161 |
| 535 | 3300030735 | Ga0316178_1049500 | Ga0316178_10495003 | 161 |
| 536 | 3300030736 | Ga0316180_1114921 | Ga0316180_11149213 | 161 |
| 537 | 3300030742 | Ga0316183_1095156 | Ga0316183_10951563 | 161 |
| 538 | 3300030744 | Ga0316181_1044905 | Ga0316181_10449051 | 161 |
| 539 | 3300030745 | Ga0316182_1067661 | Ga0316182_10676613 | 161 |
| 540 | 3300031456 | Ga0307513_10240433 | Ga0307513_102404332 | 161 |
| 541 | 3300031456 | Ga0307513_10282848 | Ga0307513_102828481 | 161 |
| 542 | 3300031548 | Ga0307408_100253553 | Ga0307408_1002535532 | 161 |
| 543 | 3300031548 | Ga0307408_100497447 | Ga0307408_1004974472 | 161 |
| 544 | 3300031548 | Ga0307408_101145858 | Ga0307408_1011458581 | 161 |
| 545 | 3300031649 | Ga0307514_10046039 | Ga0307514_100460392 | 161 |
| 546 | 3300031731 | Ga0307405_10175874 | Ga0307405_101758741 | 161 |
| 547 | 3300031731 | Ga0307405_10253973 | Ga0307405_102539731 | 161 |
| 548 | 3300031731 | Ga0307405_10342983 | Ga0307405_103429832 | 161 |
| 549 | 3300031731 | Ga0307405_10521143 | Ga0307405_105211432 | 161 |
| 550 | 3300031731 | Ga0307405_10643483 | Ga0307405_106434832 | 161 |
| 551 | 3300031852 | Ga0307410_10738796 | Ga0307410_107387961 | 161 |
| 552 | 3300031901 | Ga0307406_10015213 | Ga0307406_100152132 | 161 |
| 553 | 3300031901 | Ga0307406_10254655 | Ga0307406_102546552 | 161 |
| 554 | 3300031901 | Ga0307406_10294655 | Ga0307406_102946552 | 161 |
| 555 | 3300031903 | Ga0307407_10060640 | Ga0307407_100606402 | 161 |
| 556 | 3300031911 | Ga0307412_10008099 | Ga0307412_100080997 | 161 |
| 557 | 3300031911 | Ga0307412_10016738 | Ga0307412_100167385 | 161 |
| 558 | 3300031911 | Ga0307412_10029604 | Ga0307412_100296042 | 161 |
| 559 | 3300031911 | Ga0307412_11040098 | Ga0307412_110400981 | 161 |
| 560 | 3300032002 | Ga0307416_100021408 | Ga0307416_1000214086 | 161 |
| 561 | 3300032004 | Ga0307414_10077610 | Ga0307414_100776102 | 161 |
| 562 | 3300032005 | Ga0307411_10019572 | Ga0307411_100195722 | 161 |
| 563 | 3300032005 | Ga0307411_10361232 | Ga0307411_103612322 | 161 |
| 564 | 3300032005 | Ga0307411_10468346 | Ga0307411_104683461 | 161 |
| 565 | 3300032005 | Ga0307411_10542760 | Ga0307411_105427602 | 161 |
| 566 | 3300041404 | Ga0439436_0010239 | Ga0439436_0010239_625_1110 | 161 |
| 567 | 3300041404 | Ga0439436_0043042 | Ga0439436_0043042_404_889 | 161 |
| 568 | 3300041404 | Ga0439436_0116821 | Ga0439436_0116821_170_697 | 161 |
| 569 | 3300041406 | Ga0439439_0021934 | Ga0439439_0021934_762_1247 | 161 |
| 570 | 3300041406 | Ga0439439_0179706 | Ga0439439_0179706_32_547 | 161 |
| 571 | 3300041407 | Ga0439447_027490 | Ga0439447_027490_812_1297 | 161 |
| 572 | 3300041411 | Ga0439466_0004652 | Ga0439466_0004652_345_830 | 161 |
| 573 | 3300041411 | Ga0439466_0016643 | Ga0439466_0016643_794_1279 | 161 |
| 574 | 3300041411 | Ga0439466_0033329 | Ga0439466_0033329_522_1049 | 161 |
| 575 | 3300041413 | Ga0439465_0013074 | Ga0439465_0013074_833_1360 | 161 |
| 576 | 3300041413 | Ga0439465_0047663 | Ga0439465_0047663_621_1106 | 161 |
| 577 | 3300041999 | Ga0439433_0020920 | Ga0439433_0020920_436_921 | 161 |
| 578 | 3300041999 | Ga0439433_0026023 | Ga0439433_0026023_290_817 | 161 |
| 579 | 3300042002 | Ga0439442_002482 | Ga0439442_002482_493_978 | 161 |
| 580 | 3300042002 | Ga0439442_010805 | Ga0439442_010805_457_984 | 161 |
| 581 | 3300042004 | Ga0439445_0007766 | Ga0439445_0007766_271_798 | 161 |
| 582 | 3300042006 | Ga0439432_012486 | Ga0439432_012486_450_977 | 161 |
| 583 | 3300042006 | Ga0439432_097085 | Ga0439432_097085_241_756 | 161 |
| 584 | 3300042006 | Ga0439432_118344 | Ga0439432_118344_290_775 | 161 |
| 585 | 3300042007 | Ga0439449_0015271 | Ga0439449_0015271_706_1233 | 161 |
| 586 | 3300042007 | Ga0439449_0066857 | Ga0439449_0066857_342_857 | 161 |
| 587 | 3300042007 | Ga0439449_0115149 | Ga0439449_0115149_322_807 | 161 |
| 588 | 3300042010 | Ga0439452_027246 | Ga0439452_027246_197_682 | 161 |
| 589 | 3300042010 | Ga0439452_037736 | Ga0439452_037736_398_925 | 161 |
| 590 | 3300042014 | Ga0439457_017730 | Ga0439457_017730_435_962 | 161 |
| 591 | 3300042015 | Ga0439462_0003296 | Ga0439462_0003296_771_1256 | 161 |
| 592 | 3300042015 | Ga0439462_0007334 | Ga0439462_0007334_1525_2052 | 161 |
| 593 | 3300042121 | Ga0450919_005996 | Ga0450919_005996_523_1008 | 161 |
| 594 | 3300042122 | Ga0450920_029078 | Ga0450920_029078_15_500 | 161 |
| 595 | 3300042123 | Ga0450921_004453 | Ga0450921_004453_477_962 | 161 |
| 596 | 3300042124 | Ga0450922_012905 | Ga0450922_012905_11_496 | 161 |
| 597 | 3300042125 | Ga0450923_001463 | Ga0450923_001463_2157_2642 | 161 |
| 598 | 3300042125 | Ga0450923_003973 | Ga0450923_003973_1059_1544 | 161 |
| 599 | 3300042127 | Ga0450890_015202 | Ga0450890_015202_457_942 | 161 |
| 600 | 3300042134 | Ga0450898_019800 | Ga0450898_019800_181_666 | 161 |
| 601 | 3300042135 | Ga0450899_012102 | Ga0450899_012102_77_562 | 161 |
| 602 | 3300042145 | Ga0450906_001977 | Ga0450906_001977_549_1034 | 161 |
| 603 | 3300042145 | Ga0450906_006491 | Ga0450906_006491_1606_2091 | 161 |
| 604 | 3300042145 | Ga0450906_092812 | Ga0450906_092812_45_530 | 161 |
| 605 | 3300042146 | Ga0450907_014026 | Ga0450907_014026_561_1046 | 161 |
| 606 | 3300042147 | Ga0450910_001170 | Ga0450910_001170_2076_2561 | 161 |
| 607 | 3300042147 | Ga0450910_022332 | Ga0450910_022332_35_520 | 161 |
| 608 | 3300042156 | Ga0439446_0016081 | Ga0439446_0016081_1574_2059 | 161 |
| 609 | 3300042156 | Ga0439446_0055804 | Ga0439446_0055804_448_933 | 161 |
| 610 | 3300042156 | Ga0439446_0116802 | Ga0439446_0116802_255_740 | 161 |
| 611 | 3300042184 | Ga0450908_001728 | Ga0450908_001728_3609_4094 | 161 |
| 612 | 3300042184 | Ga0450908_069573 | Ga0450908_069573_61_576 | 161 |
| 613 | 3300042185 | Ga0450909_027013 | Ga0450909_027013_10_495 | 161 |
| 614 | 3300042435 | Ga0439434_0025840 | Ga0439434_0025840_814_1299 | 161 |
| 615 | 3300042435 | Ga0439434_0128389 | Ga0439434_0128389_272_757 | 161 |
| 616 | 3300042532 | Ga0450893_0036100 | Ga0450893_0036100_255_770 | 161 |
| 617 | 3300042532 | Ga0450893_0084924 | Ga0450893_0084924_124_609 | 161 |
| 618 | 3300044683 | Ga0466965_0064383 | Ga0466965_0064383_655_1140 | 161 |
| 619 | 3300046453 | Ga0495627_054851 | Ga0495627_054851_302_787 | 161 |
| 620 | 3300046459 | Ga0495629_0217985 | Ga0495629_0217985_377_862 | 161 |
| 621 | 3300046512 | Ga0495610_0019169 | Ga0495610_0019169_2853_3338 | 161 |
| 622 | 3300046513 | Ga0495616_0012846 | Ga0495616_0012846_764_1249 | 161 |
| 623 | 3300046515 | Ga0495620_0006122 | Ga0495620_0006122_135_620 | 161 |
| 624 | 3300046515 | Ga0495620_0158380 | Ga0495620_0158380_159_644 | 161 |
| 625 | 3300046518 | Ga0495631_0000256 | Ga0495631_0000256_35687_36172 | 161 |
| 626 | 3300046520 | Ga0495637_0051611 | Ga0495637_0051611_873_1358 | 161 |
| 627 | 3300046520 | Ga0495637_0068665 | Ga0495637_0068665_570_1055 | 161 |
| 628 | 3300046530 | Ga0495654_0106953 | Ga0495654_0106953_194_679 | 161 |
| 629 | 3300046530 | Ga0495654_0229266 | Ga0495654_0229266_170_655 | 161 |
| 630 | 3300046539 | Ga0495621_0116679 | Ga0495621_0116679_57_542 | 161 |
| 631 | 3300046543 | Ga0495645_0481213 | Ga0495645_0481213_28_513 | 161 |
| 632 | 3300046557 | Ga0495622_0076921 | Ga0495622_0076921_514_999 | 161 |
| 633 | 3300046615 | Ga0495656_0050762 | Ga0495656_0050762_560_1075 | 161 |
| 634 | 3300046616 | Ga0495668_0128526 | Ga0495668_0128526_179_664 | 161 |
| 635 | 3300046660 | Ga0495625_0002053 | Ga0495625_0002053_21298_21786 | 161 |
| 636 | 3300046660 | Ga0495625_0053668 | Ga0495625_0053668_586_1071 | 161 |
| 637 | 3300046660 | Ga0495625_0300430 | Ga0495625_0300430_399_884 | 161 |
| 638 | 3300046674 | Ga0495588_0045339 | Ga0495588_0045339_736_1221 | 161 |
| 639 | 3300046692 | Ga0495671_0011758 | Ga0495671_0011758_3854_4339 | 161 |
| 640 | 3300047321 | Ga0495676_0019988 | Ga0495676_0019988_655_1140 | 161 |
| 641 | 3300047321 | Ga0495676_0598398 | Ga0495676_0598398_30_515 | 161 |
| 642 | 3300047445 | Ga0495677_0369791 | Ga0495677_0369791_29_514 | 161 |
| 643 | 3300048089 | Ga0495614_0079526 | Ga0495614_0079526_198_683 | 161 |
| 644 | 3300048904 | Ga0496101_0031565 | Ga0496101_0031565_23_508 | 161 |
| 645 | 3300048906 | Ga0496103_0281559 | Ga0496103_0281559_178_663 | 161 |
| 646 | 3300048919 | Ga0496116_0051765 | Ga0496116_0051765_1513_1998 | 161 |
| 647 | 3300048919 | Ga0496116_0198431 | Ga0496116_0198431_518_1003 | 161 |
| 648 | 3300048920 | Ga0496117_0017454 | Ga0496117_0017454_450_935 | 161 |
| 649 | 3300048921 | Ga0496118_0013419 | Ga0496118_0013419_6570_7055 | 161 |
| 650 | 3300048921 | Ga0496118_0179237 | Ga0496118_0179237_194_679 | 161 |
| 651 | 3300048921 | Ga0496118_0236035 | Ga0496118_0236035_183_668 | 161 |
| 652 | 3300048922 | Ga0496119_0107545 | Ga0496119_0107545_457_942 | 161 |
| 653 | 3300048924 | Ga0496121_0036944 | Ga0496121_0036944_3527_4012 | 161 |
| 654 | 3300048924 | Ga0496121_0185498 | Ga0496121_0185498_334_819 | 161 |
| 655 | 3300048925 | Ga0496122_0155898 | Ga0496122_0155898_412_906 | 161 |
| 656 | 3300048925 | Ga0496122_0379276 | Ga0496122_0379276_180_665 | 161 |
| 657 | 3300048926 | Ga0496123_0133813 | Ga0496123_0133813_720_1205 | 161 |
| 658 | 3300048926 | Ga0496123_0136599 | Ga0496123_0136599_683_1168 | 161 |
| 659 | 3300048927 | Ga0496124_0097061 | Ga0496124_0097061_1072_1557 | 161 |
| 660 | 3300048927 | Ga0496124_0226336 | Ga0496124_0226336_591_1076 | 161 |
| 661 | 3300048927 | Ga0496124_0354573 | Ga0496124_0354573_189_674 | 161 |
| 662 | 3300048928 | Ga0496125_0022015 | Ga0496125_0022015_4925_5410 | 161 |
| 663 | 3300048928 | Ga0496125_0339003 | Ga0496125_0339003_342_827 | 161 |
| 664 | 3300049679 | Ga0501249_005873 | Ga0501249_005873_267_752 | 161 |
| 665 | 3300049759 | Ga0501262_007342 | Ga0501262_007342_531_1016 | 161 |
| 666 | 3300050489 | nmdc:mga03683_120838_c1 | nmdc:mga03683_120838_c1_292_807 | 161 |
| 667 | 3300050489 | nmdc:mga03683_220982_c1 | nmdc:mga03683_220982_c1_365_850 | 161 |
| 668 | 3300050489 | nmdc:mga03683_326494_c1 | nmdc:mga03683_326494_c1_170_655 | 161 |
| 669 | 3300050489 | nmdc:mga03683_49428_c1 | nmdc:mga03683_49428_c1_370_855 | 161 |
| 670 | 3300050489 | nmdc:mga03683_85827_c1 | nmdc:mga03683_85827_c1_527_1015 | 161 |
| 671 | 3300050490 | nmdc:mga03n38_171949_c1 | nmdc:mga03n38_171949_c1_190_705 | 161 |
| 672 | 3300050492 | nmdc:mga0yw44_440297_c1 | nmdc:mga0yw44_440297_c1_58_543 | 161 |
| 673 | 3300050492 | nmdc:mga0yw44_54490_c1 | nmdc:mga0yw44_54490_c1_1201_1689 | 161 |
| 674 | 3300050493 | nmdc:mga0k408_141598_c1 | nmdc:mga0k408_141598_c1_582_1070 | 161 |
| 675 | 3300050493 | nmdc:mga0k408_548170_c1 | nmdc:mga0k408_548170_c1_53_541 | 161 |
| 676 | 3300050495 | nmdc:mga04h51_185002_c1 | nmdc:mga04h51_185002_c1_100_585 | 161 |
| 677 | 3300050496 | nmdc:mga07m45_145183_c1 | nmdc:mga07m45_145183_c1_686_1171 | 161 |
| 678 | 3300050496 | nmdc:mga07m45_33050_c1 | nmdc:mga07m45_33050_c1_1472_1957 | 161 |
| 679 | 3300050496 | nmdc:mga07m45_33830_c1 | nmdc:mga07m45_33830_c1_817_1302 | 161 |
| 680 | 3300050496 | nmdc:mga07m45_445738_c1 | nmdc:mga07m45_445738_c1_104_616 | 161 |
| 681 | 3300050496 | nmdc:mga07m45_58284_c1 | nmdc:mga07m45_58284_c1_146_631 | 161 |
| 682 | 3300050496 | nmdc:mga07m45_9309_c3 | nmdc:mga07m45_9309_c3_753_1238 | 161 |
| 683 | 3300050516 | nmdc:mga0sz30_106998_c1 | nmdc:mga0sz30_106998_c1_174_659 | 161 |
| 684 | 3300053079 | Ga0500610_0058278 | Ga0500610_0058278_166_651 | 161 |
| 685 | 3300053079 | Ga0500610_0110658 | Ga0500610_0110658_160_645 | 161 |
| 686 | 3300053079 | Ga0500610_0150115 | Ga0500610_0150115_337_822 | 161 |
| 687 | 3300053093 | Ga0500651_0000224 | Ga0500651_0000224_687_1172 | 161 |
| 688 | 3300053108 | Ga0500562_019544 | Ga0500562_019544_733_1218 | 161 |
| 689 | 3300053109 | Ga0500569_084456 | Ga0500569_084456_241_726 | 161 |
| 690 | 3300053110 | Ga0500571_000057 | Ga0500571_000057_33583_34068 | 161 |
| 691 | 3300053117 | Ga0500593_072603 | Ga0500593_072603_522_1007 | 161 |
| 692 | 3300053118 | Ga0500594_0021688 | Ga0500594_0021688_737_1222 | 161 |
| 693 | 3300053120 | Ga0500597_121806 | Ga0500597_121806_179_664 | 161 |
| 694 | 3300053121 | Ga0500607_016271 | Ga0500607_016271_668_1153 | 161 |
| 695 | 3300053122 | Ga0500608_071133 | Ga0500608_071133_448_933 | 161 |
| 696 | 3300053128 | Ga0500626_099685 | Ga0500626_099685_426_911 | 161 |
| 697 | 3300053133 | Ga0500655_000250 | Ga0500655_000250_11856_12341 | 161 |
| 698 | 3300053134 | Ga0500658_0007603 | Ga0500658_0007603_3277_3762 | 161 |
| 699 | 3300053136 | Ga0500559_0092987 | Ga0500559_0092987_435_920 | 161 |
| 700 | 3300053139 | Ga0500568_0090412 | Ga0500568_0090412_502_987 | 161 |
| 701 | 3300053153 | Ga0500616_0070652 | Ga0500616_0070652_601_1086 | 161 |
| 702 | 3300053158 | Ga0500627_0051141 | Ga0500627_0051141_688_1173 | 161 |
| 703 | 3300053161 | Ga0500634_0003846 | Ga0500634_0003846_6009_6494 | 161 |
| 704 | 3300053730 | Ga0500645_034756 | Ga0500645_034756_507_992 | 161 |
| 705 | 3300053735 | Ga0500596_019836 | Ga0500596_019836_413_898 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ia2-assembly3.cif.gz_D | the crystal structure of a putative transcriptional regulator rha06195 from rhodococcus sp. rha1 | 0.8961 | 58 | 102 |
| 5zup-assembly1.cif.gz_A | crystal structure of bz junction in diverse sequence | 0.8752 | 72 | 119 |
| 1z6r-assembly1.cif.gz_A | crystal structure of mlc from escherichia coli | 0.87 | 59 | 102 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.8673 | 60 | 117 |
| 2dk5-assembly1.cif.gz_A | solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide | 0.8664 | 59 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30852_292_361_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.928 | 62 | 102 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9089 | 57 | 117 | 1.10.10.10 |
| 5zuoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8992 | 72 | 119 | 1.10.10.10 |
| 1tdx001 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8974 | 72 | 127 | 1.10.10.10 |
| af_P32910_88_152_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8965 | 58 | 117 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G6X6L7-F1-model_v4 | DNA-binding transcriptional regulator, MarR family | 0.968 | 27 | 161 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A1G6X6L7-F1-model_v4 | DNA-binding transcriptional regulator, MarR family | 0.9543 | 27 | 161 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A7G6Z637-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9477 | 56 | 158 |
GO:0003700
|
| AF-A0A7Z0RKU0-F1-model_v4 | Winged helix DNA-binding protein | 0.9218 | 23 | 159 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A1W2CZN4-F1-model_v4 | DNA-binding transcriptional regulator, MarR family | 0.9204 | 19 | 161 |
GO:0003677
GO:0003700 GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar