F476412

General Info

Members Datasets Scaffolds Average Seq Length
705 393 645 162

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0366702|Ga0395899_0366702_261_833
Length 190
Sequence LVSLPYDLAMTTRVPDAGWRLTHLGRLLGHAARRFDERVLELMAHDIEVPLALANLAARGQVSAAHVHITRHVALEGSRLTDLARQAGMTKQAMGDLVDQCEAWGLVTRDPDPRDARGRVVRFTPAGLAWLQAFKDAVAQAETEFRQEVGDEVATVVQLGLEAYAGAWGAAPEGASRRKPTPTMNSRRGD

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221570 Acidovorax sp. Root568 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2721755523 Delftia sp. HK171 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541307 Variovorax sp. GV008 Isolate Unclassified
21 2738543012 Acidovorax sp. CF301 Isolate Unclassified
22 2738543013 Variovorax sp. BT01 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
31 2842733646 Variovorax sp. R-72446 Isolate Unclassified
32 2842747753 Variovorax sp. R-72060 Isolate Unclassified
33 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
34 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
35 2885198086 Variovorax sp. 679 Isolate Unclassified
36 2885211737 Variovorax sp. 553 Isolate Unclassified
37 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
40 2904456579 Variovorax sp. 2002 Isolate Unclassified
41 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
42 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
43 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
44 2928037797 Variovorax sp. 1126 Isolate Unclassified
45 2928044640 Variovorax sp. 1128 Isolate Unclassified
46 2928051484 Variovorax sp. 1133 Isolate Unclassified
47 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
48 2928070936 Variovorax gossypii 1167 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
54 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
55 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
56 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
57 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
58 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
59 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
65 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
66 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
77 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
127 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
128 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
200 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
201 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
202 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
203 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
204 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
205 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
206 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
239 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
240 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
246 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
247 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
248 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
249 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
250 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
253 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
257 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
260 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
261 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
262 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
263 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
264 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
265 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
266 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
267 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
268 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
269 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
270 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
271 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
272 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
273 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
274 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
275 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
276 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
277 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
278 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
279 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
280 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
368 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
369 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
373 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
374 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
375 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
376 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
377 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
378 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
379 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
380 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
388 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
389 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
390 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
391 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
392 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.92
Metatranscriptomes 0.57
Isolates 8.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.11
Nodule 0.71
Rhizoplane 2.7
Rhizosphere 58.58
Stem 0
Stem Tuber 0
Unclassified 13.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019155 3300001989 Bacteria 2453
2 JGI25159J45721_1046946 3300002987 Bacteria 605
3 JGI25151J46595_10034863 3300003187 Bacteria 1918
4 rootH1_10010984 3300003316 Bacteria 1666
5 Ga0006562J51391_1036397 3300003578 Bacteria 6670
6 Ga0006562J51391_1036398 3300003578 Bacteria 5370
7 Ga0006562J51391_1042796 3300003578 Bacteria 1085
8 Ga0006562J51391_1042797 3300003578 Bacteria 3240
9 Ga0055527_1009905 3300003760 Bacteria 1108
10 Ga0055535_1000185 3300003761 Bacteria 66514
11 Ga0055542_1000003 3300003762 Bacteria 582721
12 Ga0055536_1014588 3300003781 Bacteria 2744
13 Ga0055534_1001656 3300003784 Bacteria 8585
14 Ga0055534_1008870 3300003784 Bacteria 2235
15 Ga0055534_1016875 3300003784 Bacteria 1301
16 Ga0055528_1033773 3300003790 Bacteria 1274
17 Ga0055530_10021074 3300003791 Bacteria 1930
18 Ga0055540_1006578 3300003792 Bacteria 4578
19 Ga0055540_1008854 3300003792 Bacteria 3566
20 Ga0055540_1019512 3300003792 Bacteria 1822
21 Ga0055531_10001518 3300003794 Bacteria 17029
22 Ga0055531_10027994 3300003794 Bacteria 1957
23 Ga0055531_10029498 3300003794 Bacteria 1867
24 Ga0065714_10004635 3300005288 Bacteria 4640
25 Ga0065704_10084500 3300005289 Bacteria 3328
26 Ga0070676_10347716 3300005328 Bacteria 1018
27 Ga0070670_100077256 3300005331 Bacteria 2861
28 Ga0070677_10610832 3300005333 Bacteria 605
29 Ga0068869_100254596 3300005334 Bacteria 1403
30 Ga0070680_100058388 3300005336 Bacteria 3155
31 Ga0070680_100330402 3300005336 Bacteria 1295
32 Ga0070660_100131245 3300005339 Bacteria 2005
33 Ga0070668_100153959 3300005347 Bacteria 1861
34 Ga0070669_100187802 3300005353 Bacteria 1620
35 Ga0070675_100781420 3300005354 Bacteria 872
36 Ga0070674_100287507 3300005356 Bacteria 1306
37 Ga0070659_100232218 3300005366 Bacteria 1525
38 Ga0070667_100316065 3300005367 Bacteria 1409
39 Ga0070714_100588153 3300005435 Bacteria 1068
40 Ga0070662_100054362 3300005457 Bacteria 2901
41 Ga0068867_100381124 3300005459 Bacteria 1184
42 Ga0068867_100742868 3300005459 Bacteria 870
43 Ga0070679_100045747 3300005530 Bacteria 4361
44 Ga0070679_100084028 3300005530 Bacteria 3172
45 Ga0068853_100257720 3300005539 Bacteria 1602
46 Ga0070665_100198421 3300005548 Bacteria 2007
47 Ga0070665_100476381 3300005548 Bacteria 1259
48 Ga0070665_100684529 3300005548 Bacteria 1038
49 Ga0070665_100727244 3300005548 Bacteria 1006
50 Ga0068855_100300509 3300005563 Bacteria 1777
51 Ga0070664_100009654 3300005564 Bacteria 7828
52 Ga0068854_100105296 3300005578 Bacteria 2120
53 Ga0068852_100400241 3300005616 Bacteria 1350
54 Ga0068852_100591218 3300005616 Bacteria 1113
55 Ga0068852_100676482 3300005616 Bacteria 1041
56 Ga0068852_101595441 3300005616 Bacteria 675
57 Ga0068864_100100952 3300005618 Bacteria 2559
58 Ga0068864_100471246 3300005618 Bacteria 1204
59 Ga0068861_101220120 3300005719 Bacteria 728
60 Ga0068851_10002203 3300005834 Bacteria 8569
61 Ga0068863_100040189 3300005841 Bacteria 4448
62 Ga0068862_100140296 3300005844 Bacteria 2145
63 Ga0075365_10006832 3300006038 Bacteria 6325
64 Ga0075365_10122938 3300006038 Bacteria 1792
65 Ga0075363_100085120 3300006048 Bacteria 1734
66 Ga0075363_100098472 3300006048 Bacteria 1616
67 Ga0075363_100392777 3300006048 Bacteria 814
68 Ga0075363_100605577 3300006048 Bacteria 657
69 Ga0075364_10668030 3300006051 Bacteria 709
70 Ga0075362_10012458 3300006177 Bacteria 3379
71 Ga0075362_10027962 3300006177 Bacteria 2418
72 Ga0075362_10048119 3300006177 Bacteria 1901
73 Ga0075362_10268775 3300006177 Bacteria 841
74 Ga0075362_10334849 3300006177 Bacteria 755
75 Ga0075367_10075113 3300006178 Bacteria 2038
76 Ga0075367_10304368 3300006178 Bacteria 1004
77 Ga0075369_10072866 3300006186 Bacteria 1514
78 Ga0075366_10012228 3300006195 Bacteria 4866
79 Ga0075366_10013797 3300006195 Bacteria 4606
80 Ga0075366_10169783 3300006195 Bacteria 1323
81 Ga0075366_10199836 3300006195 Bacteria 1216
82 Ga0075366_10453407 3300006195 Bacteria 791
83 Ga0075366_10490251 3300006195 Bacteria 759
84 Ga0075366_10498901 3300006195 Bacteria 752
85 Ga0075370_10004750 3300006353 Bacteria 6645
86 Ga0075370_10042241 3300006353 Bacteria 2576
87 Ga0075370_10085117 3300006353 Bacteria 1820
88 Ga0075370_10109614 3300006353 Bacteria 1602
89 Ga0075370_10172051 3300006353 Bacteria 1273
90 Ga0075370_10290068 3300006353 Bacteria 972
91 Ga0075370_10325611 3300006353 Bacteria 916
92 Ga0075370_10412621 3300006353 Bacteria 811
93 Ga0075370_10424483 3300006353 Bacteria 799
94 Ga0075370_10432189 3300006353 Bacteria 791
95 Ga0075370_10438553 3300006353 Bacteria 785
96 Ga0075370_10470517 3300006353 Bacteria 757
97 Ga0075370_10491070 3300006353 Bacteria 740
98 Ga0068871_100457443 3300006358 Bacteria 1145
99 Ga0075430_100037061 3300006846 Bacteria 4133
100 Ga0079104_1000027 3300006946 Bacteria 212641
101 Ga0099826_10024823 3300006948 Bacteria 4450
102 Ga0105244_10021367 3300009036 Bacteria 3580
103 Ga0105250_10000066 3300009092 Bacteria 100012
104 Ga0105240_10044773 3300009093 Bacteria 5619
105 Ga0105240_10866582 3300009093 Bacteria 974
106 Ga0105243_10006239 3300009148 Bacteria 9212
107 Ga0105243_10031178 3300009148 Bacteria 4109
108 Ga0105243_10734063 3300009148 Bacteria 966
109 Ga0105242_10000434 3300009176 Bacteria 33374
110 Ga0105242_10234151 3300009176 Bacteria 1647
111 Ga0105248_11147409 3300009177 Bacteria 878
112 Ga0105237_10097372 3300009545 Bacteria 2932
113 Ga0105238_10372500 3300009551 Bacteria 1418
114 Ga0105238_10461287 3300009551 Bacteria 1268
115 Ga0105238_10726325 3300009551 Bacteria 1006
116 Ga0105238_11687689 3300009551 Bacteria 664
117 Ga0105239_10778653 3300010375 Bacteria 1096
118 Ga0105239_11150057 3300010375 Bacteria 894
119 Ga0105246_10135775 3300011119 Bacteria 1843
120 Ga0105246_10204304 3300011119 Bacteria 1538
121 Ga0105246_10306065 3300011119 Bacteria 1285
122 Ga0157322_1013657 3300012490 Bacteria 700
123 Ga0157347_1001667 3300012502 Bacteria 1788
124 Ga0157347_1004962 3300012502 Bacteria 1255
125 Ga0157347_1028748 3300012502 Bacteria 687
126 Ga0157339_1000815 3300012505 Bacteria 1716
127 Ga0157373_10022558 3300013100 Bacteria 4566
128 Ga0157373_10184960 3300013100 Bacteria 1468
129 Ga0157371_10030125 3300013102 Bacteria 3916
130 Ga0157370_10023750 3300013104 Bacteria 6084
131 Ga0157370_10176975 3300013104 Bacteria 1983
132 Ga0157370_10456404 3300013104 Bacteria 1175
133 Ga0157369_10094259 3300013105 Bacteria 3196
134 Ga0157378_10692548 3300013297 Bacteria 1038
135 Ga0157378_11855496 3300013297 Bacteria 651
136 Ga0163162_10314310 3300013306 Bacteria 1699
137 Ga0163162_10546576 3300013306 Bacteria 1287
138 Ga0157372_12072851 3300013307 Bacteria 654
139 Ga0157375_10636985 3300013308 Bacteria 1223
140 Ga0157375_10834797 3300013308 Bacteria 1069
141 Ga0182008_10000678 3300014497 Bacteria 24604
142 Ga0182008_10013895 3300014497 Bacteria 4226
143 Ga0182008_10016633 3300014497 Bacteria 3820
144 Ga0182008_10153357 3300014497 Bacteria 1156
145 Ga0182008_10247719 3300014497 Bacteria 918
146 Ga0157376_11012115 3300014969 Bacteria 854
147 Ga0182006_1004961 3300015261 Bacteria 6427
148 Ga0182006_1046371 3300015261 Bacteria 1688
149 Ga0182006_1168623 3300015261 Bacteria 734
150 Ga0182007_10005210 3300015262 Bacteria 5745
151 Ga0182007_10016821 3300015262 Bacteria 2688
152 Ga0182007_10133678 3300015262 Bacteria 836
153 Ga0163161_10004734 3300017792 Bacteria 9464
154 Ga0163161_10039115 3300017792 Bacteria 3403
155 Ga0163161_10071218 3300017792 Bacteria 2543
156 Ga0163161_10261274 3300017792 Bacteria 1352
157 Ga0163161_10494540 3300017792 Bacteria 995
158 Ga0163161_10918413 3300017792 Bacteria 743
159 Ga0213872_10006498 3300021361 Bacteria 5857
160 Ga0209672_100279 3300025228 Bacteria 37019
161 Ga0209147_101464 3300025229 Bacteria 8476
162 Ga0209258_100015 3300025242 Bacteria 706310
163 Ga0207425_1010199 3300025245 Bacteria 2298
164 Ga0209148_1000028 3300025254 Bacteria 582773
165 Ga0209129_1000160 3300025258 Bacteria 102457
166 Ga0209129_1021955 3300025258 Bacteria 1160
167 Ga0209129_1025122 3300025258 Bacteria 1041
168 Ga0209565_1000236 3300025263 Bacteria 60311
169 Ga0209565_1000762 3300025263 Bacteria 18882
170 Ga0209565_1002449 3300025263 Bacteria 6684
171 Ga0209673_1000286 3300025273 Bacteria 94581
172 Ga0209673_1000556 3300025273 Bacteria 59978
173 Ga0209673_1010331 3300025273 Bacteria 3942
174 Ga0209673_1049559 3300025273 Bacteria 1122
175 Ga0209130_1000760 3300025284 Bacteria 27940
176 Ga0209130_1001309 3300025284 Bacteria 17028
177 Ga0209130_1006552 3300025284 Bacteria 3762
178 Ga0209675_1000987 3300025291 Bacteria 18009
179 Ga0209675_1001227 3300025291 Bacteria 15467
180 Ga0209675_1001556 3300025291 Bacteria 13030
181 Ga0209675_1029576 3300025291 Bacteria 1317
182 Ga0209676_1000074 3300025292 Bacteria 305770
183 Ga0209676_1000660 3300025292 Bacteria 49420
184 Ga0209676_1007069 3300025292 Bacteria 5377
185 Ga0209676_1009793 3300025292 Bacteria 4082
186 Ga0209676_1024158 3300025292 Bacteria 1975
187 Ga0209676_1049399 3300025292 Bacteria 1117
188 Ga0209025_1000269 3300025294 Bacteria 121642
189 Ga0209025_1000349 3300025294 Bacteria 100055
190 Ga0209025_1000846 3300025294 Bacteria 48468
191 Ga0209025_1015579 3300025294 Bacteria 4567
192 Ga0209564_1000294 3300025295 Bacteria 100958
193 Ga0209564_1001177 3300025295 Bacteria 30362
194 Ga0209758_1000039 3300025297 Bacteria 428951
195 Ga0209050_1000015 3300025298 Bacteria 759102
196 Ga0209050_1008576 3300025298 Bacteria 5420
197 Ga0209256_1000136 3300025299 Bacteria 159047
198 Ga0209256_1000230 3300025299 Bacteria 100958
199 Ga0207426_1000108 3300025302 Bacteria 242257
200 Ga0207426_1000130 3300025302 Bacteria 210271
201 Ga0207426_1001644 3300025302 Bacteria 17444
202 Ga0209051_1000010 3300025303 Bacteria 641298
203 Ga0209051_1000508 3300025303 Bacteria 49345
204 Ga0209051_1001982 3300025303 Bacteria 15729
205 Ga0209051_1006199 3300025303 Bacteria 6780
206 Ga0209051_1006759 3300025303 Bacteria 6400
207 Ga0209051_1007004 3300025303 Bacteria 6247
208 Ga0209257_1000015 3300025304 Bacteria 908141
209 Ga0209257_1000026 3300025304 Bacteria 723225
210 Ga0209257_1000582 3300025304 Bacteria 61499
211 Ga0209257_1016051 3300025304 Bacteria 3058
212 Ga0207656_10006596 3300025321 Bacteria 4186
213 Ga0207655_1030413 3300025728 Bacteria 2511
214 Ga0207688_10297728 3300025901 Bacteria 986
215 Ga0207645_10172775 3300025907 Bacteria 1417
216 Ga0207705_10091665 3300025909 Bacteria 2226
217 Ga0207695_10046357 3300025913 Bacteria 4608
218 Ga0207695_10156165 3300025913 Bacteria 2216
219 Ga0207671_10124182 3300025914 Bacteria 1976
220 Ga0207657_10115072 3300025919 Bacteria 2217
221 Ga0207652_10029413 3300025921 Bacteria 4593
222 Ga0207652_10067117 3300025921 Bacteria 3110
223 Ga0207681_10147296 3300025923 Bacteria 1760
224 Ga0207694_10532113 3300025924 Bacteria 985
225 Ga0207694_10845533 3300025924 Bacteria 773
226 Ga0207690_10311350 3300025932 Bacteria 1235
227 Ga0207690_10479976 3300025932 Bacteria 1003
228 Ga0207706_10006769 3300025933 Bacteria 10596
229 Ga0207686_10000514 3300025934 Bacteria 25109
230 Ga0207709_10000196 3300025935 Bacteria 80952
231 Ga0207709_10001898 3300025935 Bacteria 13785
232 Ga0207669_10217354 3300025937 Bacteria 1400
233 Ga0207669_10495096 3300025937 Bacteria 977
234 Ga0207691_10124859 3300025940 Bacteria 2278
235 Ga0207691_11057825 3300025940 Bacteria 676
236 Ga0207679_10010437 3300025945 Bacteria 5981
237 Ga0207667_10079242 3300025949 Bacteria 3404
238 Ga0207667_10312346 3300025949 Bacteria 1605
239 Ga0207667_10382272 3300025949 Bacteria 1434
240 Ga0207651_10522677 3300025960 Bacteria 1029
241 Ga0207668_10438309 3300025972 Bacteria 1112
242 Ga0207640_10112498 3300025981 Bacteria 1933
243 Ga0207640_10535080 3300025981 Bacteria 982
244 Ga0207658_10080539 3300025986 Bacteria 2494
245 Ga0207658_10978435 3300025986 Bacteria 772
246 Ga0207677_10689201 3300026023 Bacteria 905
247 Ga0207639_10507779 3300026041 Bacteria 1102
248 Ga0207639_10914176 3300026041 Bacteria 820
249 Ga0207641_10046119 3300026088 Bacteria 3673
250 Ga0207648_10249653 3300026089 Bacteria 1582
251 Ga0207648_10327190 3300026089 Bacteria 1378
252 Ga0207676_10374011 3300026095 Bacteria 1324
253 Ga0207674_10620974 3300026116 Bacteria 1044
254 Ga0207683_10013814 3300026121 Bacteria 6885
255 Ga0207698_10606857 3300026142 Bacteria 1079
256 Ga0207698_10857888 3300026142 Bacteria 913
257 Ga0207698_11851123 3300026142 Bacteria 618
258 Ga0209282_1014933 3300027666 Bacteria 4946
259 Ga0209974_10028637 3300027876 Bacteria 1845
260 Ga0268266_10506274 3300028379 Bacteria 1153
261 Ga0268266_10707712 3300028379 Bacteria 971
262 Ga0268266_11226052 3300028379 Bacteria 725
263 Ga0268266_11529798 3300028379 Bacteria 643
264 Ga0268265_10032859 3300028380 Bacteria 3765
265 Ga0307515_10000034 3300028794 Bacteria 344640
266 Ga0307515_10000179 3300028794 Bacteria 156716
267 Ga0307515_10000222 3300028794 Bacteria 140902
268 Ga0307515_10001166 3300028794 Bacteria 60153
269 Ga0307515_10019026 3300028794 Bacteria 12392
270 Ga0307515_10367645 3300028794 Bacteria 1076
271 Ga0307512_10052380 3300030522 Bacteria 3255
272 Ga0307512_10144232 3300030522 Bacteria 1446
273 Ga0316177_1160851 3300030731 Bacteria 978
274 Ga0314311_1136520 3300030733 Bacteria 2391
275 Ga0316179_1021038 3300030734 Bacteria 4613
276 Ga0316178_1049500 3300030735 Bacteria 5544
277 Ga0316180_1114921 3300030736 Bacteria 3130
278 Ga0316180_1124794 3300030736 Bacteria 706
279 Ga0316183_1095156 3300030742 Bacteria 2315
280 Ga0316181_1044905 3300030744 Bacteria 1242
281 Ga0316182_1067661 3300030745 Bacteria 3539
282 Ga0265330_10036383 3300031235 Bacteria 2195
283 Ga0265332_10016400 3300031238 Bacteria 3268
284 Ga0265331_10024909 3300031250 Bacteria 3023
285 Ga0265327_10281719 3300031251 Bacteria 734
286 Ga0307513_10030880 3300031456 Bacteria 6078
287 Ga0307513_10240433 3300031456 Bacteria 1616
288 Ga0307513_10282848 3300031456 Bacteria 1435
289 Ga0307513_10569827 3300031456 Bacteria 843
290 Ga0307513_10718889 3300031456 Bacteria 704
291 Ga0307509_10027035 3300031507 Bacteria 6389
292 Ga0307408_100001559 3300031548 Bacteria 16942
293 Ga0307408_100253553 3300031548 Bacteria 1452
294 Ga0307408_100497447 3300031548 Bacteria 1066
295 Ga0307408_100674336 3300031548 Bacteria 927
296 Ga0307408_101145858 3300031548 Bacteria 723
297 Ga0307508_10000122 3300031616 Bacteria 92612
298 Ga0307514_10004149 3300031649 Bacteria 13427
299 Ga0307514_10006235 3300031649 Bacteria 10443
300 Ga0307514_10046039 3300031649 Bacteria 3409
301 Ga0265314_10003183 3300031711 Bacteria 16071
302 Ga0307516_10005879 3300031730 Bacteria 14519
303 Ga0307405_10175874 3300031731 Bacteria 1531
304 Ga0307405_10253973 3300031731 Bacteria 1309
305 Ga0307405_10342983 3300031731 Bacteria 1149
306 Ga0307405_10521143 3300031731 Bacteria 956
307 Ga0307405_10643483 3300031731 Bacteria 871
308 Ga0307410_10738796 3300031852 Bacteria 832
309 Ga0307406_10001398 3300031901 Bacteria 13412
310 Ga0307406_10015213 3300031901 Bacteria 4447
311 Ga0307406_10231614 3300031901 Bacteria 1380
312 Ga0307406_10254655 3300031901 Bacteria 1324
313 Ga0307406_10294655 3300031901 Bacteria 1243
314 Ga0307407_10060640 3300031903 Bacteria 2208
315 Ga0307412_10008099 3300031911 Bacteria 5988
316 Ga0307412_10016738 3300031911 Bacteria 4374
317 Ga0307412_10029604 3300031911 Bacteria 3438
318 Ga0307412_10499467 3300031911 Bacteria 1012
319 Ga0307412_11040098 3300031911 Bacteria 725
320 Ga0307416_100021408 3300032002 Bacteria 4641
321 Ga0307414_10077610 3300032004 Bacteria 2418
322 Ga0307411_10019572 3300032005 Bacteria 3914
323 Ga0307411_10172885 3300032005 Bacteria 1631
324 Ga0307411_10361232 3300032005 Bacteria 1187
325 Ga0307411_10468346 3300032005 Bacteria 1058
326 Ga0307411_10542760 3300032005 Bacteria 990
327 Ga0307411_10685810 3300032005 Bacteria 891
328 Ga0307510_10380831 3300033180 Bacteria 856
329 Ga0307510_10495024 3300033180 Bacteria 665
330 Ga0373959_0089916 3300034820 Bacteria 719
331 Ga0373931_0199514 3300035691 Bacteria 1194
332 Ga0373935_0469992 3300035692 Bacteria 910
333 Ga0373937_0851268 3300036401 Bacteria 860
334 Ga0395899_0003496 3300037312 Bacteria 12446
335 Ga0395899_0100694 3300037312 Bacteria 2086
336 Ga0395899_0222578 3300037312 Bacteria 1306
337 Ga0395899_0230848 3300037312 Bacteria 1278
338 Ga0395899_0366702 3300037312 Bacteria 960
339 Ga0395900_0003724 3300037418 Bacteria 16375
340 Ga0395900_0007772 3300037418 Bacteria 11059
341 Ga0395900_0039681 3300037418 Bacteria 4850
342 Ga0395900_0075042 3300037418 Bacteria 3476
343 Ga0395900_0344920 3300037418 Bacteria 1464
344 Ga0395900_0427098 3300037418 Bacteria 1285
345 Ga0395898_0032951 3300037466 Bacteria 5171
346 Ga0395898_0094243 3300037466 Bacteria 2877
347 Ga0395898_1405677 3300037466 Bacteria 625
348 Ga0395905_0000047 3300037471 Bacteria 237582
349 Ga0395905_0002887 3300037471 Bacteria 18776
350 Ga0395905_0003130 3300037471 Bacteria 17834
351 Ga0395905_0005429 3300037471 Bacteria 13023
352 Ga0395905_0046785 3300037471 Bacteria 4056
353 Ga0395905_0058827 3300037471 Bacteria 3593
354 Ga0395905_0118050 3300037471 Bacteria 2493
355 Ga0395905_0228188 3300037471 Bacteria 1741
356 Ga0395905_0520308 3300037471 Bacteria 1090
357 Ga0395905_0525943 3300037471 Bacteria 1083
358 Ga0395905_0708814 3300037471 Bacteria 909
359 Ga0395905_0798895 3300037471 Bacteria 846
360 Ga0395901_0007882 3300038443 Bacteria 10743
361 Ga0395901_0014407 3300038443 Bacteria 8048
362 Ga0395901_0096529 3300038443 Bacteria 3098
363 Ga0395901_0118358 3300038443 Bacteria 2783
364 Ga0395901_0310823 3300038443 Bacteria 1632
365 Ga0395901_0484309 3300038443 Bacteria 1261
366 Ga0395901_1136356 3300038443 Bacteria 750
367 Ga0436361_0752278 3300039447 Bacteria 8215
368 Ga0439436_0010239 3300041404 Bacteria 2863
369 Ga0439436_0029839 3300041404 Bacteria 1587
370 Ga0439436_0043042 3300041404 Bacteria 1289
371 Ga0439436_0116821 3300041404 Bacteria 745
372 Ga0439439_0021934 3300041406 Bacteria 1593
373 Ga0439439_0179706 3300041406 Bacteria 609
374 Ga0439447_027490 3300041407 Bacteria 1451
375 Ga0439453_0033802 3300041408 Bacteria 979
376 Ga0439466_0004652 3300041411 Bacteria 5272
377 Ga0439466_0016643 3300041411 Bacteria 2655
378 Ga0439466_0033329 3300041411 Bacteria 1750
379 Ga0439465_0013074 3300041413 Bacteria 2592
380 Ga0439465_0047663 3300041413 Bacteria 1397
381 Ga0451793_0908423 3300041452 Bacteria 797
382 Ga0451795_1355545 3300041456 Bacteria 644
383 Ga0451800_0814143 3300041459 Bacteria 1277
384 Ga0451804_0012504 3300041463 Bacteria 1036
385 Ga0451833_1303881 3300041491 Bacteria 838
386 Ga0451849_0371145 3300041505 Bacteria 788
387 Ga0451843_0464067 3300041509 Bacteria 570
388 Ga0439433_0018480 3300041999 Bacteria 1553
389 Ga0439433_0020920 3300041999 Bacteria 1461
390 Ga0439433_0026023 3300041999 Bacteria 1323
391 Ga0439442_002482 3300042002 Bacteria 3621
392 Ga0439442_010805 3300042002 Bacteria 1854
393 Ga0439443_106844 3300042003 Bacteria 540
394 Ga0439445_0007766 3300042004 Bacteria 2497
395 Ga0439432_012486 3300042006 Bacteria 2904
396 Ga0439432_097085 3300042006 Bacteria 883
397 Ga0439432_118344 3300042006 Bacteria 785
398 Ga0439449_0015271 3300042007 Bacteria 2884
399 Ga0439449_0066857 3300042007 Bacteria 1325
400 Ga0439449_0115149 3300042007 Bacteria 997
401 Ga0439452_027246 3300042010 Bacteria 1436
402 Ga0439452_037736 3300042010 Bacteria 1150
403 Ga0439457_017730 3300042014 Bacteria 1580
404 Ga0439462_0003296 3300042015 Bacteria 3860
405 Ga0439462_0006865 3300042015 Bacteria 2839
406 Ga0439462_0007334 3300042015 Bacteria 2758
407 Ga0450911_000194 3300042115 Bacteria 23939
408 Ga0450919_005996 3300042121 Bacteria 1447
409 Ga0450920_029078 3300042122 Bacteria 1084
410 Ga0450921_004453 3300042123 Bacteria 1023
411 Ga0450922_012905 3300042124 Bacteria 813
412 Ga0450923_001463 3300042125 Bacteria 3137
413 Ga0450923_003973 3300042125 Bacteria 2285
414 Ga0450888_062793 3300042126 Bacteria 547
415 Ga0450890_012472 3300042127 Bacteria 1103
416 Ga0450890_015202 3300042127 Bacteria 1012
417 Ga0450897_011181 3300042128 Bacteria 872
418 Ga0450891_004527 3300042129 Bacteria 1297
419 Ga0450898_019800 3300042134 Bacteria 1175
420 Ga0450899_012102 3300042135 Bacteria 968
421 Ga0450903_036422 3300042138 Bacteria 734
422 Ga0450905_015920 3300042142 Bacteria 1081
423 Ga0450906_001977 3300042145 Bacteria 4482
424 Ga0450906_006491 3300042145 Bacteria 2361
425 Ga0450906_092812 3300042145 Bacteria 549
426 Ga0450907_014026 3300042146 Bacteria 1337
427 Ga0450910_001170 3300042147 Bacteria 3254
428 Ga0450910_022332 3300042147 Bacteria 962
429 Ga0439446_0016081 3300042156 Bacteria 2081
430 Ga0439446_0055804 3300042156 Bacteria 1186
431 Ga0439446_0116802 3300042156 Bacteria 855
432 Ga0450908_001728 3300042184 Bacteria 4256
433 Ga0450908_069573 3300042184 Bacteria 624
434 Ga0450909_002487 3300042185 Bacteria 2610
435 Ga0450909_027013 3300042185 Bacteria 866
436 Ga0439434_0025840 3300042435 Bacteria 1773
437 Ga0439434_0030060 3300042435 Bacteria 1648
438 Ga0439434_0128389 3300042435 Bacteria 830
439 Ga0439459_0066734 3300042438 Bacteria 824
440 Ga0439464_0013756 3300042439 Bacteria 2171
441 Ga0450893_0011078 3300042532 Bacteria 1487
442 Ga0450893_0036100 3300042532 Bacteria 893
443 Ga0450893_0042541 3300042532 Bacteria 835
444 Ga0450893_0084924 3300042532 Bacteria 630
445 Ga0466969_0019653 3300044656 Bacteria 3508
446 Ga0466965_0064383 3300044683 Bacteria 1835
447 Ga0466965_0096018 3300044683 Bacteria 1512
448 Ga0466966_0192436 3300044684 Bacteria 1236
449 Ga0466966_0201642 3300044684 Bacteria 1204
450 Ga0466961_0009025 3300044693 Bacteria 6360
451 Ga0466961_0086979 3300044693 Bacteria 1975
452 Ga0466961_0193257 3300044693 Bacteria 1261
453 Ga0453684_0480221 3300044712 Bacteria 1379
454 Ga0466968_0154142 3300044735 Bacteria 1057
455 Ga0466970_0625688 3300044765 Bacteria 625
456 Ga0466957_0157446 3300044842 Bacteria 1473
457 Ga0466957_0259494 3300044842 Bacteria 1158
458 Ga0466960_0062941 3300044901 Bacteria 1825
459 Ga0466959_0060150 3300045049 Bacteria 2764
460 Ga0466959_0409718 3300045049 Bacteria 921
461 Ga0466959_0527351 3300045049 Bacteria 797
462 Ga0466959_0803756 3300045049 Bacteria 629
463 Ga0451576_0142051 3300045051 Bacteria 2503
464 Ga0451576_0258453 3300045051 Bacteria 1820
465 Ga0451576_1044719 3300045051 Bacteria 856
466 Ga0466958_0250888 3300045836 Bacteria 1132
467 Ga0466958_0386579 3300045836 Bacteria 903
468 Ga0466967_0602903 3300045976 Bacteria 1084
469 Ga0466967_0604087 3300045976 Bacteria 1083
470 Ga0466967_0785398 3300045976 Bacteria 945
471 Ga0495627_054851 3300046453 Bacteria 1190
472 Ga0495629_0217985 3300046459 Bacteria 1317
473 Ga0495650_0026896 3300046471 Bacteria 2667
474 Ga0495639_0084494 3300046475 Bacteria 1482
475 Ga0495610_0016240 3300046512 Bacteria 4295
476 Ga0495610_0019169 3300046512 Bacteria 3836
477 Ga0495616_0012846 3300046513 Bacteria 4737
478 Ga0495620_0006122 3300046515 Bacteria 6641
479 Ga0495620_0158380 3300046515 Bacteria 880
480 Ga0495631_0000256 3300046518 Bacteria 36913
481 Ga0495632_0100674 3300046519 Bacteria 1362
482 Ga0495637_0051611 3300046520 Bacteria 1720
483 Ga0495637_0068665 3300046520 Bacteria 1435
484 Ga0495642_0119476 3300046528 Bacteria 1130
485 Ga0495654_0000621 3300046530 Bacteria 28258
486 Ga0495654_0106953 3300046530 Bacteria 1280
487 Ga0495654_0229266 3300046530 Bacteria 782
488 Ga0495640_0621146 3300046533 Bacteria 652
489 Ga0495621_0082081 3300046539 Bacteria 1203
490 Ga0495621_0105777 3300046539 Bacteria 1075
491 Ga0495621_0116679 3300046539 Bacteria 1028
492 Ga0495645_0481213 3300046543 Bacteria 779
493 Ga0495622_0076921 3300046557 Bacteria 1538
494 Ga0495633_0005245 3300046558 Bacteria 7994
495 Ga0495656_0038312 3300046615 Bacteria 1985
496 Ga0495656_0050762 3300046615 Bacteria 1772
497 Ga0495668_0128526 3300046616 Bacteria 1387
498 Ga0495625_0002053 3300046660 Bacteria 22597
499 Ga0495625_0006884 3300046660 Bacteria 10036
500 Ga0495625_0053668 3300046660 Bacteria 2881
501 Ga0495625_0300430 3300046660 Bacteria 1027
502 Ga0495659_0276850 3300046664 Bacteria 704
503 Ga0495588_0045339 3300046674 Bacteria 2253
504 Ga0495657_0677688 3300046675 Bacteria 593
505 Ga0495658_0034626 3300046683 Bacteria 2772
506 Ga0495624_0237747 3300046690 Bacteria 1103
507 Ga0495670_0138460 3300046691 Bacteria 1272
508 Ga0495671_0011758 3300046692 Bacteria 4799
509 Ga0495600_0418592 3300046809 Bacteria 832
510 Ga0495581_0378657 3300047315 Bacteria 826
511 Ga0495676_0019988 3300047321 Bacteria 5882
512 Ga0495676_0598398 3300047321 Bacteria 718
513 Ga0495677_0369791 3300047445 Bacteria 566
514 Ga0495681_0071440 3300047470 Bacteria 1572
515 Ga0495602_0483104 3300048088 Bacteria 869
516 Ga0495614_0079526 3300048089 Bacteria 1419
517 Ga0496100_0445213 3300048903 Bacteria 992
518 Ga0496101_0031565 3300048904 Bacteria 3725
519 Ga0496102_0004774 3300048905 Bacteria 11465
520 Ga0496102_0126808 3300048905 Bacteria 2386
521 Ga0496102_0408316 3300048905 Bacteria 1276
522 Ga0496103_0280252 3300048906 Bacteria 1072
523 Ga0496103_0281559 3300048906 Bacteria 1069
524 Ga0496104_0231117 3300048907 Bacteria 1761
525 Ga0496105_0008359 3300048908 Bacteria 8042
526 Ga0496108_0098179 3300048911 Bacteria 2496
527 Ga0496109_0547658 3300048912 Bacteria 1091
528 Ga0496113_0832371 3300048916 Bacteria 732
529 Ga0496116_0051765 3300048919 Bacteria 2725
530 Ga0496116_0198431 3300048919 Bacteria 1053
531 Ga0496117_0017454 3300048920 Bacteria 5992
532 Ga0496117_0478385 3300048920 Bacteria 609
533 Ga0496118_0013419 3300048921 Bacteria 7752
534 Ga0496118_0179237 3300048921 Bacteria 1282
535 Ga0496118_0236035 3300048921 Bacteria 1051
536 Ga0496118_0440882 3300048921 Bacteria 664
537 Ga0496119_0107545 3300048922 Bacteria 1555
538 Ga0496121_0036944 3300048924 Bacteria 4345
539 Ga0496121_0098101 3300048924 Bacteria 2268
540 Ga0496121_0185498 3300048924 Bacteria 1496
541 Ga0496122_0004040 3300048925 Bacteria 18651
542 Ga0496122_0116737 3300048925 Bacteria 1734
543 Ga0496122_0155898 3300048925 Bacteria 1401
544 Ga0496122_0209463 3300048925 Bacteria 1131
545 Ga0496122_0379276 3300048925 Bacteria 726
546 Ga0496123_0000299 3300048926 Bacteria 96749
547 Ga0496123_0037156 3300048926 Bacteria 3443
548 Ga0496123_0133813 3300048926 Bacteria 1368
549 Ga0496123_0136599 3300048926 Bacteria 1348
550 Ga0496123_0305665 3300048926 Bacteria 757
551 Ga0496124_0097061 3300048927 Bacteria 2393
552 Ga0496124_0108668 3300048927 Bacteria 2236
553 Ga0496124_0226336 3300048927 Bacteria 1402
554 Ga0496124_0354573 3300048927 Bacteria 1036
555 Ga0496124_0480354 3300048927 Bacteria 839
556 Ga0496125_0022015 3300048928 Bacteria 5927
557 Ga0496125_0026207 3300048928 Bacteria 5318
558 Ga0496125_0067718 3300048928 Bacteria 2812
559 Ga0496125_0068872 3300048928 Bacteria 2780
560 Ga0496125_0225817 3300048928 Bacteria 1202
561 Ga0496125_0339003 3300048928 Bacteria 903
562 Ga0496126_0099531 3300048929 Bacteria 2546
563 Ga0496126_0428956 3300048929 Bacteria 1067
564 Ga0501034_0292532 3300049571 Bacteria 1566
565 Ga0501038_0336009 3300049574 Bacteria 1179
566 Ga0501039_0483327 3300049575 Bacteria 973
567 Ga0501043_0061521 3300049579 Bacteria 2949
568 Ga0501043_0250893 3300049579 Bacteria 1363
569 Ga0501046_0200600 3300049580 Bacteria 1484
570 Ga0501047_0204289 3300049581 Bacteria 1835
571 Ga0501047_0353983 3300049581 Bacteria 1305
572 Ga0501074_0297251 3300049590 Bacteria 1147
573 Ga0501249_005873 3300049679 Bacteria 2512
574 Ga0501249_095343 3300049679 Bacteria 709
575 Ga0501080_0099858 3300049742 Bacteria 2693
576 Ga0501262_007342 3300049759 Bacteria 1332
577 Ga0501044_0837133 3300049823 Bacteria 797
578 nmdc:mga03683_109197_c1 3300050489 Bacteria 1222
579 nmdc:mga03683_120838_c1 3300050489 Bacteria 1165
580 nmdc:mga03683_220982_c1 3300050489 Bacteria 874
581 nmdc:mga03683_326494_c1 3300050489 Bacteria 723
582 nmdc:mga03683_353056_c1 3300050489 Bacteria 696
583 nmdc:mga03683_425217_c1 3300050489 Bacteria 637
584 nmdc:mga03683_49428_c1 3300050489 Bacteria 1106
585 nmdc:mga03683_85827_c1 3300050489 Bacteria 1366
586 nmdc:mga03n38_154531_c1 3300050490 Bacteria 1157
587 nmdc:mga03n38_171949_c1 3300050490 Bacteria 1104
588 nmdc:mga0yw44_440297_c1 3300050492 Bacteria 883
589 nmdc:mga0yw44_54490_c1 3300050492 Bacteria 2431
590 nmdc:mga0k408_141598_c1 3300050493 Bacteria 1431
591 nmdc:mga0k408_210946_c1 3300050493 Bacteria 1160
592 nmdc:mga0k408_275868_c1 3300050493 Bacteria 1004
593 nmdc:mga0k408_548170_c1 3300050493 Bacteria 684
594 nmdc:mga0k408_95474_c1 3300050493 Bacteria 1750
595 nmdc:mga06z11_347519_c1 3300050494 Bacteria 887
596 nmdc:mga06z11_704160_c1 3300050494 Bacteria 615
597 nmdc:mga04h51_185002_c1 3300050495 Bacteria 812
598 nmdc:mga04h51_308460_c1 3300050495 Bacteria 646
599 nmdc:mga07m45_123785_c1 3300050496 Bacteria 1494
600 nmdc:mga07m45_129869_c1 3300050496 Bacteria 1458
601 nmdc:mga07m45_145183_c1 3300050496 Bacteria 1375
602 nmdc:mga07m45_207258_c1 3300050496 Bacteria 1141
603 nmdc:mga07m45_249156_c1 3300050496 Bacteria 1033
604 nmdc:mga07m45_33050_c1 3300050496 Bacteria 2872
605 nmdc:mga07m45_33830_c1 3300050496 Bacteria 2840
606 nmdc:mga07m45_351292_c1 3300050496 Bacteria 857
607 nmdc:mga07m45_445738_c1 3300050496 Bacteria 751
608 nmdc:mga07m45_451254_c1 3300050496 Bacteria 746
609 nmdc:mga07m45_58284_c1 3300050496 Bacteria 2185
610 nmdc:mga07m45_9309_c3 3300050496 Bacteria 1556
611 nmdc:mga0qj67_294050_c1 3300050509 Bacteria 1316
612 nmdc:mga0sz30_106998_c1 3300050516 Bacteria 1224
613 Ga0500610_0058278 3300053079 Bacteria 2016
614 Ga0500610_0110658 3300053079 Bacteria 1412
615 Ga0500610_0150115 3300053079 Bacteria 1168
616 Ga0500635_0083626 3300053080 Bacteria 1151
617 Ga0500651_0000224 3300053093 Bacteria 35276
618 Ga0500562_019544 3300053108 Bacteria 1753
619 Ga0500569_084456 3300053109 Bacteria 1020
620 Ga0500571_000057 3300053110 Bacteria 34612
621 Ga0500593_072603 3300053117 Bacteria 1490
622 Ga0500594_0021688 3300053118 Bacteria 1613
623 Ga0500594_0059555 3300053118 Bacteria 1097
624 Ga0500597_121806 3300053120 Bacteria 1130
625 Ga0500607_016271 3300053121 Bacteria 4267
626 Ga0500608_071133 3300053122 Bacteria 1654
627 Ga0500626_099685 3300053128 Bacteria 1267
628 Ga0500655_000250 3300053133 Bacteria 12616
629 Ga0500658_0007603 3300053134 Bacteria 4003
630 Ga0500559_0001099 3300053136 Bacteria 16348
631 Ga0500559_0092987 3300053136 Bacteria 1382
632 Ga0500568_0090412 3300053139 Bacteria 1154
633 Ga0500573_0108765 3300053140 Bacteria 1553
634 Ga0500616_0070652 3300053153 Bacteria 1781
635 Ga0500627_0051141 3300053158 Bacteria 1801
636 Ga0500634_0003846 3300053161 Bacteria 6799
637 Ga0500634_0015287 3300053161 Bacteria 4073
638 Ga0500645_005572 3300053730 Bacteria 4610
639 Ga0500645_034756 3300053730 Bacteria 1505
640 Ga0500645_054454 3300053730 Bacteria 1163
641 Ga0500645_084264 3300053730 Bacteria 905
642 Ga0500596_019836 3300053735 Bacteria 1010
643 Ga0500587_009223 3300053739 Bacteria 1262
644 Ga0590077_037320 3300059426 Bacteria 1073
645 Ga0466962_0086759 3300061719 Bacteria 1499

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_101595441 Ga0068852_1015954412 134
2 3300005336 Ga0070680_100330402 Ga0070680_1003304021 146
3 3300006353 Ga0075370_10470517 Ga0075370_104705171 146
4 3300031548 Ga0307408_100001559 Ga0307408_10000155915 146
5 3300031901 Ga0307406_10001398 Ga0307406_100013985 146
6 3300042142 Ga0450905_015920 Ga0450905_015920_16_522 148
7 iso_pu_bacteria 2643221611 2644073250 149
8 3300044712 Ga0453684_0480221 Ga0453684_0480221_646_1131 150
9 iso_pu_bacteria 2738543013 2739247699 152
10 3300025949 Ga0207667_10312346 Ga0207667_103123462 153
11 3300027876 Ga0209974_10028637 Ga0209974_100286372 153
12 3300031456 Ga0307513_10718889 Ga0307513_107188891 153
13 3300037312 Ga0395899_0100694 Ga0395899_0100694_362_856 153
14 3300037418 Ga0395900_0003724 Ga0395900_0003724_7179_7673 153
15 3300037418 Ga0395900_0075042 Ga0395900_0075042_1502_2005 153
16 3300037466 Ga0395898_0032951 Ga0395898_0032951_3579_4073 153
17 3300037471 Ga0395905_0046785 Ga0395905_0046785_2693_3187 153
18 3300037471 Ga0395905_0520308 Ga0395905_0520308_285_788 153
19 3300037471 Ga0395905_0708814 Ga0395905_0708814_132_644 153
20 3300038443 Ga0395901_0007882 Ga0395901_0007882_7135_7629 153
21 3300038443 Ga0395901_0484309 Ga0395901_0484309_96_599 153
22 iso_pu_bacteria 2881101125 2881104424 153
23 iso_pu_bacteria 2928115317 2928120069 153
24 3300006048 Ga0075363_100085120 Ga0075363_1000851202 154
25 3300013307 Ga0157372_12072851 Ga0157372_120728511 154
26 3300031235 Ga0265330_10036383 Ga0265330_100363833 154
27 3300031238 Ga0265332_10016400 Ga0265332_100164002 154
28 3300031250 Ga0265331_10024909 Ga0265331_100249094 154
29 3300031711 Ga0265314_10003183 Ga0265314_100031836 154
30 3300037418 Ga0395900_0427098 Ga0395900_0427098_465_947 154
31 3300037466 Ga0395898_1405677 Ga0395898_1405677_145_615 154
32 3300037471 Ga0395905_0798895 Ga0395905_0798895_257_772 154
33 3300041459 Ga0451800_0814143 Ga0451800_0814143_109_591 154
34 3300044684 Ga0466966_0192436 Ga0466966_0192436_712_1185 154
35 3300045049 Ga0466959_0803756 Ga0466959_0803756_74_559 154
36 3300045836 Ga0466958_0250888 Ga0466958_0250888_265_750 154
37 3300049571 Ga0501034_0292532 Ga0501034_0292532_340_837 154
38 3300049574 Ga0501038_0336009 Ga0501038_0336009_441_938 154
39 3300049579 Ga0501043_0061521 Ga0501043_0061521_305_802 154
40 3300049580 Ga0501046_0200600 Ga0501046_0200600_562_1059 154
41 3300049581 Ga0501047_0204289 Ga0501047_0204289_704_1201 154
42 3300049590 Ga0501074_0297251 Ga0501074_0297251_334_831 154
43 3300049742 Ga0501080_0099858 Ga0501080_0099858_1636_2133 154
44 3300050490 nmdc:mga03n38_154531_c1 nmdc:mga03n38_154531_c1_210_689 154
45 iso_pu_bacteria 2585428062 2587757844 154
46 3300005548 Ga0070665_100727244 Ga0070665_1007272442 155
47 3300037471 Ga0395905_0525943 Ga0395905_0525943_129_647 155
48 3300038443 Ga0395901_1136356 Ga0395901_1136356_50_592 155
49 3300044684 Ga0466966_0201642 Ga0466966_0201642_43_531 155
50 3300044693 Ga0466961_0086979 Ga0466961_0086979_1036_1524 155
51 3300044765 Ga0466970_0625688 Ga0466970_0625688_21_509 155
52 3300045049 Ga0466959_0527351 Ga0466959_0527351_22_510 155
53 3300048905 Ga0496102_0004774 Ga0496102_0004774_10276_10788 155
54 3300048905 Ga0496102_0408316 Ga0496102_0408316_559_1032 155
55 3300061719 Ga0466962_0086759 Ga0466962_0086759_743_1231 155
56 iso_pu_bacteria 2511231002 2511245426 155
57 3300003784 Ga0055534_1016875 Ga0055534_10168751 156
58 3300003792 Ga0055540_1006578 Ga0055540_10065785 156
59 3300003794 Ga0055531_10001518 Ga0055531_1000151812 156
60 3300005328 Ga0070676_10347716 Ga0070676_103477162 156
61 3300005331 Ga0070670_100077256 Ga0070670_1000772563 156
62 3300005333 Ga0070677_10610832 Ga0070677_106108321 156
63 3300005336 Ga0070680_100058388 Ga0070680_1000583884 156
64 3300005339 Ga0070660_100131245 Ga0070660_1001312453 156
65 3300005347 Ga0070668_100153959 Ga0070668_1001539592 156
66 3300005435 Ga0070714_100588153 Ga0070714_1005881532 156
67 3300005530 Ga0070679_100045747 Ga0070679_1000457475 156
68 3300005530 Ga0070679_100084028 Ga0070679_1000840281 156
69 3300005548 Ga0070665_100684529 Ga0070665_1006845292 156
70 3300005618 Ga0068864_100100952 Ga0068864_1001009522 156
71 3300005618 Ga0068864_100471246 Ga0068864_1004712462 156
72 3300005719 Ga0068861_101220120 Ga0068861_1012201202 156
73 3300005841 Ga0068863_100040189 Ga0068863_1000401892 156
74 3300006038 Ga0075365_10122938 Ga0075365_101229382 156
75 3300006048 Ga0075363_100605577 Ga0075363_1006055772 156
76 3300006178 Ga0075367_10304368 Ga0075367_103043682 156
77 3300006195 Ga0075366_10199836 Ga0075366_101998362 156
78 3300006195 Ga0075366_10453407 Ga0075366_104534071 156
79 3300006195 Ga0075366_10498901 Ga0075366_104989011 156
80 3300006353 Ga0075370_10325611 Ga0075370_103256111 156
81 3300006353 Ga0075370_10424483 Ga0075370_104244832 156
82 3300006353 Ga0075370_10432189 Ga0075370_104321891 156
83 3300006353 Ga0075370_10491070 Ga0075370_104910701 156
84 3300006846 Ga0075430_100037061 Ga0075430_1000370614 156
85 3300009093 Ga0105240_10044773 Ga0105240_100447736 156
86 3300009551 Ga0105238_10726325 Ga0105238_107263252 156
87 3300011119 Ga0105246_10204304 Ga0105246_102043042 156
88 3300012490 Ga0157322_1013657 Ga0157322_10136571 156
89 3300013297 Ga0157378_10692548 Ga0157378_106925482 156
90 3300013306 Ga0163162_10314310 Ga0163162_103143102 156
91 3300013308 Ga0157375_10834797 Ga0157375_108347972 156
92 3300014497 Ga0182008_10016633 Ga0182008_100166336 156
93 3300014969 Ga0157376_11012115 Ga0157376_110121152 156
94 3300015262 Ga0182007_10016821 Ga0182007_100168213 156
95 3300017792 Ga0163161_10039115 Ga0163161_100391152 156
96 3300017792 Ga0163161_10261274 Ga0163161_102612742 156
97 3300025273 Ga0209673_1049559 Ga0209673_10495592 156
98 3300025284 Ga0209130_1006552 Ga0209130_10065524 156
99 3300025291 Ga0209675_1000987 Ga0209675_10009877 156
100 3300025291 Ga0209675_1029576 Ga0209675_10295762 156
101 3300025292 Ga0209676_1007069 Ga0209676_10070691 156
102 3300025292 Ga0209676_1009793 Ga0209676_10097931 156
103 3300025303 Ga0209051_1001982 Ga0209051_10019825 156
104 3300025303 Ga0209051_1006199 Ga0209051_10061997 156
105 3300025304 Ga0209257_1000015 Ga0209257_1000015305 156
106 3300025304 Ga0209257_1016051 Ga0209257_10160514 156
107 3300025901 Ga0207688_10297728 Ga0207688_102977282 156
108 3300025907 Ga0207645_10172775 Ga0207645_101727752 156
109 3300025909 Ga0207705_10091665 Ga0207705_100916652 156
110 3300025913 Ga0207695_10046357 Ga0207695_100463572 156
111 3300025919 Ga0207657_10115072 Ga0207657_101150723 156
112 3300025921 Ga0207652_10029413 Ga0207652_100294135 156
113 3300025921 Ga0207652_10067117 Ga0207652_100671173 156
114 3300025937 Ga0207669_10495096 Ga0207669_104950961 156
115 3300025949 Ga0207667_10079242 Ga0207667_100792422 156
116 3300025972 Ga0207668_10438309 Ga0207668_104383092 156
117 3300025986 Ga0207658_10080539 Ga0207658_100805392 156
118 3300026023 Ga0207677_10689201 Ga0207677_106892011 156
119 3300026088 Ga0207641_10046119 Ga0207641_100461195 156
120 3300026089 Ga0207648_10327190 Ga0207648_103271902 156
121 3300026095 Ga0207676_10374011 Ga0207676_103740112 156
122 3300026121 Ga0207683_10013814 Ga0207683_100138142 156
123 3300028379 Ga0268266_10707712 Ga0268266_107077122 156
124 3300028794 Ga0307515_10000179 Ga0307515_10000179119 156
125 3300028794 Ga0307515_10000222 Ga0307515_1000022297 156
126 3300028794 Ga0307515_10001166 Ga0307515_1000116633 156
127 3300028794 Ga0307515_10019026 Ga0307515_100190264 156
128 3300030522 Ga0307512_10052380 Ga0307512_100523804 156
129 3300030736 Ga0316180_1124794 Ga0316180_11247941 156
130 3300031251 Ga0265327_10281719 Ga0265327_102817192 156
131 3300031456 Ga0307513_10030880 Ga0307513_100308802 156
132 3300031507 Ga0307509_10027035 Ga0307509_100270355 156
133 3300031616 Ga0307508_10000122 Ga0307508_1000012261 156
134 3300031649 Ga0307514_10004149 Ga0307514_100041497 156
135 3300031649 Ga0307514_10006235 Ga0307514_100062357 156
136 3300031730 Ga0307516_10005879 Ga0307516_100058799 156
137 3300032005 Ga0307411_10685810 Ga0307411_106858102 156
138 3300033180 Ga0307510_10380831 Ga0307510_103808312 156
139 3300033180 Ga0307510_10495024 Ga0307510_104950241 156
140 3300034820 Ga0373959_0089916 Ga0373959_0089916_193_666 156
141 3300035691 Ga0373931_0199514 Ga0373931_0199514_653_1126 156
142 3300035692 Ga0373935_0469992 Ga0373935_0469992_66_539 156
143 3300037312 Ga0395899_0222578 Ga0395899_0222578_439_918 156
144 3300037312 Ga0395899_0230848 Ga0395899_0230848_38_514 156
145 3300037312 Ga0395899_0366702 Ga0395899_0366702_261_833 156
146 3300037418 Ga0395900_0039681 Ga0395900_0039681_2813_3292 156
147 3300037466 Ga0395898_0094243 Ga0395898_0094243_250_729 156
148 3300037471 Ga0395905_0058827 Ga0395905_0058827_3008_3484 156
149 3300037471 Ga0395905_0118050 Ga0395905_0118050_1445_1918 156
150 3300038443 Ga0395901_0096529 Ga0395901_0096529_2231_2710 156
151 3300038443 Ga0395901_0118358 Ga0395901_0118358_1705_2277 156
152 3300041404 Ga0439436_0029839 Ga0439436_0029839_569_1045 156
153 3300041408 Ga0439453_0033802 Ga0439453_0033802_365_841 156
154 3300041452 Ga0451793_0908423 Ga0451793_0908423_58_531 156
155 3300041463 Ga0451804_0012504 Ga0451804_0012504_528_1016 156
156 3300041491 Ga0451833_1303881 Ga0451833_1303881_148_624 156
157 3300041505 Ga0451849_0371145 Ga0451849_0371145_53_613 156
158 3300041999 Ga0439433_0018480 Ga0439433_0018480_229_705 156
159 3300042127 Ga0450890_012472 Ga0450890_012472_117_593 156
160 3300042128 Ga0450897_011181 Ga0450897_011181_80_556 156
161 3300042138 Ga0450903_036422 Ga0450903_036422_223_699 156
162 3300042185 Ga0450909_002487 Ga0450909_002487_264_740 156
163 3300042435 Ga0439434_0030060 Ga0439434_0030060_761_1237 156
164 3300042438 Ga0439459_0066734 Ga0439459_0066734_88_564 156
165 3300042439 Ga0439464_0013756 Ga0439464_0013756_1236_1712 156
166 3300042532 Ga0450893_0042541 Ga0450893_0042541_263_739 156
167 3300044693 Ga0466961_0193257 Ga0466961_0193257_321_803 156
168 3300044842 Ga0466957_0157446 Ga0466957_0157446_678_1157 156
169 3300044842 Ga0466957_0259494 Ga0466957_0259494_368_850 156
170 3300045049 Ga0466959_0409718 Ga0466959_0409718_261_743 156
171 3300045051 Ga0451576_0142051 Ga0451576_0142051_520_996 156
172 3300045836 Ga0466958_0386579 Ga0466958_0386579_178_657 156
173 3300045976 Ga0466967_0602903 Ga0466967_0602903_335_817 156
174 3300045976 Ga0466967_0604087 Ga0466967_0604087_24_503 156
175 3300045976 Ga0466967_0785398 Ga0466967_0785398_180_656 156
176 3300046475 Ga0495639_0084494 Ga0495639_0084494_570_1040 156
177 3300046512 Ga0495610_0016240 Ga0495610_0016240_3204_3692 156
178 3300046519 Ga0495632_0100674 Ga0495632_0100674_139_627 156
179 3300046528 Ga0495642_0119476 Ga0495642_0119476_166_636 156
180 3300046533 Ga0495640_0621146 Ga0495640_0621146_75_545 156
181 3300046539 Ga0495621_0082081 Ga0495621_0082081_371_847 156
182 3300046539 Ga0495621_0105777 Ga0495621_0105777_372_842 156
183 3300046615 Ga0495656_0038312 Ga0495656_0038312_1137_1607 156
184 3300046660 Ga0495625_0006884 Ga0495625_0006884_807_1298 156
185 3300046664 Ga0495659_0276850 Ga0495659_0276850_38_508 156
186 3300046675 Ga0495657_0677688 Ga0495657_0677688_39_509 156
187 3300046683 Ga0495658_0034626 Ga0495658_0034626_138_626 156
188 3300046690 Ga0495624_0237747 Ga0495624_0237747_234_704 156
189 3300046691 Ga0495670_0138460 Ga0495670_0138460_533_1003 156
190 3300046809 Ga0495600_0418592 Ga0495600_0418592_143_613 156
191 3300047315 Ga0495581_0378657 Ga0495581_0378657_304_774 156
192 3300048088 Ga0495602_0483104 Ga0495602_0483104_283_753 156
193 3300048903 Ga0496100_0445213 Ga0496100_0445213_122_592 156
194 3300048905 Ga0496102_0126808 Ga0496102_0126808_1881_2351 156
195 3300048906 Ga0496103_0280252 Ga0496103_0280252_19_492 156
196 3300048907 Ga0496104_0231117 Ga0496104_0231117_390_860 156
197 3300048908 Ga0496105_0008359 Ga0496105_0008359_875_1345 156
198 3300048911 Ga0496108_0098179 Ga0496108_0098179_1229_1699 156
199 3300048912 Ga0496109_0547658 Ga0496109_0547658_514_984 156
200 3300048916 Ga0496113_0832371 Ga0496113_0832371_48_518 156
201 3300049575 Ga0501039_0483327 Ga0501039_0483327_273_749 156
202 3300049579 Ga0501043_0250893 Ga0501043_0250893_555_1031 156
203 3300049581 Ga0501047_0353983 Ga0501047_0353983_165_641 156
204 3300049823 Ga0501044_0837133 Ga0501044_0837133_162_638 156
205 3300050489 nmdc:mga03683_425217_c1 nmdc:mga03683_425217_c1_128_610 156
206 3300050493 nmdc:mga0k408_275868_c1 nmdc:mga0k408_275868_c1_373_861 156
207 3300050493 nmdc:mga0k408_95474_c1 nmdc:mga0k408_95474_c1_680_1195 156
208 3300050494 nmdc:mga06z11_347519_c1 nmdc:mga06z11_347519_c1_135_617 156
209 3300050495 nmdc:mga04h51_308460_c1 nmdc:mga04h51_308460_c1_120_596 156
210 3300050496 nmdc:mga07m45_123785_c1 nmdc:mga07m45_123785_c1_640_1116 156
211 3300050496 nmdc:mga07m45_207258_c1 nmdc:mga07m45_207258_c1_264_752 156
212 3300050496 nmdc:mga07m45_249156_c1 nmdc:mga07m45_249156_c1_258_749 156
213 3300050496 nmdc:mga07m45_351292_c1 nmdc:mga07m45_351292_c1_145_660 156
214 3300050496 nmdc:mga07m45_451254_c1 nmdc:mga07m45_451254_c1_77_565 156
215 3300050509 nmdc:mga0qj67_294050_c1 nmdc:mga0qj67_294050_c1_421_897 156
216 3300053080 Ga0500635_0083626 Ga0500635_0083626_430_903 156
217 3300053730 Ga0500645_084264 Ga0500645_084264_194_667 156
218 3300053739 Ga0500587_009223 Ga0500587_009223_550_1038 156
219 iso_pu_bacteria 2643221658 2644327154 156
220 iso_pu_bacteria 2842747753 2842750247 156
221 iso_pu_bacteria 2894023352 2894027801 156
222 iso_pu_bacteria 2932422444 2932422566 156
223 3300005548 Ga0070665_100476381 Ga0070665_1004763812 157
224 3300005616 Ga0068852_100400241 Ga0068852_1004002412 157
225 3300006177 Ga0075362_10027962 Ga0075362_100279621 157
226 3300013306 Ga0163162_10546576 Ga0163162_105465762 157
227 3300025937 Ga0207669_10217354 Ga0207669_102173542 157
228 3300028379 Ga0268266_11226052 Ga0268266_112260521 157
229 3300031548 Ga0307408_100674336 Ga0307408_1006743361 157
230 3300031901 Ga0307406_10231614 Ga0307406_102316141 157
231 3300031911 Ga0307412_10499467 Ga0307412_104994672 157
232 3300032005 Ga0307411_10172885 Ga0307411_101728852 157
233 3300037312 Ga0395899_0003496 Ga0395899_0003496_9456_9968 157
234 3300037418 Ga0395900_0007772 Ga0395900_0007772_5800_6312 157
235 3300037418 Ga0395900_0344920 Ga0395900_0344920_364_891 157
236 3300037471 Ga0395905_0000047 Ga0395905_0000047_150006_150533 157
237 3300037471 Ga0395905_0002887 Ga0395905_0002887_11020_11517 157
238 3300037471 Ga0395905_0003130 Ga0395905_0003130_2454_2966 157
239 3300037471 Ga0395905_0005429 Ga0395905_0005429_8538_9050 157
240 3300037471 Ga0395905_0228188 Ga0395905_0228188_393_920 157
241 3300038443 Ga0395901_0014407 Ga0395901_0014407_6179_6691 157
242 3300038443 Ga0395901_0310823 Ga0395901_0310823_479_1006 157
243 3300041456 Ga0451795_1355545 Ga0451795_1355545_105_578 157
244 3300041509 Ga0451843_0464067 Ga0451843_0464067_63_536 157
245 3300042003 Ga0439443_106844 Ga0439443_106844_29_517 157
246 3300042115 Ga0450911_000194 Ga0450911_000194_3525_4001 157
247 3300042126 Ga0450888_062793 Ga0450888_062793_32_520 157
248 3300042129 Ga0450891_004527 Ga0450891_004527_215_727 157
249 3300042532 Ga0450893_0011078 Ga0450893_0011078_523_1011 157
250 3300044656 Ga0466969_0019653 Ga0466969_0019653_449_976 157
251 3300044683 Ga0466965_0096018 Ga0466965_0096018_694_1221 157
252 3300044693 Ga0466961_0009025 Ga0466961_0009025_353_880 157
253 3300044735 Ga0466968_0154142 Ga0466968_0154142_101_628 157
254 3300044901 Ga0466960_0062941 Ga0466960_0062941_80_607 157
255 3300045049 Ga0466959_0060150 Ga0466959_0060150_772_1299 157
256 3300045051 Ga0451576_0258453 Ga0451576_0258453_908_1411 157
257 3300048924 Ga0496121_0098101 Ga0496121_0098101_348_824 157
258 3300048927 Ga0496124_0480354 Ga0496124_0480354_185_661 157
259 3300048928 Ga0496125_0026207 Ga0496125_0026207_3708_4184 157
260 3300048928 Ga0496125_0068872 Ga0496125_0068872_1803_2279 157
261 3300050489 nmdc:mga03683_353056_c1 nmdc:mga03683_353056_c1_80_559 157
262 3300059426 Ga0590077_037320 Ga0590077_037320_39_521 157
263 iso_pu_bacteria 2513020051 2513226875 157
264 iso_pu_bacteria 2547132374 2548500413 157
265 iso_pu_bacteria 2599185214 2599621665 157
266 iso_pu_bacteria 2599185226 2599670651 157
267 iso_pu_bacteria 2599185227 2599679141 157
268 iso_pu_bacteria 2599185229 2599691176 157
269 iso_pu_bacteria 2643221628 2644163618 157
270 iso_pu_bacteria 2643221672 2644398958 157
271 iso_pu_bacteria 2643221683 2644465818 157
272 iso_pu_bacteria 2643221717 2644647040 157
273 iso_pu_bacteria 2738541277 2738721745 157
274 iso_pu_bacteria 2738543012 2739244449 157
275 iso_pu_bacteria 2738543019 2739282109 157
276 iso_pu_bacteria 2816332133 2816469892 157
277 iso_pu_bacteria 2818991446 2819597851 157
278 iso_pu_bacteria 2831265667 2831268821 157
279 iso_pu_bacteria 2838054893 2838058247 157
280 iso_pu_bacteria 2842677519 2842678190 157
281 iso_pu_bacteria 2842733646 2842737006 157
282 iso_pu_bacteria 2885192300 2885194481 157
283 iso_pu_bacteria 2885198086 2885204016 157
284 iso_pu_bacteria 2885211737 2885217650 157
285 iso_pu_bacteria 2899924645 2899929267 157
286 iso_pu_bacteria 2904449895 2904451231 157
287 iso_pu_bacteria 2904456579 2904458093 157
288 iso_pu_bacteria 2904479285 2904481238 157
289 iso_pu_bacteria 2904541872 2904542870 157
290 iso_pu_bacteria 2919462493 2919465568 157
291 iso_pu_bacteria 2928037797 2928040292 157
292 iso_pu_bacteria 2928044640 2928046959 157
293 iso_pu_bacteria 2928051484 2928057840 157
294 iso_pu_bacteria 2928064002 2928067785 157
295 iso_pu_bacteria 2928070936 2928072328 157
296 iso_pu_bacteria 2928084124 2928085537 157
297 iso_pu_bacteria 2929160207 2929166286 157
298 iso_pu_bacteria 2929520902 2929526301 157
299 iso_pu_bacteria 2945909444 2945915127 157
300 iso_pu_bacteria 2945945610 2945950853 157
301 iso_pu_bacteria 2945972063 2945974517 157
302 iso_pu_bacteria 2945984333 2945989461 157
303 iso_pu_bacteria 2954767861 2954769747 157
304 iso_pu_bacteria 2974320154 2974321713 157
305 3300005354 Ga0070675_100781420 Ga0070675_1007814202 158
306 3300005548 Ga0070665_100198421 Ga0070665_1001984212 158
307 3300025940 Ga0207691_11057825 Ga0207691_110578251 158
308 3300028379 Ga0268266_10506274 Ga0268266_105062742 158
309 3300031456 Ga0307513_10569827 Ga0307513_105698271 158
310 3300046471 Ga0495650_0026896 Ga0495650_0026896_1959_2435 158
311 iso_pu_bacteria 2721755523 2722886293 158
312 iso_pu_bacteria 2839138175 2839141926 158
313 iso_pu_bacteria 2842718218 2842720845 158
314 3300021361 Ga0213872_10006498 Ga0213872_100064981 159
315 3300036401 Ga0373937_0851268 Ga0373937_0851268_49_552 159
316 3300039447 Ga0436361_0752278 Ga0436361_0752278_2391_2873 159
317 3300045051 Ga0451576_1044719 Ga0451576_1044719_165_668 159
318 3300046530 Ga0495654_0000621 Ga0495654_0000621_737_1309 159
319 3300046558 Ga0495633_0005245 Ga0495633_0005245_6879_7367 159
320 3300048925 Ga0496122_0209463 Ga0496122_0209463_613_1101 159
321 3300048926 Ga0496123_0305665 Ga0496123_0305665_191_679 159
322 3300048928 Ga0496125_0225817 Ga0496125_0225817_628_1164 159
323 3300053161 Ga0500634_0015287 Ga0500634_0015287_401_883 159
324 3300053730 Ga0500645_005572 Ga0500645_005572_3102_3584 159
325 3300053730 Ga0500645_054454 Ga0500645_054454_312_821 159
326 3300005289 Ga0065704_10084500 Ga0065704_100845002 160
327 3300005353 Ga0070669_100187802 Ga0070669_1001878022 160
328 3300005616 Ga0068852_100676482 Ga0068852_1006764822 160
329 3300006048 Ga0075363_100098472 Ga0075363_1000984722 160
330 3300006177 Ga0075362_10048119 Ga0075362_100481192 160
331 3300006195 Ga0075366_10012228 Ga0075366_100122282 160
332 3300006353 Ga0075370_10172051 Ga0075370_101720512 160
333 3300006946 Ga0079104_1000027 Ga0079104_1000027184 160
334 3300009092 Ga0105250_10000066 Ga0105250_1000006650 160
335 3300009148 Ga0105243_10031178 Ga0105243_100311784 160
336 3300014497 Ga0182008_10000678 Ga0182008_100006782 160
337 3300014497 Ga0182008_10247719 Ga0182008_102477191 160
338 3300025923 Ga0207681_10147296 Ga0207681_101472962 160
339 3300026142 Ga0207698_11851123 Ga0207698_118511231 160
340 3300042015 Ga0439462_0006865 Ga0439462_0006865_1741_2259 160
341 3300047470 Ga0495681_0071440 Ga0495681_0071440_568_1050 160
342 3300048920 Ga0496117_0478385 Ga0496117_0478385_108_590 160
343 3300048921 Ga0496118_0440882 Ga0496118_0440882_61_543 160
344 3300048925 Ga0496122_0004040 Ga0496122_0004040_669_1151 160
345 3300048925 Ga0496122_0116737 Ga0496122_0116737_402_905 160
346 3300048926 Ga0496123_0000299 Ga0496123_0000299_16091_16573 160
347 3300048926 Ga0496123_0037156 Ga0496123_0037156_1532_2035 160
348 3300048927 Ga0496124_0108668 Ga0496124_0108668_1224_1706 160
349 3300048928 Ga0496125_0067718 Ga0496125_0067718_1971_2474 160
350 3300048929 Ga0496126_0099531 Ga0496126_0099531_2031_2534 160
351 3300048929 Ga0496126_0428956 Ga0496126_0428956_355_858 160
352 3300049679 Ga0501249_095343 Ga0501249_095343_194_697 160
353 3300050489 nmdc:mga03683_109197_c1 nmdc:mga03683_109197_c1_707_1189 160
354 3300050493 nmdc:mga0k408_210946_c1 nmdc:mga0k408_210946_c1_601_1083 160
355 3300050494 nmdc:mga06z11_704160_c1 nmdc:mga06z11_704160_c1_109_591 160
356 3300050496 nmdc:mga07m45_129869_c1 nmdc:mga07m45_129869_c1_727_1209 160
357 3300053118 Ga0500594_0059555 Ga0500594_0059555_273_755 160
358 3300053136 Ga0500559_0001099 Ga0500559_0001099_714_1196 160
359 3300053140 Ga0500573_0108765 Ga0500573_0108765_601_1083 160
360 iso_pu_bacteria 2643221570 2643864517 160
361 iso_pu_bacteria 2643221596 2643992870 160
362 iso_pu_bacteria 2643221652 2644291792 160
363 iso_pu_bacteria 2738541307 2738881904 160
364 iso_pu_bacteria 2990710928 2990715096 160
365 3300001989 JGI24739J22299_10019155 JGI24739J22299_100191552 161
366 3300002987 JGI25159J45721_1046946 JGI25159J45721_10469461 161
367 3300003187 JGI25151J46595_10034863 JGI25151J46595_100348632 161
368 3300003316 rootH1_10010984 rootH1_100109841 161
369 3300003578 Ga0006562J51391_1036397 Ga0006562J51391_10363972 161
370 3300003578 Ga0006562J51391_1036398 Ga0006562J51391_10363986 161
371 3300003578 Ga0006562J51391_1042796 Ga0006562J51391_10427961 161
372 3300003578 Ga0006562J51391_1042797 Ga0006562J51391_10427971 161
373 3300003760 Ga0055527_1009905 Ga0055527_10099052 161
374 3300003761 Ga0055535_1000185 Ga0055535_100018560 161
375 3300003762 Ga0055542_1000003 Ga0055542_1000003228 161
376 3300003781 Ga0055536_1014588 Ga0055536_10145883 161
377 3300003784 Ga0055534_1001656 Ga0055534_10016568 161
378 3300003784 Ga0055534_1008870 Ga0055534_10088703 161
379 3300003790 Ga0055528_1033773 Ga0055528_10337732 161
380 3300003791 Ga0055530_10021074 Ga0055530_100210742 161
381 3300003792 Ga0055540_1008854 Ga0055540_10088543 161
382 3300003792 Ga0055540_1019512 Ga0055540_10195122 161
383 3300003794 Ga0055531_10027994 Ga0055531_100279942 161
384 3300003794 Ga0055531_10029498 Ga0055531_100294982 161
385 3300005288 Ga0065714_10004635 Ga0065714_100046352 161
386 3300005334 Ga0068869_100254596 Ga0068869_1002545961 161
387 3300005356 Ga0070674_100287507 Ga0070674_1002875072 161
388 3300005366 Ga0070659_100232218 Ga0070659_1002322182 161
389 3300005367 Ga0070667_100316065 Ga0070667_1003160652 161
390 3300005457 Ga0070662_100054362 Ga0070662_1000543622 161
391 3300005459 Ga0068867_100381124 Ga0068867_1003811242 161
392 3300005459 Ga0068867_100742868 Ga0068867_1007428681 161
393 3300005539 Ga0068853_100257720 Ga0068853_1002577202 161
394 3300005563 Ga0068855_100300509 Ga0068855_1003005092 161
395 3300005564 Ga0070664_100009654 Ga0070664_1000096543 161
396 3300005578 Ga0068854_100105296 Ga0068854_1001052963 161
397 3300005616 Ga0068852_100591218 Ga0068852_1005912182 161
398 3300005834 Ga0068851_10002203 Ga0068851_100022038 161
399 3300005844 Ga0068862_100140296 Ga0068862_1001402962 161
400 3300006038 Ga0075365_10006832 Ga0075365_100068328 161
401 3300006048 Ga0075363_100392777 Ga0075363_1003927772 161
402 3300006051 Ga0075364_10668030 Ga0075364_106680302 161
403 3300006177 Ga0075362_10012458 Ga0075362_100124583 161
404 3300006177 Ga0075362_10268775 Ga0075362_102687752 161
405 3300006177 Ga0075362_10334849 Ga0075362_103348492 161
406 3300006178 Ga0075367_10075113 Ga0075367_100751133 161
407 3300006186 Ga0075369_10072866 Ga0075369_100728662 161
408 3300006195 Ga0075366_10013797 Ga0075366_100137976 161
409 3300006195 Ga0075366_10169783 Ga0075366_101697831 161
410 3300006195 Ga0075366_10490251 Ga0075366_104902511 161
411 3300006353 Ga0075370_10004750 Ga0075370_100047508 161
412 3300006353 Ga0075370_10042241 Ga0075370_100422413 161
413 3300006353 Ga0075370_10085117 Ga0075370_100851172 161
414 3300006353 Ga0075370_10109614 Ga0075370_101096143 161
415 3300006353 Ga0075370_10290068 Ga0075370_102900681 161
416 3300006353 Ga0075370_10412621 Ga0075370_104126212 161
417 3300006353 Ga0075370_10438553 Ga0075370_104385532 161
418 3300006358 Ga0068871_100457443 Ga0068871_1004574432 161
419 3300006948 Ga0099826_10024823 Ga0099826_100248232 161
420 3300009036 Ga0105244_10021367 Ga0105244_100213672 161
421 3300009093 Ga0105240_10866582 Ga0105240_108665821 161
422 3300009148 Ga0105243_10006239 Ga0105243_100062392 161
423 3300009148 Ga0105243_10734063 Ga0105243_107340632 161
424 3300009176 Ga0105242_10000434 Ga0105242_100004341 161
425 3300009176 Ga0105242_10234151 Ga0105242_102341512 161
426 3300009177 Ga0105248_11147409 Ga0105248_111474092 161
427 3300009545 Ga0105237_10097372 Ga0105237_100973722 161
428 3300009551 Ga0105238_10372500 Ga0105238_103725002 161
429 3300009551 Ga0105238_10461287 Ga0105238_104612872 161
430 3300009551 Ga0105238_11687689 Ga0105238_116876891 161
431 3300010375 Ga0105239_10778653 Ga0105239_107786532 161
432 3300010375 Ga0105239_11150057 Ga0105239_111500572 161
433 3300011119 Ga0105246_10135775 Ga0105246_101357752 161
434 3300011119 Ga0105246_10306065 Ga0105246_103060652 161
435 3300012502 Ga0157347_1001667 Ga0157347_10016673 161
436 3300012502 Ga0157347_1004962 Ga0157347_10049622 161
437 3300012502 Ga0157347_1028748 Ga0157347_10287481 161
438 3300012505 Ga0157339_1000815 Ga0157339_10008151 161
439 3300013100 Ga0157373_10022558 Ga0157373_100225586 161
440 3300013100 Ga0157373_10184960 Ga0157373_101849602 161
441 3300013102 Ga0157371_10030125 Ga0157371_100301254 161
442 3300013104 Ga0157370_10023750 Ga0157370_100237508 161
443 3300013104 Ga0157370_10176975 Ga0157370_101769752 161
444 3300013104 Ga0157370_10456404 Ga0157370_104564042 161
445 3300013105 Ga0157369_10094259 Ga0157369_100942592 161
446 3300013297 Ga0157378_11855496 Ga0157378_118554961 161
447 3300013308 Ga0157375_10636985 Ga0157375_106369852 161
448 3300014497 Ga0182008_10013895 Ga0182008_100138952 161
449 3300014497 Ga0182008_10153357 Ga0182008_101533572 161
450 3300015261 Ga0182006_1004961 Ga0182006_10049612 161
451 3300015261 Ga0182006_1046371 Ga0182006_10463712 161
452 3300015261 Ga0182006_1168623 Ga0182006_11686231 161
453 3300015262 Ga0182007_10005210 Ga0182007_100052102 161
454 3300015262 Ga0182007_10133678 Ga0182007_101336781 161
455 3300017792 Ga0163161_10004734 Ga0163161_100047342 161
456 3300017792 Ga0163161_10071218 Ga0163161_100712183 161
457 3300017792 Ga0163161_10494540 Ga0163161_104945401 161
458 3300017792 Ga0163161_10918413 Ga0163161_109184131 161
459 3300025228 Ga0209672_100279 Ga0209672_10027932 161
460 3300025229 Ga0209147_101464 Ga0209147_1014642 161
461 3300025242 Ga0209258_100015 Ga0209258_100015347 161
462 3300025245 Ga0207425_1010199 Ga0207425_10101992 161
463 3300025254 Ga0209148_1000028 Ga0209148_1000028322 161
464 3300025258 Ga0209129_1000160 Ga0209129_100016084 161
465 3300025258 Ga0209129_1021955 Ga0209129_10219552 161
466 3300025258 Ga0209129_1025122 Ga0209129_10251222 161
467 3300025263 Ga0209565_1000236 Ga0209565_100023661 161
468 3300025263 Ga0209565_1000762 Ga0209565_10007628 161
469 3300025263 Ga0209565_1002449 Ga0209565_10024492 161
470 3300025273 Ga0209673_1000286 Ga0209673_100028675 161
471 3300025273 Ga0209673_1000556 Ga0209673_100055661 161
472 3300025273 Ga0209673_1010331 Ga0209673_10103314 161
473 3300025284 Ga0209130_1000760 Ga0209130_100076024 161
474 3300025284 Ga0209130_1001309 Ga0209130_100130914 161
475 3300025291 Ga0209675_1001227 Ga0209675_10012278 161
476 3300025291 Ga0209675_1001556 Ga0209675_10015567 161
477 3300025292 Ga0209676_1000074 Ga0209676_1000074109 161
478 3300025292 Ga0209676_1000660 Ga0209676_10006602 161
479 3300025292 Ga0209676_1024158 Ga0209676_10241582 161
480 3300025292 Ga0209676_1049399 Ga0209676_10493992 161
481 3300025294 Ga0209025_1000269 Ga0209025_100026934 161
482 3300025294 Ga0209025_1000349 Ga0209025_100034910 161
483 3300025294 Ga0209025_1000846 Ga0209025_100084651 161
484 3300025294 Ga0209025_1015579 Ga0209025_10155795 161
485 3300025295 Ga0209564_1000294 Ga0209564_100029410 161
486 3300025295 Ga0209564_1001177 Ga0209564_100117722 161
487 3300025297 Ga0209758_1000039 Ga0209758_1000039326 161
488 3300025298 Ga0209050_1000015 Ga0209050_1000015361 161
489 3300025298 Ga0209050_1008576 Ga0209050_10085766 161
490 3300025299 Ga0209256_1000136 Ga0209256_100013678 161
491 3300025299 Ga0209256_1000230 Ga0209256_100023010 161
492 3300025302 Ga0207426_1000108 Ga0207426_100010864 161
493 3300025302 Ga0207426_1000130 Ga0207426_100013040 161
494 3300025302 Ga0207426_1001644 Ga0207426_10016443 161
495 3300025303 Ga0209051_1000010 Ga0209051_1000010361 161
496 3300025303 Ga0209051_1000508 Ga0209051_100050853 161
497 3300025303 Ga0209051_1006759 Ga0209051_10067592 161
498 3300025303 Ga0209051_1007004 Ga0209051_10070042 161
499 3300025304 Ga0209257_1000026 Ga0209257_1000026316 161
500 3300025304 Ga0209257_1000582 Ga0209257_10005827 161
501 3300025321 Ga0207656_10006596 Ga0207656_100065962 161
502 3300025728 Ga0207655_1030413 Ga0207655_10304133 161
503 3300025913 Ga0207695_10156165 Ga0207695_101561653 161
504 3300025914 Ga0207671_10124182 Ga0207671_101241821 161
505 3300025924 Ga0207694_10532113 Ga0207694_105321132 161
506 3300025924 Ga0207694_10845533 Ga0207694_108455332 161
507 3300025932 Ga0207690_10311350 Ga0207690_103113502 161
508 3300025932 Ga0207690_10479976 Ga0207690_104799762 161
509 3300025933 Ga0207706_10006769 Ga0207706_1000676911 161
510 3300025934 Ga0207686_10000514 Ga0207686_100005149 161
511 3300025935 Ga0207709_10000196 Ga0207709_1000019664 161
512 3300025935 Ga0207709_10001898 Ga0207709_100018987 161
513 3300025940 Ga0207691_10124859 Ga0207691_101248593 161
514 3300025945 Ga0207679_10010437 Ga0207679_100104377 161
515 3300025949 Ga0207667_10382272 Ga0207667_103822722 161
516 3300025960 Ga0207651_10522677 Ga0207651_105226771 161
517 3300025981 Ga0207640_10112498 Ga0207640_101124982 161
518 3300025981 Ga0207640_10535080 Ga0207640_105350802 161
519 3300025986 Ga0207658_10978435 Ga0207658_109784351 161
520 3300026041 Ga0207639_10507779 Ga0207639_105077792 161
521 3300026041 Ga0207639_10914176 Ga0207639_109141762 161
522 3300026089 Ga0207648_10249653 Ga0207648_102496532 161
523 3300026116 Ga0207674_10620974 Ga0207674_106209741 161
524 3300026142 Ga0207698_10606857 Ga0207698_106068572 161
525 3300026142 Ga0207698_10857888 Ga0207698_108578882 161
526 3300027666 Ga0209282_1014933 Ga0209282_10149332 161
527 3300028379 Ga0268266_11529798 Ga0268266_115297981 161
528 3300028380 Ga0268265_10032859 Ga0268265_100328592 161
529 3300028794 Ga0307515_10000034 Ga0307515_10000034160 161
530 3300028794 Ga0307515_10367645 Ga0307515_103676452 161
531 3300030522 Ga0307512_10144232 Ga0307512_101442322 161
532 3300030731 Ga0316177_1160851 Ga0316177_11608512 161
533 3300030733 Ga0314311_1136520 Ga0314311_11365203 161
534 3300030734 Ga0316179_1021038 Ga0316179_10210386 161
535 3300030735 Ga0316178_1049500 Ga0316178_10495003 161
536 3300030736 Ga0316180_1114921 Ga0316180_11149213 161
537 3300030742 Ga0316183_1095156 Ga0316183_10951563 161
538 3300030744 Ga0316181_1044905 Ga0316181_10449051 161
539 3300030745 Ga0316182_1067661 Ga0316182_10676613 161
540 3300031456 Ga0307513_10240433 Ga0307513_102404332 161
541 3300031456 Ga0307513_10282848 Ga0307513_102828481 161
542 3300031548 Ga0307408_100253553 Ga0307408_1002535532 161
543 3300031548 Ga0307408_100497447 Ga0307408_1004974472 161
544 3300031548 Ga0307408_101145858 Ga0307408_1011458581 161
545 3300031649 Ga0307514_10046039 Ga0307514_100460392 161
546 3300031731 Ga0307405_10175874 Ga0307405_101758741 161
547 3300031731 Ga0307405_10253973 Ga0307405_102539731 161
548 3300031731 Ga0307405_10342983 Ga0307405_103429832 161
549 3300031731 Ga0307405_10521143 Ga0307405_105211432 161
550 3300031731 Ga0307405_10643483 Ga0307405_106434832 161
551 3300031852 Ga0307410_10738796 Ga0307410_107387961 161
552 3300031901 Ga0307406_10015213 Ga0307406_100152132 161
553 3300031901 Ga0307406_10254655 Ga0307406_102546552 161
554 3300031901 Ga0307406_10294655 Ga0307406_102946552 161
555 3300031903 Ga0307407_10060640 Ga0307407_100606402 161
556 3300031911 Ga0307412_10008099 Ga0307412_100080997 161
557 3300031911 Ga0307412_10016738 Ga0307412_100167385 161
558 3300031911 Ga0307412_10029604 Ga0307412_100296042 161
559 3300031911 Ga0307412_11040098 Ga0307412_110400981 161
560 3300032002 Ga0307416_100021408 Ga0307416_1000214086 161
561 3300032004 Ga0307414_10077610 Ga0307414_100776102 161
562 3300032005 Ga0307411_10019572 Ga0307411_100195722 161
563 3300032005 Ga0307411_10361232 Ga0307411_103612322 161
564 3300032005 Ga0307411_10468346 Ga0307411_104683461 161
565 3300032005 Ga0307411_10542760 Ga0307411_105427602 161
566 3300041404 Ga0439436_0010239 Ga0439436_0010239_625_1110 161
567 3300041404 Ga0439436_0043042 Ga0439436_0043042_404_889 161
568 3300041404 Ga0439436_0116821 Ga0439436_0116821_170_697 161
569 3300041406 Ga0439439_0021934 Ga0439439_0021934_762_1247 161
570 3300041406 Ga0439439_0179706 Ga0439439_0179706_32_547 161
571 3300041407 Ga0439447_027490 Ga0439447_027490_812_1297 161
572 3300041411 Ga0439466_0004652 Ga0439466_0004652_345_830 161
573 3300041411 Ga0439466_0016643 Ga0439466_0016643_794_1279 161
574 3300041411 Ga0439466_0033329 Ga0439466_0033329_522_1049 161
575 3300041413 Ga0439465_0013074 Ga0439465_0013074_833_1360 161
576 3300041413 Ga0439465_0047663 Ga0439465_0047663_621_1106 161
577 3300041999 Ga0439433_0020920 Ga0439433_0020920_436_921 161
578 3300041999 Ga0439433_0026023 Ga0439433_0026023_290_817 161
579 3300042002 Ga0439442_002482 Ga0439442_002482_493_978 161
580 3300042002 Ga0439442_010805 Ga0439442_010805_457_984 161
581 3300042004 Ga0439445_0007766 Ga0439445_0007766_271_798 161
582 3300042006 Ga0439432_012486 Ga0439432_012486_450_977 161
583 3300042006 Ga0439432_097085 Ga0439432_097085_241_756 161
584 3300042006 Ga0439432_118344 Ga0439432_118344_290_775 161
585 3300042007 Ga0439449_0015271 Ga0439449_0015271_706_1233 161
586 3300042007 Ga0439449_0066857 Ga0439449_0066857_342_857 161
587 3300042007 Ga0439449_0115149 Ga0439449_0115149_322_807 161
588 3300042010 Ga0439452_027246 Ga0439452_027246_197_682 161
589 3300042010 Ga0439452_037736 Ga0439452_037736_398_925 161
590 3300042014 Ga0439457_017730 Ga0439457_017730_435_962 161
591 3300042015 Ga0439462_0003296 Ga0439462_0003296_771_1256 161
592 3300042015 Ga0439462_0007334 Ga0439462_0007334_1525_2052 161
593 3300042121 Ga0450919_005996 Ga0450919_005996_523_1008 161
594 3300042122 Ga0450920_029078 Ga0450920_029078_15_500 161
595 3300042123 Ga0450921_004453 Ga0450921_004453_477_962 161
596 3300042124 Ga0450922_012905 Ga0450922_012905_11_496 161
597 3300042125 Ga0450923_001463 Ga0450923_001463_2157_2642 161
598 3300042125 Ga0450923_003973 Ga0450923_003973_1059_1544 161
599 3300042127 Ga0450890_015202 Ga0450890_015202_457_942 161
600 3300042134 Ga0450898_019800 Ga0450898_019800_181_666 161
601 3300042135 Ga0450899_012102 Ga0450899_012102_77_562 161
602 3300042145 Ga0450906_001977 Ga0450906_001977_549_1034 161
603 3300042145 Ga0450906_006491 Ga0450906_006491_1606_2091 161
604 3300042145 Ga0450906_092812 Ga0450906_092812_45_530 161
605 3300042146 Ga0450907_014026 Ga0450907_014026_561_1046 161
606 3300042147 Ga0450910_001170 Ga0450910_001170_2076_2561 161
607 3300042147 Ga0450910_022332 Ga0450910_022332_35_520 161
608 3300042156 Ga0439446_0016081 Ga0439446_0016081_1574_2059 161
609 3300042156 Ga0439446_0055804 Ga0439446_0055804_448_933 161
610 3300042156 Ga0439446_0116802 Ga0439446_0116802_255_740 161
611 3300042184 Ga0450908_001728 Ga0450908_001728_3609_4094 161
612 3300042184 Ga0450908_069573 Ga0450908_069573_61_576 161
613 3300042185 Ga0450909_027013 Ga0450909_027013_10_495 161
614 3300042435 Ga0439434_0025840 Ga0439434_0025840_814_1299 161
615 3300042435 Ga0439434_0128389 Ga0439434_0128389_272_757 161
616 3300042532 Ga0450893_0036100 Ga0450893_0036100_255_770 161
617 3300042532 Ga0450893_0084924 Ga0450893_0084924_124_609 161
618 3300044683 Ga0466965_0064383 Ga0466965_0064383_655_1140 161
619 3300046453 Ga0495627_054851 Ga0495627_054851_302_787 161
620 3300046459 Ga0495629_0217985 Ga0495629_0217985_377_862 161
621 3300046512 Ga0495610_0019169 Ga0495610_0019169_2853_3338 161
622 3300046513 Ga0495616_0012846 Ga0495616_0012846_764_1249 161
623 3300046515 Ga0495620_0006122 Ga0495620_0006122_135_620 161
624 3300046515 Ga0495620_0158380 Ga0495620_0158380_159_644 161
625 3300046518 Ga0495631_0000256 Ga0495631_0000256_35687_36172 161
626 3300046520 Ga0495637_0051611 Ga0495637_0051611_873_1358 161
627 3300046520 Ga0495637_0068665 Ga0495637_0068665_570_1055 161
628 3300046530 Ga0495654_0106953 Ga0495654_0106953_194_679 161
629 3300046530 Ga0495654_0229266 Ga0495654_0229266_170_655 161
630 3300046539 Ga0495621_0116679 Ga0495621_0116679_57_542 161
631 3300046543 Ga0495645_0481213 Ga0495645_0481213_28_513 161
632 3300046557 Ga0495622_0076921 Ga0495622_0076921_514_999 161
633 3300046615 Ga0495656_0050762 Ga0495656_0050762_560_1075 161
634 3300046616 Ga0495668_0128526 Ga0495668_0128526_179_664 161
635 3300046660 Ga0495625_0002053 Ga0495625_0002053_21298_21786 161
636 3300046660 Ga0495625_0053668 Ga0495625_0053668_586_1071 161
637 3300046660 Ga0495625_0300430 Ga0495625_0300430_399_884 161
638 3300046674 Ga0495588_0045339 Ga0495588_0045339_736_1221 161
639 3300046692 Ga0495671_0011758 Ga0495671_0011758_3854_4339 161
640 3300047321 Ga0495676_0019988 Ga0495676_0019988_655_1140 161
641 3300047321 Ga0495676_0598398 Ga0495676_0598398_30_515 161
642 3300047445 Ga0495677_0369791 Ga0495677_0369791_29_514 161
643 3300048089 Ga0495614_0079526 Ga0495614_0079526_198_683 161
644 3300048904 Ga0496101_0031565 Ga0496101_0031565_23_508 161
645 3300048906 Ga0496103_0281559 Ga0496103_0281559_178_663 161
646 3300048919 Ga0496116_0051765 Ga0496116_0051765_1513_1998 161
647 3300048919 Ga0496116_0198431 Ga0496116_0198431_518_1003 161
648 3300048920 Ga0496117_0017454 Ga0496117_0017454_450_935 161
649 3300048921 Ga0496118_0013419 Ga0496118_0013419_6570_7055 161
650 3300048921 Ga0496118_0179237 Ga0496118_0179237_194_679 161
651 3300048921 Ga0496118_0236035 Ga0496118_0236035_183_668 161
652 3300048922 Ga0496119_0107545 Ga0496119_0107545_457_942 161
653 3300048924 Ga0496121_0036944 Ga0496121_0036944_3527_4012 161
654 3300048924 Ga0496121_0185498 Ga0496121_0185498_334_819 161
655 3300048925 Ga0496122_0155898 Ga0496122_0155898_412_906 161
656 3300048925 Ga0496122_0379276 Ga0496122_0379276_180_665 161
657 3300048926 Ga0496123_0133813 Ga0496123_0133813_720_1205 161
658 3300048926 Ga0496123_0136599 Ga0496123_0136599_683_1168 161
659 3300048927 Ga0496124_0097061 Ga0496124_0097061_1072_1557 161
660 3300048927 Ga0496124_0226336 Ga0496124_0226336_591_1076 161
661 3300048927 Ga0496124_0354573 Ga0496124_0354573_189_674 161
662 3300048928 Ga0496125_0022015 Ga0496125_0022015_4925_5410 161
663 3300048928 Ga0496125_0339003 Ga0496125_0339003_342_827 161
664 3300049679 Ga0501249_005873 Ga0501249_005873_267_752 161
665 3300049759 Ga0501262_007342 Ga0501262_007342_531_1016 161
666 3300050489 nmdc:mga03683_120838_c1 nmdc:mga03683_120838_c1_292_807 161
667 3300050489 nmdc:mga03683_220982_c1 nmdc:mga03683_220982_c1_365_850 161
668 3300050489 nmdc:mga03683_326494_c1 nmdc:mga03683_326494_c1_170_655 161
669 3300050489 nmdc:mga03683_49428_c1 nmdc:mga03683_49428_c1_370_855 161
670 3300050489 nmdc:mga03683_85827_c1 nmdc:mga03683_85827_c1_527_1015 161
671 3300050490 nmdc:mga03n38_171949_c1 nmdc:mga03n38_171949_c1_190_705 161
672 3300050492 nmdc:mga0yw44_440297_c1 nmdc:mga0yw44_440297_c1_58_543 161
673 3300050492 nmdc:mga0yw44_54490_c1 nmdc:mga0yw44_54490_c1_1201_1689 161
674 3300050493 nmdc:mga0k408_141598_c1 nmdc:mga0k408_141598_c1_582_1070 161
675 3300050493 nmdc:mga0k408_548170_c1 nmdc:mga0k408_548170_c1_53_541 161
676 3300050495 nmdc:mga04h51_185002_c1 nmdc:mga04h51_185002_c1_100_585 161
677 3300050496 nmdc:mga07m45_145183_c1 nmdc:mga07m45_145183_c1_686_1171 161
678 3300050496 nmdc:mga07m45_33050_c1 nmdc:mga07m45_33050_c1_1472_1957 161
679 3300050496 nmdc:mga07m45_33830_c1 nmdc:mga07m45_33830_c1_817_1302 161
680 3300050496 nmdc:mga07m45_445738_c1 nmdc:mga07m45_445738_c1_104_616 161
681 3300050496 nmdc:mga07m45_58284_c1 nmdc:mga07m45_58284_c1_146_631 161
682 3300050496 nmdc:mga07m45_9309_c3 nmdc:mga07m45_9309_c3_753_1238 161
683 3300050516 nmdc:mga0sz30_106998_c1 nmdc:mga0sz30_106998_c1_174_659 161
684 3300053079 Ga0500610_0058278 Ga0500610_0058278_166_651 161
685 3300053079 Ga0500610_0110658 Ga0500610_0110658_160_645 161
686 3300053079 Ga0500610_0150115 Ga0500610_0150115_337_822 161
687 3300053093 Ga0500651_0000224 Ga0500651_0000224_687_1172 161
688 3300053108 Ga0500562_019544 Ga0500562_019544_733_1218 161
689 3300053109 Ga0500569_084456 Ga0500569_084456_241_726 161
690 3300053110 Ga0500571_000057 Ga0500571_000057_33583_34068 161
691 3300053117 Ga0500593_072603 Ga0500593_072603_522_1007 161
692 3300053118 Ga0500594_0021688 Ga0500594_0021688_737_1222 161
693 3300053120 Ga0500597_121806 Ga0500597_121806_179_664 161
694 3300053121 Ga0500607_016271 Ga0500607_016271_668_1153 161
695 3300053122 Ga0500608_071133 Ga0500608_071133_448_933 161
696 3300053128 Ga0500626_099685 Ga0500626_099685_426_911 161
697 3300053133 Ga0500655_000250 Ga0500655_000250_11856_12341 161
698 3300053134 Ga0500658_0007603 Ga0500658_0007603_3277_3762 161
699 3300053136 Ga0500559_0092987 Ga0500559_0092987_435_920 161
700 3300053139 Ga0500568_0090412 Ga0500568_0090412_502_987 161
701 3300053153 Ga0500616_0070652 Ga0500616_0070652_601_1086 161
702 3300053158 Ga0500627_0051141 Ga0500627_0051141_688_1173 161
703 3300053161 Ga0500634_0003846 Ga0500634_0003846_6009_6494 161
704 3300053730 Ga0500645_034756 Ga0500645_034756_507_992 161
705 3300053735 Ga0500596_019836 Ga0500596_019836_413_898 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

60

118

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ia2-assembly3.cif.gz_D the crystal structure of a putative transcriptional regulator rha06195 from rhodococcus sp. rha1 0.8961 58 102
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8752 72 119
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.87 59 102
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8673 60 117
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.8664 59 117
ID Description Score Start End Superfamily
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.928 62 102 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9089 57 117 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8992 72 119 1.10.10.10
1tdx001 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8974 72 127 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8965 58 117 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G6X6L7-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.968 27 161 GO:0003677
GO:0003700
GO:0006950
AF-A0A1G6X6L7-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9543 27 161 GO:0003677
GO:0003700
GO:0006950
AF-A0A7G6Z637-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9477 56 158 GO:0003700
AF-A0A7Z0RKU0-F1-model_v4 Winged helix DNA-binding protein 0.9218 23 159 GO:0003677
GO:0003700
GO:0006950
AF-A0A1W2CZN4-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9204 19 161 GO:0003677
GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
87.97 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map