F476375

General Info

Members Datasets Scaffolds Average Seq Length
704 355 683 240

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0131003|Ga0495676_0131003_515_1279
Length 254
Sequence VPLLLLQRLKTVQVDGLAIALRPRPMAEAADLGVQLVRNHARSVWRTFLPVYIVTVLLALCTVEIAGWLPSLLIFWLKPWFDRSLLFIHSRAVFGQETRWSDLWQNRRVVWGGQLLRTLLWRRLSPWRSFTQAIDQLEGQRGGARRKRRTQLLRGRRGAATGMQMVFANVEMALDICLLSLLFWFAPEGSARDLFGWLTQSDVPLQSLLTAGAYALVIGVLEPFYVAAGFAMYLNRRVELEAWDIEQEFRRGFR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2818991446 Variovorax sp. 1180 Isolate Unclassified
10 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
11 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
12 2885198086 Variovorax sp. 679 Isolate Unclassified
13 2885211737 Variovorax sp. 553 Isolate Unclassified
14 2899924645 Variovorax sp. 369 Isolate Unclassified
15 2928037797 Variovorax sp. 1126 Isolate Unclassified
16 2928044640 Variovorax sp. 1128 Isolate Unclassified
17 2928051484 Variovorax sp. 1133 Isolate Unclassified
18 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
19 2928070936 Variovorax gossypii 1167 Isolate Unclassified
20 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
21 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
162 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
236 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
237 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
238 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
262 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
296 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
340 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
341 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
342 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
343 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
344 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
354 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
355 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0.28
Isolates 2.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.39
Nodule 0.28
Rhizoplane 1.56
Rhizosphere 56.96
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10107636 3300001989 Bacteria 838
2 JGI25155J39150_1000041 3300002704 Bacteria 88843
3 JGI25156J39149_1000031 3300002705 Bacteria 124983
4 JGI25154J39366_1000049 3300002738 Bacteria 124995
5 JGI25158J39367_1011392 3300002739 Bacteria 1187
6 JGI25157J39369_1000041 3300002741 Bacteria 124982
7 JGI25152J39213_1001385 3300002773 Bacteria 10512
8 JGI25152J39213_1003919 3300002773 Bacteria 4881
9 JGI25150J39212_1004083 3300002774 Bacteria 3303
10 JGI25159J45721_1002044 3300002987 Bacteria 7985
11 JGI25159J45721_1004046 3300002987 Bacteria 4986
12 JGI25159J45721_1007697 3300002987 Bacteria 3054
13 JGI25159J45721_1027216 3300002987 Bacteria 974
14 JGI25151J46595_10002148 3300003187 Bacteria 12247
15 JGI25151J46595_10002546 3300003187 Bacteria 10815
16 JGI25151J46595_10002892 3300003187 Bacteria 9846
17 JGI25151J46595_10012456 3300003187 Bacteria 3866
18 JGI25151J46595_10035283 3300003187 Bacteria 1901
19 JGI25151J46595_10040471 3300003187 Bacteria 1706
20 JGI25153J46596_10001619 3300003215 Bacteria 13360
21 JGI25153J46596_10002836 3300003215 Bacteria 9847
22 rootH1_10029614 3300003316 Bacteria 6153
23 rootH2_10145589 3300003320 Bacteria 1883
24 rootH1_10158496 3300003323 Bacteria 4214
25 JGI25160J50197_1000684 3300003354 Bacteria 18764
26 JGI25160J50197_1001665 3300003354 Bacteria 10845
27 JGI25160J50197_1004870 3300003354 Bacteria 5716
28 JGI25161J50226_1000042 3300003374 Bacteria 123841
29 JGI25161J50226_1004966 3300003374 Bacteria 2689
30 JGI25161J50226_1012128 3300003374 Bacteria 1045
31 Ga0006562J51391_1039354 3300003578 Bacteria 3790
32 Ga0055535_1000192 3300003761 Bacteria 64814
33 Ga0055542_1000058 3300003762 Bacteria 162781
34 Ga0055526_1006434 3300003771 Bacteria 6370
35 Ga0055526_1008120 3300003771 Bacteria 5292
36 Ga0055526_1008276 3300003771 Bacteria 5218
37 Ga0055537_1000865 3300003773 Bacteria 14531
38 Ga0055537_1000915 3300003773 Bacteria 13891
39 Ga0055524_1000260 3300003775 Bacteria 53486
40 Ga0055524_1004565 3300003775 Bacteria 6370
41 Ga0055536_1002259 3300003781 Bacteria 10963
42 Ga0055534_1001009 3300003784 Bacteria 12390
43 Ga0055534_1002221 3300003784 Bacteria 6891
44 Ga0055534_1019916 3300003784 Bacteria 1143
45 Ga0055528_1001308 3300003790 Bacteria 15606
46 Ga0055528_1008604 3300003790 Bacteria 4347
47 Ga0055530_10000386 3300003791 Bacteria 39620
48 Ga0055530_10000553 3300003791 Bacteria 32445
49 Ga0055530_10007037 3300003791 Bacteria 4838
50 Ga0055540_1000010 3300003792 Bacteria 290865
51 Ga0055540_1001280 3300003792 Bacteria 15303
52 Ga0055540_1002089 3300003792 Bacteria 10966
53 Ga0055540_1003175 3300003792 Bacteria 8109
54 Ga0055540_1020075 3300003792 Bacteria 1780
55 Ga0055531_10001065 3300003794 Bacteria 21587
56 Ga0055531_10001780 3300003794 Bacteria 15303
57 Ga0055531_10002998 3300003794 Bacteria 10960
58 Ga0055531_10003465 3300003794 Bacteria 10039
59 Ga0055531_10003566 3300003794 Bacteria 9876
60 Ga0055543_1000279 3300004625 Bacteria 37669
61 Ga0055543_1000922 3300004625 Bacteria 13701
62 Ga0055543_1002930 3300004625 Bacteria 5333
63 Ga0065165_1002803 3300005262 Bacteria 13701
64 Ga0065165_1007714 3300005262 Bacteria 5210
65 Ga0065165_1008412 3300005262 Bacteria 4833
66 Ga0065165_1008974 3300005262 Bacteria 4573
67 Ga0065715_10102963 3300005293 Unclassified 3068
68 Ga0065715_10105842 3300005293 Unclassified 2867
69 Ga0065715_10168814 3300005293 Bacteria 1564
70 Ga0065707_10005231 3300005295 Bacteria 3372
71 Ga0065707_10082114 3300005295 Bacteria 21501
72 Ga0065707_10107161 3300005295 Bacteria 2566
73 Ga0065707_10123977 3300005295 Unclassified 2054
74 Ga0070676_10090163 3300005328 Bacteria 1877
75 Ga0070676_10445860 3300005328 Bacteria 909
76 Ga0070683_100021428 3300005329 Bacteria 5768
77 Ga0070683_100035296 3300005329 Bacteria 4571
78 Ga0070690_100078474 3300005330 Bacteria 2157
79 Ga0070670_100245844 3300005331 Bacteria 1558
80 Ga0070670_100731007 3300005331 Unclassified 891
81 Ga0070677_10107040 3300005333 Bacteria 1242
82 Ga0068869_100094676 3300005334 Bacteria 2252
83 Ga0068869_100205532 3300005334 Bacteria 1555
84 Ga0070680_100242916 3300005336 Bacteria 1522
85 Ga0070682_100345692 3300005337 Bacteria 1107
86 Ga0068868_100584430 3300005338 Bacteria 988
87 Ga0070660_100119996 3300005339 Bacteria 2098
88 Ga0070660_100278148 3300005339 Bacteria 1369
89 Ga0070689_100001812 3300005340 Bacteria 13734
90 Ga0070689_100043554 3300005340 Bacteria 3450
91 Ga0070687_100015192 3300005343 Bacteria 3474
92 Ga0070669_100003380 3300005353 Bacteria 11478
93 Ga0070669_100009114 3300005353 Bacteria 7072
94 Ga0070669_100039261 3300005353 Bacteria 3439
95 Ga0070675_100108096 3300005354 Bacteria 2349
96 Ga0070675_100365796 3300005354 Bacteria 1281
97 Ga0070671_100045984 3300005355 Bacteria 3630
98 Ga0070674_100245741 3300005356 Bacteria 1403
99 Ga0070674_100435859 3300005356 Bacteria 1079
100 Ga0070674_100456435 3300005356 Bacteria 1056
101 Ga0070673_100135404 3300005364 Bacteria 2073
102 Ga0070673_100183174 3300005364 Unclassified 1794
103 Ga0070673_100244687 3300005364 Bacteria 1561
104 Ga0070688_100022761 3300005365 Bacteria 3678
105 Ga0070688_100367980 3300005365 Unclassified 1057
106 Ga0070688_100567095 3300005365 Bacteria 865
107 Ga0070659_100225401 3300005366 Bacteria 1548
108 Ga0070659_100410456 3300005366 Bacteria 1144
109 Ga0070667_100185086 3300005367 Bacteria 1843
110 Ga0070705_100067429 3300005440 Bacteria 2149
111 Ga0070700_100002005 3300005441 Bacteria 10342
112 Ga0070700_100044838 3300005441 Unclassified 2725
113 Ga0070700_100307412 3300005441 Bacteria 1160
114 Ga0070694_100002855 3300005444 Bacteria 10258
115 Ga0070694_100315567 3300005444 Bacteria 1202
116 Ga0070663_100009363 3300005455 Bacteria 6062
117 Ga0070678_100036820 3300005456 Bacteria 3429
118 Ga0070678_100059787 3300005456 Unclassified 2802
119 Ga0070678_100161737 3300005456 Bacteria 1815
120 Ga0070662_100016502 3300005457 Bacteria 4960
121 Ga0070662_100018289 3300005457 Bacteria 4739
122 Ga0070681_10092205 3300005458 Unclassified 2978
123 Ga0068867_100000042 3300005459 Bacteria 77140
124 Ga0068867_100009240 3300005459 Bacteria 6956
125 Ga0068867_100048820 3300005459 Bacteria 3115
126 Ga0068867_100766957 3300005459 Bacteria 857
127 Ga0070706_100006362 3300005467 Bacteria 11153
128 Ga0070706_100054184 3300005467 Bacteria 3702
129 Ga0070706_100136563 3300005467 Unclassified 2289
130 Ga0070707_100014136 3300005468 Bacteria 7481
131 Ga0070698_100083197 3300005471 Bacteria 3191
132 Ga0070699_100069382 3300005518 Bacteria 3063
133 Ga0068853_100004595 3300005539 Bacteria 10712
134 Ga0068853_100021439 3300005539 Bacteria 5388
135 Ga0068853_100075897 3300005539 Bacteria 2934
136 Ga0068853_100087384 3300005539 Bacteria 2736
137 Ga0070672_100057979 3300005543 Bacteria 3041
138 Ga0070686_100015782 3300005544 Bacteria 4384
139 Ga0070686_100061239 3300005544 Bacteria 2431
140 Ga0070696_100444715 3300005546 Bacteria 1022
141 Ga0070693_100030718 3300005547 Bacteria 2939
142 Ga0070665_100003695 3300005548 Bacteria 16205
143 Ga0070665_100035690 3300005548 Bacteria 5000
144 Ga0070665_100525164 3300005548 Bacteria 1195
145 Ga0070704_100002098 3300005549 Bacteria 11090
146 Ga0070704_100218470 3300005549 Bacteria 1548
147 Ga0068855_100009405 3300005563 Bacteria 11802
148 Ga0068855_100432269 3300005563 Bacteria 1439
149 Ga0068855_100745602 3300005563 Bacteria 1045
150 Ga0070664_100004106 3300005564 Bacteria 11696
151 Ga0070664_100305096 3300005564 Bacteria 1439
152 Ga0070664_100439725 3300005564 Unclassified 1196
153 Ga0068857_100003699 3300005577 Bacteria 12830
154 Ga0068857_100010135 3300005577 Bacteria 8189
155 Ga0068857_100010788 3300005577 Bacteria 7952
156 Ga0068857_100031414 3300005577 Bacteria 4693
157 Ga0068854_100033283 3300005578 Bacteria 3593
158 Ga0068854_100043779 3300005578 Bacteria 3175
159 Ga0068854_100241690 3300005578 Bacteria 1438
160 Ga0068856_100172206 3300005614 Bacteria 2177
161 Ga0070702_100001656 3300005615 Bacteria 9240
162 Ga0068852_100021501 3300005616 Bacteria 5154
163 Ga0068852_100160793 3300005616 Bacteria 2097
164 Ga0068852_100396283 3300005616 Bacteria 1357
165 Ga0068859_100003913 3300005617 Bacteria 15203
166 Ga0068859_100103230 3300005617 Bacteria 2909
167 Ga0068864_100017265 3300005618 Bacteria 6018
168 Ga0068864_100050776 3300005618 Bacteria 3571
169 Ga0068864_100200674 3300005618 Bacteria 1832
170 Ga0068866_10191716 3300005718 Unclassified 1215
171 Ga0068861_100001582 3300005719 Bacteria 14478
172 Ga0068861_100001663 3300005719 Bacteria 14225
173 Ga0068861_100016468 3300005719 Bacteria 5232
174 Ga0068851_10037901 3300005834 Bacteria 2418
175 Ga0068870_10002226 3300005840 Bacteria 8048
176 Ga0068858_100148991 3300005842 Bacteria 2199
177 Ga0068860_100120159 3300005843 Bacteria 2516
178 Ga0068860_100544879 3300005843 Bacteria 1162
179 Ga0068862_100012186 3300005844 Bacteria 7107
180 Ga0068862_100070665 3300005844 Bacteria 3014
181 Ga0068862_100408709 3300005844 Unclassified 1271
182 Ga0068862_100440109 3300005844 Bacteria 1227
183 Ga0081455_10000066 3300005937 Bacteria 115221
184 Ga0075365_10053529 3300006038 Bacteria 2673
185 Ga0075365_10101130 3300006038 Bacteria 1974
186 Ga0075365_10243622 3300006038 Bacteria 1263
187 Ga0075368_10053596 3300006042 Bacteria 1606
188 Ga0075368_10138046 3300006042 Bacteria 1015
189 Ga0075363_100084158 3300006048 Bacteria 1744
190 Ga0075363_100153068 3300006048 Bacteria 1302
191 Ga0075363_100209016 3300006048 Bacteria 1117
192 Ga0075364_10019429 3300006051 Bacteria 4265
193 Ga0075364_10257702 3300006051 Bacteria 1186
194 Ga0075364_10289634 3300006051 Bacteria 1114
195 Ga0075432_10078416 3300006058 Bacteria 1195
196 Ga0075362_10034649 3300006177 Bacteria 2201
197 Ga0075362_10042494 3300006177 Bacteria 2009
198 Ga0075362_10069115 3300006177 Bacteria 1610
199 Ga0075362_10126482 3300006177 Bacteria 1213
200 Ga0075367_10006362 3300006178 Bacteria 5958
201 Ga0075367_10011215 3300006178 Bacteria 4732
202 Ga0075367_10024107 3300006178 Bacteria 3431
203 Ga0075367_10031771 3300006178 Bacteria 3033
204 Ga0075367_10090669 3300006178 Bacteria 1859
205 Ga0075367_10272318 3300006178 Bacteria 1063
206 Ga0075369_10014370 3300006186 Bacteria 3162
207 Ga0075366_10004217 3300006195 Bacteria 7707
208 Ga0075366_10012200 3300006195 Bacteria 4871
209 Ga0075366_10013204 3300006195 Bacteria 4698
210 Ga0075366_10019104 3300006195 Bacteria 3960
211 Ga0075366_10030349 3300006195 Bacteria 3178
212 Ga0075366_10031403 3300006195 Bacteria 3125
213 Ga0075366_10070035 3300006195 Bacteria 2088
214 Ga0075366_10179727 3300006195 Bacteria 1285
215 Ga0075366_10250723 3300006195 Bacteria 1080
216 Ga0097621_100187141 3300006237 Unclassified 1791
217 Ga0097621_100241906 3300006237 Bacteria 1578
218 Ga0075370_10000059 3300006353 Bacteria 32632
219 Ga0075370_10000220 3300006353 Bacteria 20375
220 Ga0075370_10008504 3300006353 Bacteria 5286
221 Ga0075370_10028264 3300006353 Bacteria 3116
222 Ga0075370_10043563 3300006353 Bacteria 2536
223 Ga0075370_10057500 3300006353 Bacteria 2211
224 Ga0075370_10234274 3300006353 Bacteria 1087
225 Ga0075370_10316976 3300006353 Bacteria 929
226 Ga0068871_100012030 3300006358 Bacteria 6369
227 Ga0068871_100056557 3300006358 Bacteria 3189
228 Ga0068871_100198273 3300006358 Unclassified 1732
229 Ga0075428_100008577 3300006844 Bacteria 11337
230 Ga0075428_100029742 3300006844 Bacteria 6042
231 Ga0075430_100069168 3300006846 Bacteria 2962
232 Ga0075430_100159976 3300006846 Bacteria 1875
233 Ga0075431_100037295 3300006847 Bacteria 5009
234 Ga0075431_100127572 3300006847 Bacteria 2625
235 Ga0075431_100330878 3300006847 Bacteria 1534
236 Ga0075433_10014097 3300006852 Bacteria 6518
237 Ga0075434_100019051 3300006871 Bacteria 6634
238 Ga0075434_100029189 3300006871 Bacteria 5424
239 Ga0075434_100149383 3300006871 Bacteria 2357
240 Ga0075429_100046639 3300006880 Bacteria 3770
241 Ga0075429_100120549 3300006880 Unclassified 2293
242 Ga0075429_100242620 3300006880 Bacteria 1578
243 Ga0068865_100029574 3300006881 Bacteria 3637
244 Ga0097620_100003912 3300006931 Bacteria 15203
245 Ga0097620_100103227 3300006931 Bacteria 2909
246 Ga0099826_10078446 3300006948 Bacteria 2068
247 Ga0075435_100058900 3300007076 Bacteria 3112
248 Ga0075435_100779332 3300007076 Bacteria 832
249 Ga0099795_10000252 3300007788 Bacteria 9530
250 Ga0105244_10004022 3300009036 Bacteria 10269
251 Ga0105240_10007179 3300009093 Bacteria 16222
252 Ga0105240_10205219 3300009093 Unclassified 2307
253 Ga0105240_10449574 3300009093 Bacteria 1442
254 Ga0111539_10004096 3300009094 Bacteria 19126
255 Ga0111539_10005321 3300009094 Bacteria 16657
256 Ga0111539_10024487 3300009094 Bacteria 7403
257 Ga0111539_10090659 3300009094 Bacteria 3592
258 Ga0111539_10102418 3300009094 Bacteria 3360
259 Ga0111539_10195776 3300009094 Unclassified 2357
260 Ga0111539_10582489 3300009094 Bacteria 1303
261 Ga0105245_10040873 3300009098 Bacteria 4132
262 Ga0105247_10080016 3300009101 Bacteria 2057
263 Ga0114129_10031517 3300009147 Bacteria 7493
264 Ga0114129_10183832 3300009147 Bacteria 2843
265 Ga0105243_10002909 3300009148 Bacteria 14178
266 Ga0105243_10003902 3300009148 Bacteria 11904
267 Ga0105243_10043728 3300009148 Bacteria 3511
268 Ga0105243_10213304 3300009148 Bacteria 1701
269 Ga0105243_10439307 3300009148 Bacteria 1221
270 Ga0105243_10752693 3300009148 Bacteria 955
271 Ga0105248_11280631 3300009177 Unclassified 829
272 Ga0105237_10013241 3300009545 Bacteria 8654
273 Ga0105237_10016231 3300009545 Bacteria 7744
274 Ga0105237_10320957 3300009545 Bacteria 1552
275 Ga0105238_10103384 3300009551 Bacteria 2830
276 Ga0105238_10204784 3300009551 Bacteria 1949
277 Ga0105238_10255685 3300009551 Bacteria 1731
278 Ga0105249_10000719 3300009553 Bacteria 30139
279 Ga0105249_10017219 3300009553 Bacteria 6416
280 Ga0099796_10000338 3300010159 Bacteria 7589
281 Ga0105239_10000328 3300010375 Bacteria 70165
282 Ga0105239_10014343 3300010375 Bacteria 8792
283 Ga0105239_10067146 3300010375 Bacteria 3939
284 Ga0105239_10095285 3300010375 Bacteria 3288
285 Ga0105246_10068482 3300011119 Bacteria 2490
286 Ga0157373_10069518 3300013100 Bacteria 2489
287 Ga0157371_10033042 3300013102 Bacteria 3720
288 Ga0157370_10264616 3300013104 Bacteria 1589
289 Ga0157370_10563101 3300013104 Bacteria 1044
290 Ga0157369_10006986 3300013105 Bacteria 13022
291 Ga0157369_10046134 3300013105 Bacteria 4737
292 Ga0157369_10095033 3300013105 Bacteria 3181
293 Ga0157374_10476220 3300013296 Bacteria 1251
294 Ga0157378_10714149 3300013297 Bacteria 1023
295 Ga0157372_10085056 3300013307 Bacteria 3587
296 Ga0157372_10141315 3300013307 Bacteria 2774
297 Ga0157372_11251759 3300013307 Bacteria 857
298 Ga0157375_10001087 3300013308 Bacteria 23575
299 Ga0157380_10013927 3300014326 Bacteria 5873
300 Ga0157380_10017083 3300014326 Bacteria 5364
301 Ga0157380_10051650 3300014326 Unclassified 3252
302 Ga0157380_10097494 3300014326 Bacteria 2440
303 Ga0157377_10000038 3300014745 Bacteria 113777
304 Ga0157377_10013920 3300014745 Bacteria 4082
305 Ga0157376_10024319 3300014969 Bacteria 4753
306 Ga0157376_10129325 3300014969 Bacteria 2251
307 Ga0182006_1001206 3300015261 Bacteria 16155
308 Ga0182007_10001393 3300015262 Bacteria 13006
309 Ga0163161_10100239 3300017792 Bacteria 2155
310 Ga0163161_10755358 3300017792 Unclassified 814
311 Ga0209435_100014 3300025206 Bacteria 322129
312 Ga0209436_103101 3300025208 Bacteria 4578
313 Ga0209436_103113 3300025208 Bacteria 4561
314 Ga0209436_107346 3300025208 Bacteria 2310
315 Ga0209672_100539 3300025228 Bacteria 20575
316 Ga0209258_100147 3300025242 Bacteria 162823
317 Ga0207425_1000518 3300025245 Bacteria 23516
318 Ga0207425_1001598 3300025245 Bacteria 9177
319 Ga0207425_1007663 3300025245 Bacteria 2827
320 Ga0209646_1000001 3300025246 Bacteria 3092932
321 Ga0209026_1000073 3300025250 Bacteria 205399
322 Ga0209148_1000122 3300025254 Bacteria 186071
323 Ga0209759_1000013 3300025256 Bacteria 399300
324 Ga0209129_1000601 3300025258 Bacteria 24463
325 Ga0209129_1003026 3300025258 Bacteria 7634
326 Ga0209129_1004064 3300025258 Bacteria 5964
327 Ga0209565_1000248 3300025263 Bacteria 57592
328 Ga0209565_1000462 3300025263 Bacteria 30996
329 Ga0209565_1001796 3300025263 Bacteria 8652
330 Ga0209673_1000008 3300025273 Bacteria 626013
331 Ga0209673_1000377 3300025273 Bacteria 80360
332 Ga0209673_1000681 3300025273 Bacteria 48925
333 Ga0209673_1013907 3300025273 Bacteria 3147
334 Ga0209673_1028266 3300025273 Bacteria 1809
335 Ga0209130_1000216 3300025284 Bacteria 75536
336 Ga0209130_1000218 3300025284 Bacteria 75339
337 Ga0209130_1000269 3300025284 Bacteria 65107
338 Ga0209130_1000614 3300025284 Bacteria 34072
339 Ga0209130_1002698 3300025284 Bacteria 8454
340 Ga0209675_1000136 3300025291 Bacteria 99301
341 Ga0209675_1000673 3300025291 Bacteria 23959
342 Ga0209675_1001146 3300025291 Bacteria 16153
343 Ga0209675_1002838 3300025291 Bacteria 8619
344 Ga0209676_1000007 3300025292 Bacteria 1029371
345 Ga0209676_1000202 3300025292 Bacteria 133078
346 Ga0209676_1002009 3300025292 Bacteria 16042
347 Ga0209676_1008703 3300025292 Bacteria 4482
348 Ga0209025_1000285 3300025294 Bacteria 114575
349 Ga0209025_1001205 3300025294 Bacteria 36303
350 Ga0209025_1003664 3300025294 Bacteria 14218
351 Ga0209025_1006058 3300025294 Bacteria 9563
352 Ga0209025_1008848 3300025294 Bacteria 7143
353 Ga0209025_1011994 3300025294 Bacteria 5619
354 Ga0209025_1046211 3300025294 Bacteria 1794
355 Ga0209564_1000223 3300025295 Bacteria 128117
356 Ga0209564_1000226 3300025295 Bacteria 125693
357 Ga0209564_1000443 3300025295 Bacteria 71364
358 Ga0209564_1002033 3300025295 Bacteria 17545
359 Ga0209564_1004696 3300025295 Bacteria 8192
360 Ga0209758_1000142 3300025297 Bacteria 171779
361 Ga0209758_1005313 3300025297 Bacteria 10045
362 Ga0209758_1009291 3300025297 Bacteria 6141
363 Ga0209050_1000003 3300025298 Bacteria 1609245
364 Ga0209050_1000224 3300025298 Bacteria 125433
365 Ga0209050_1002324 3300025298 Bacteria 16727
366 Ga0209050_1004327 3300025298 Bacteria 9688
367 Ga0209256_1000001 3300025299 Bacteria 2166974
368 Ga0209256_1000114 3300025299 Bacteria 173999
369 Ga0209256_1000174 3300025299 Bacteria 128117
370 Ga0207426_1000117 3300025302 Bacteria 224652
371 Ga0207426_1000162 3300025302 Bacteria 172643
372 Ga0207426_1000232 3300025302 Bacteria 128117
373 Ga0207426_1001659 3300025302 Bacteria 17304
374 Ga0209051_1000003 3300025303 Bacteria 1609245
375 Ga0209051_1000112 3300025303 Bacteria 152667
376 Ga0209051_1000497 3300025303 Bacteria 50521
377 Ga0209051_1000972 3300025303 Bacteria 27946
378 Ga0209051_1005424 3300025303 Bacteria 7461
379 Ga0209257_1000020 3300025304 Bacteria 773356
380 Ga0209257_1000144 3300025304 Bacteria 197078
381 Ga0209257_1000163 3300025304 Bacteria 175355
382 Ga0209257_1000290 3300025304 Bacteria 110826
383 Ga0209257_1003943 3300025304 Bacteria 12048
384 Ga0209257_1005848 3300025304 Bacteria 8335
385 Ga0207697_10042161 3300025315 Unclassified 1874
386 Ga0207656_10026641 3300025321 Bacteria 2359
387 Ga0207642_10272558 3300025899 Unclassified 970
388 Ga0207688_10176626 3300025901 Unclassified 1272
389 Ga0207688_10231300 3300025901 Bacteria 1116
390 Ga0207647_10111140 3300025904 Bacteria 1620
391 Ga0207645_10041034 3300025907 Bacteria 2963
392 Ga0207684_10041981 3300025910 Bacteria 3877
393 Ga0207684_10129711 3300025910 Bacteria 2164
394 Ga0207684_10285769 3300025910 Bacteria 1422
395 Ga0207707_10027781 3300025912 Bacteria 4947
396 Ga0207695_10015535 3300025913 Bacteria 8955
397 Ga0207695_10157766 3300025913 Bacteria 2203
398 Ga0207695_10634927 3300025913 Bacteria 949
399 Ga0207671_10009035 3300025914 Bacteria 8383
400 Ga0207652_10119385 3300025921 Unclassified 2345
401 Ga0207681_10015517 3300025923 Bacteria 4752
402 Ga0207694_10060771 3300025924 Bacteria 2941
403 Ga0207694_10288135 3300025924 Bacteria 1350
404 Ga0207659_10558599 3300025926 Bacteria 973
405 Ga0207706_10010502 3300025933 Bacteria 8463
406 Ga0207706_10035248 3300025933 Bacteria 4449
407 Ga0207709_10003119 3300025935 Bacteria 9969
408 Ga0207709_10007578 3300025935 Bacteria 6030
409 Ga0207709_10025141 3300025935 Bacteria 3407
410 Ga0207709_10033920 3300025935 Bacteria 3003
411 Ga0207670_10001881 3300025936 Bacteria 10967
412 Ga0207670_10166726 3300025936 Bacteria 1648
413 Ga0207669_10521660 3300025937 Unclassified 954
414 Ga0207704_10114209 3300025938 Bacteria 1833
415 Ga0207691_10021260 3300025940 Bacteria 6129
416 Ga0207691_10039139 3300025940 Bacteria 4387
417 Ga0207689_10110651 3300025942 Bacteria 2257
418 Ga0207661_10032621 3300025944 Bacteria 4037
419 Ga0207679_10224793 3300025945 Bacteria 1581
420 Ga0207679_10326337 3300025945 Unclassified 1331
421 Ga0207667_10025177 3300025949 Bacteria 6520
422 Ga0207667_10030151 3300025949 Bacteria 5870
423 Ga0207667_10072804 3300025949 Bacteria 3571
424 Ga0207651_10062152 3300025960 Bacteria 2601
425 Ga0207651_10151872 3300025960 Unclassified 1804
426 Ga0207651_10295395 3300025960 Unclassified 1345
427 Ga0207712_10150562 3300025961 Bacteria 1797
428 Ga0207668_10116877 3300025972 Bacteria 2012
429 Ga0207640_10060057 3300025981 Bacteria 2511
430 Ga0207640_10210971 3300025981 Unclassified 1479
431 Ga0207658_10345273 3300025986 Bacteria 1295
432 Ga0207658_10432214 3300025986 Bacteria 1163
433 Ga0207677_10069488 3300026023 Bacteria 2477
434 Ga0207703_10287408 3300026035 Bacteria 1496
435 Ga0207639_10009374 3300026041 Bacteria 6750
436 Ga0207639_10242487 3300026041 Bacteria 1568
437 Ga0207639_10436471 3300026041 Bacteria 1186
438 Ga0207678_10019228 3300026067 Bacteria 5999
439 Ga0207708_10079713 3300026075 Bacteria 2515
440 Ga0207708_10542762 3300026075 Bacteria 979
441 Ga0207702_10149432 3300026078 Bacteria 2124
442 Ga0207641_10209908 3300026088 Bacteria 1800
443 Ga0207641_10461748 3300026088 Bacteria 1229
444 Ga0207648_10000118 3300026089 Bacteria 77144
445 Ga0207648_10025275 3300026089 Bacteria 5292
446 Ga0207648_10338590 3300026089 Bacteria 1354
447 Ga0207648_10740892 3300026089 Bacteria 912
448 Ga0207676_10030832 3300026095 Bacteria 4028
449 Ga0207676_10111168 3300026095 Bacteria 2293
450 Ga0207674_10004373 3300026116 Bacteria 17040
451 Ga0207674_10191311 3300026116 Bacteria 1996
452 Ga0207674_10540593 3300026116 Bacteria 1126
453 Ga0207675_100001909 3300026118 Bacteria 20795
454 Ga0207675_100003206 3300026118 Bacteria 16048
455 Ga0207675_100118645 3300026118 Unclassified 2502
456 Ga0207675_100323945 3300026118 Bacteria 1505
457 Ga0207683_10031188 3300026121 Bacteria 4626
458 Ga0207683_10098527 3300026121 Unclassified 2608
459 Ga0207683_10183076 3300026121 Bacteria 1900
460 Ga0207698_10014731 3300026142 Bacteria 5209
461 Ga0209813_10038861 3300027866 Bacteria 1440
462 Ga0209813_10046244 3300027866 Bacteria 1344
463 Ga0209974_10004756 3300027876 Bacteria 4820
464 Ga0207428_10001170 3300027907 Bacteria 28244
465 Ga0207428_10006671 3300027907 Bacteria 10599
466 Ga0207428_10174792 3300027907 Bacteria 1625
467 Ga0207428_10201953 3300027907 Bacteria 1495
468 Ga0265356_1000850 3300028017 Bacteria 5023
469 Ga0268266_10005779 3300028379 Bacteria 11456
470 Ga0268266_10040624 3300028379 Bacteria 3965
471 Ga0268265_10000211 3300028380 Bacteria 68076
472 Ga0268265_10019102 3300028380 Bacteria 4757
473 Ga0268265_10129149 3300028380 Bacteria 2097
474 Ga0268265_10436908 3300028380 Bacteria 1219
475 Ga0268264_10053673 3300028381 Bacteria 3363
476 Ga0268264_10270193 3300028381 Bacteria 1588
477 Ga0307517_10012260 3300028786 Bacteria 11787
478 Ga0307517_10115800 3300028786 Bacteria 2010
479 Ga0307517_10340346 3300028786 Unclassified 820
480 Ga0307515_10002735 3300028794 Bacteria 37724
481 Ga0307515_10004327 3300028794 Bacteria 29456
482 Ga0307515_10009775 3300028794 Bacteria 18483
483 Ga0307515_10020040 3300028794 Bacteria 11971
484 Ga0307515_10025281 3300028794 Bacteria 10285
485 Ga0307515_10135482 3300028794 Bacteria 2681
486 Ga0307515_10136765 3300028794 Bacteria 2658
487 Ga0307515_10208838 3300028794 Unclassified 1803
488 Ga0307512_10016074 3300030522 Bacteria 6916
489 Ga0316177_1035019 3300030731 Bacteria 1718
490 Ga0316183_1052862 3300030742 Bacteria 1580
491 Ga0265762_1023378 3300030760 Unclassified 1145
492 Ga0307513_10003908 3300031456 Bacteria 20030
493 Ga0307513_10044731 3300031456 Bacteria 4847
494 Ga0307513_10199121 3300031456 Bacteria 1846
495 Ga0307513_10223745 3300031456 Bacteria 1700
496 Ga0307509_10053248 3300031507 Bacteria 4316
497 Ga0307509_10129081 3300031507 Bacteria 2487
498 Ga0307509_10191987 3300031507 Bacteria 1892
499 Ga0307408_100178609 3300031548 Bacteria 1701
500 Ga0307408_100185844 3300031548 Bacteria 1670
501 Ga0307408_100699876 3300031548 Bacteria 911
502 Ga0307508_10000050 3300031616 Bacteria 135222
503 Ga0307508_10001066 3300031616 Bacteria 31732
504 Ga0307508_10003935 3300031616 Bacteria 14738
505 Ga0307514_10045004 3300031649 Bacteria 3455
506 Ga0307516_10195279 3300031730 Bacteria 1747
507 Ga0307516_10232181 3300031730 Bacteria 1548
508 Ga0307413_10051656 3300031824 Bacteria 2478
509 Ga0307413_10127522 3300031824 Bacteria 1735
510 Ga0307412_10203925 3300031911 Bacteria 1504
511 Ga0307412_10301105 3300031911 Bacteria 1267
512 Ga0307412_10368520 3300031911 Bacteria 1159
513 Ga0307409_100293450 3300031995 Bacteria 1509
514 Ga0307416_100134249 3300032002 Bacteria 2235
515 Ga0307416_100351469 3300032002 Bacteria 1492
516 Ga0307416_100674491 3300032002 Bacteria 1121
517 Ga0307414_10205839 3300032004 Bacteria 1604
518 Ga0307415_100036188 3300032126 Bacteria 3233
519 Ga0307507_10027456 3300033179 Bacteria 6101
520 Ga0373939_0179735 3300035114 Bacteria 788
521 Ga0373941_0149261 3300035115 Bacteria 856
522 Ga0373960_0122837 3300035121 Bacteria 863
523 Ga0373961_0012887 3300035241 Bacteria 2100
524 Ga0373931_0019924 3300035691 Bacteria 3352
525 Ga0395905_0008608 3300037471 Bacteria 10052
526 Ga0395905_0071099 3300037471 Bacteria 3262
527 Ga0395905_0175917 3300037471 Bacteria 2009
528 Ga0395905_0201748 3300037471 Bacteria 1864
529 Ga0395901_0170162 3300038443 Bacteria 2286
530 Ga0451797_0498566 3300041453 Bacteria 1587
531 Ga0451853_0558546 3300041512 Bacteria 1410
532 Ga0439443_011547 3300042003 Bacteria 1295
533 Ga0450893_0004169 3300042532 Bacteria 2299
534 Ga0466969_0010615 3300044656 Bacteria 4881
535 Ga0466969_0028029 3300044656 Bacteria 2880
536 Ga0466965_0009551 3300044683 Bacteria 4509
537 Ga0466966_0001704 3300044684 Bacteria 14203
538 Ga0466966_0009537 3300044684 Bacteria 6425
539 Ga0466961_0002399 3300044693 Bacteria 11641
540 Ga0466963_0017043 3300044694 Bacteria 4524
541 Ga0466964_0001234 3300044706 Bacteria 8677
542 Ga0466970_0032716 3300044765 Bacteria 2747
543 Ga0466970_0104719 3300044765 Bacteria 1542
544 Ga0466957_0040794 3300044842 Bacteria 2804
545 Ga0466960_0010312 3300044901 Bacteria 3878
546 Ga0466959_0000156 3300045049 Bacteria 44750
547 Ga0466959_0118021 3300045049 Bacteria 1888
548 Ga0451576_0024633 3300045051 Bacteria 6498
549 Ga0451576_0121103 3300045051 Bacteria 2724
550 Ga0451576_0750886 3300045051 Bacteria 1025
551 Ga0466967_0001757 3300045976 Bacteria 12950
552 Ga0495638_0004001 3300046460 Bacteria 11319
553 Ga0495638_0018848 3300046460 Bacteria 4576
554 Ga0495610_0048720 3300046512 Bacteria 2079
555 Ga0495610_0050346 3300046512 Bacteria 2034
556 Ga0495616_0000903 3300046513 Bacteria 21412
557 Ga0495620_0059966 3300046515 Bacteria 1588
558 Ga0495620_0071235 3300046515 Bacteria 1422
559 Ga0495631_0000405 3300046518 Bacteria 29764
560 Ga0495632_0018997 3300046519 Bacteria 3753
561 Ga0495632_0095570 3300046519 Bacteria 1404
562 Ga0495637_0006352 3300046520 Bacteria 5940
563 Ga0495643_0014410 3300046522 Bacteria 4704
564 Ga0495643_0082312 3300046522 Bacteria 1673
565 Ga0495654_0002419 3300046530 Bacteria 12027
566 Ga0495621_0000849 3300046539 Bacteria 7787
567 Ga0495621_0007576 3300046539 Bacteria 3221
568 Ga0495597_0009643 3300046542 Bacteria 4760
569 Ga0495656_0198836 3300046615 Bacteria 994
570 Ga0495625_0003005 3300046660 Bacteria 17395
571 Ga0495625_0025776 3300046660 Unclassified 4452
572 Ga0495625_0031201 3300046660 Bacteria 3966
573 Ga0495625_0403263 3300046660 Bacteria 854
574 Ga0495658_0059128 3300046683 Bacteria 2194
575 Ga0495669_0152867 3300046684 Unclassified 1093
576 Ga0495649_0015636 3300046694 Bacteria 4314
577 Ga0495660_0033942 3300046810 Bacteria 2858
578 Ga0495676_0131003 3300047321 Bacteria 1810
579 Ga0495687_000367 3300047443 Bacteria 56387
580 Ga0495593_0026567 3300047673 Bacteria 3195
581 Ga0495614_0061535 3300048089 Bacteria 1613
582 Ga0495626_0037802 3300048091 Bacteria 2292
583 Ga0496102_0010655 3300048905 Bacteria 7919
584 Ga0496105_0508115 3300048908 Bacteria 945
585 Ga0496106_0686821 3300048909 Bacteria 816
586 Ga0496108_0095002 3300048911 Bacteria 2538
587 Ga0496109_0040768 3300048912 Bacteria 4206
588 Ga0496110_0005495 3300048913 Bacteria 9942
589 Ga0496110_0364409 3300048913 Bacteria 1317
590 Ga0496116_0006960 3300048919 Bacteria 10135
591 Ga0496117_0023345 3300048920 Bacteria 4932
592 Ga0496118_0006317 3300048921 Bacteria 13093
593 Ga0496119_0040656 3300048922 Bacteria 2971
594 Ga0496121_0062431 3300048924 Unclassified 3052
595 Ga0496121_0062648 3300048924 Bacteria 3044
596 Ga0496122_0260567 3300048925 Bacteria 962
597 Ga0496123_0068013 3300048926 Bacteria 2246
598 Ga0496124_0009873 3300048927 Bacteria 9762
599 Ga0496124_0161996 3300048927 Bacteria 1742
600 Ga0496124_0350974 3300048927 Bacteria 1043
601 Ga0496125_0005801 3300048928 Bacteria 13563
602 Ga0496125_0067138 3300048928 Bacteria 2828
603 Ga0501034_0238524 3300049571 Bacteria 1765
604 Ga0501042_0374636 3300049578 Unclassified 1030
605 Ga0501069_0081778 3300049585 Bacteria 1820
606 Ga0501083_0381891 3300049744 Bacteria 916
607 nmdc:mga03683_13290_c1 3300050489 Bacteria 3026
608 nmdc:mga03683_42303_c1 3300050489 Bacteria 1874
609 nmdc:mga03683_67770_c1 3300050489 Bacteria 1520
610 nmdc:mga03n38_114388_c1 3300050490 Bacteria 1318
611 nmdc:mga03n38_116052_c1 3300050490 Bacteria 1310
612 nmdc:mga03n38_134106_c1 3300050490 Bacteria 1230
613 nmdc:mga03n38_60058_c1 3300050490 Bacteria 1727
614 nmdc:mga00v17_15333_c1 3300050491 Bacteria 4301
615 nmdc:mga00v17_1626_c1 3300050491 Bacteria 11752
616 nmdc:mga0yw44_13994_c1 3300050492 Bacteria 4243
617 nmdc:mga0k408_11238_c1 3300050493 Bacteria 4867
618 nmdc:mga0k408_2439_c2 3300050493 Bacteria 6617
619 nmdc:mga0k408_275487_c1 3300050493 Bacteria 1004
620 nmdc:mga0k408_28428_c1 3300050493 Bacteria 3179
621 nmdc:mga0k408_30313_c2 3300050493 Bacteria 2256
622 nmdc:mga0k408_313557_c1 3300050493 Unclassified 936
623 nmdc:mga0k408_464040_c1 3300050493 Bacteria 751
624 nmdc:mga06z11_219155_c1 3300050494 Bacteria 1111
625 nmdc:mga06z11_74118_c1 3300050494 Bacteria 1809
626 nmdc:mga04h51_139875_c1 3300050495 Bacteria 917
627 nmdc:mga04h51_38788_c1 3300050495 Unclassified 1544
628 nmdc:mga04h51_76280_c1 3300050495 Bacteria 1181
629 nmdc:mga07m45_2073_c1 3300050496 Bacteria 9307
630 nmdc:mga07m45_2098_c1 3300050496 Bacteria 9263
631 nmdc:mga07m45_210_c1 3300050496 Bacteria 23070
632 nmdc:mga07m45_32993_c1 3300050496 Bacteria 2874
633 nmdc:mga07m45_46242_c1 3300050496 Bacteria 2445
634 nmdc:mga07m45_63975_c1 3300050496 Bacteria 2087
635 nmdc:mga07m45_95836_c1 3300050496 Bacteria 1702
636 nmdc:mga07m45_99617_c1 3300050496 Bacteria 1669
637 nmdc:mga05p37_124482_c1 3300050507 Bacteria 3166
638 nmdc:mga09592_280536_c1 3300050508 Unclassified 1445
639 nmdc:mga09592_6498_c1 3300050508 Bacteria 9523
640 nmdc:mga0qj67_78225_c1 3300050509 Bacteria 2647
641 nmdc:mga06r32_150619_c1 3300050510 Unclassified 2304
642 nmdc:mga06r32_344796_c1 3300050510 Bacteria 1474
643 nmdc:mga06r32_50162_c2 3300050510 Bacteria 2633
644 nmdc:mga08y16_10534_c1 3300050511 Bacteria 9704
645 nmdc:mga08y16_12596_c1 3300050511 Bacteria 8896
646 nmdc:mga08y16_215271_c1 3300050511 Bacteria 1989
647 nmdc:mga08y16_224500_c1 3300050511 Unclassified 1944
648 nmdc:mga08y16_251151_c1 3300050511 Unclassified 1828
649 nmdc:mga08y16_3599_c1 3300050511 Bacteria 16089
650 nmdc:mga0n895_63233_c1 3300050512 Unclassified 3659
651 nmdc:mga0n895_97541_c1 3300050512 Bacteria 2945
652 nmdc:mga0rr50_84822_c1 3300050513 Unclassified 2453
653 nmdc:mga0a205_5674_c1 3300050515 Bacteria 11245
654 nmdc:mga0a205_9437_c1 3300050515 Bacteria 8919
655 Ga0500610_0040772 3300053079 Bacteria 2400
656 Ga0500578_0089688 3300053086 Bacteria 1952
657 Ga0500644_0001224 3300053088 Bacteria 7134
658 Ga0500583_0004231 3300053092 Bacteria 4646
659 Ga0500651_0000217 3300053093 Bacteria 36081
660 Ga0500651_0173020 3300053093 Bacteria 1286
661 Ga0500566_0084204 3300053094 Bacteria 1765
662 Ga0500562_044030 3300053108 Bacteria 1188
663 Ga0500571_002139 3300053110 Bacteria 9692
664 Ga0500593_000770 3300053117 Bacteria 12006
665 Ga0500594_0003486 3300053118 Bacteria 3460
666 Ga0500608_005510 3300053122 Bacteria 5041
667 Ga0500626_002518 3300053128 Bacteria 6354
668 Ga0500628_003253 3300053129 Bacteria 2675
669 Ga0500642_0081137 3300053130 Bacteria 1490
670 Ga0500655_001011 3300053133 Bacteria 5426
671 Ga0500658_0000686 3300053134 Bacteria 13986
672 Ga0500658_0000800 3300053134 Bacteria 13026
673 Ga0500658_0027843 3300053134 Bacteria 2189
674 Ga0500559_0014533 3300053136 Bacteria 3327
675 Ga0500564_016563 3300053138 Bacteria 3340
676 Ga0500568_0004042 3300053139 Bacteria 7949
677 Ga0500568_0027934 3300053139 Bacteria 2356
678 Ga0500590_039194 3300053148 Bacteria 2442
679 Ga0500616_0000030 3300053153 Bacteria 415224
680 Ga0500616_0227635 3300053153 Bacteria 809
681 Ga0500619_000179 3300053154 Bacteria 15172
682 Ga0500638_036650 3300053162 Bacteria 2378
683 Ga0500587_000509 3300053739 Bacteria 4702

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10069115 Ga0075362_100691152 182
2 3300050489 nmdc:mga03683_13290_c1 nmdc:mga03683_13290_c1_1032_1766 182
3 3300042532 Ga0450893_0004169 Ga0450893_0004169_583_1317 197
4 3300048909 Ga0496106_0686821 Ga0496106_0686821_167_769 199
5 3300009094 Ga0111539_10005321 Ga0111539_1000532110 200
6 3300009553 Ga0105249_10000719 Ga0105249_1000071911 200
7 3300050511 nmdc:mga08y16_3599_c1 nmdc:mga08y16_3599_c1_6106_6711 200
8 3300048908 Ga0496105_0508115 Ga0496105_0508115_19_750 201
9 3300027876 Ga0209974_10004756 Ga0209974_100047562 203
10 3300037471 Ga0395905_0175917 Ga0395905_0175917_1101_1832 206
11 3300038443 Ga0395901_0170162 Ga0395901_0170162_1337_2068 206
12 3300030522 Ga0307512_10016074 Ga0307512_100160748 207
13 3300035114 Ga0373939_0179735 Ga0373939_0179735_13_708 207
14 3300031649 Ga0307514_10045004 Ga0307514_100450042 208
15 3300025901 Ga0207688_10176626 Ga0207688_101766262 211
16 3300053108 Ga0500562_044030 Ga0500562_044030_15_650 211
17 3300028794 Ga0307515_10135482 Ga0307515_101354822 212
18 3300005459 Ga0068867_100766957 Ga0068867_1007669571 213
19 3300005539 Ga0068853_100087384 Ga0068853_1000873842 213
20 3300005616 Ga0068852_100396283 Ga0068852_1003962832 213
21 3300009093 Ga0105240_10007179 Ga0105240_100071794 213
22 3300009545 Ga0105237_10013241 Ga0105237_100132415 213
23 3300010375 Ga0105239_10000328 Ga0105239_1000032816 213
24 3300025913 Ga0207695_10015535 Ga0207695_100155357 213
25 3300025914 Ga0207671_10009035 Ga0207671_100090356 213
26 3300026041 Ga0207639_10242487 Ga0207639_102424872 213
27 3300026089 Ga0207648_10740892 Ga0207648_107408922 213
28 3300028794 Ga0307515_10004327 Ga0307515_100043275 214
29 3300046683 Ga0495658_0059128 Ga0495658_0059128_373_1101 214
30 3300028794 Ga0307515_10002735 Ga0307515_1000273535 215
31 3300031456 Ga0307513_10003908 Ga0307513_100039088 215
32 3300031507 Ga0307509_10191987 Ga0307509_101919872 215
33 3300031616 Ga0307508_10000050 Ga0307508_1000005081 215
34 3300005455 Ga0070663_100009363 Ga0070663_1000093633 216
35 3300006177 Ga0075362_10126482 Ga0075362_101264822 216
36 3300026067 Ga0207678_10019228 Ga0207678_100192284 216
37 3300028794 Ga0307515_10009775 Ga0307515_1000977513 216
38 3300041512 Ga0451853_0558546 Ga0451853_0558546_453_1181 216
39 3300044656 Ga0466969_0028029 Ga0466969_0028029_1256_2038 216
40 3300044683 Ga0466965_0009551 Ga0466965_0009551_2048_2830 216
41 3300044684 Ga0466966_0009537 Ga0466966_0009537_4442_5224 216
42 3300044694 Ga0466963_0017043 Ga0466963_0017043_683_1465 216
43 3300044706 Ga0466964_0001234 Ga0466964_0001234_7536_8318 216
44 3300044765 Ga0466970_0032716 Ga0466970_0032716_723_1505 216
45 3300044842 Ga0466957_0040794 Ga0466957_0040794_1719_2501 216
46 3300045049 Ga0466959_0000156 Ga0466959_0000156_14201_14983 216
47 3300045976 Ga0466967_0001757 Ga0466967_0001757_2484_3266 216
48 3300053739 Ga0500587_000509 Ga0500587_000509_20_706 216
49 3300028786 Ga0307517_10012260 Ga0307517_100122608 217
50 3300028794 Ga0307515_10136765 Ga0307515_101367651 217
51 3300028794 Ga0307515_10208838 Ga0307515_102088383 217
52 3300031548 Ga0307408_100178609 Ga0307408_1001786092 217
53 3300031911 Ga0307412_10203925 Ga0307412_102039252 217
54 3300032002 Ga0307416_100674491 Ga0307416_1006744912 217
55 3300046512 Ga0495610_0050346 Ga0495610_0050346_126_854 217
56 3300046519 Ga0495632_0095570 Ga0495632_0095570_204_938 217
57 3300046660 Ga0495625_0403263 Ga0495625_0403263_42_776 217
58 3300050493 nmdc:mga0k408_30313_c2 nmdc:mga0k408_30313_c2_463_1191 217
59 3300050496 nmdc:mga07m45_63975_c1 nmdc:mga07m45_63975_c1_906_1634 217
60 3300005293 Ga0065715_10102963 Ga0065715_101029632 218
61 3300005563 Ga0068855_100009405 Ga0068855_1000094055 218
62 3300006038 Ga0075365_10053529 Ga0075365_100535293 218
63 3300006042 Ga0075368_10053596 Ga0075368_100535962 218
64 3300006048 Ga0075363_100209016 Ga0075363_1002090162 218
65 3300006051 Ga0075364_10289634 Ga0075364_102896342 218
66 3300006178 Ga0075367_10090669 Ga0075367_100906692 218
67 3300006195 Ga0075366_10250723 Ga0075366_102507232 218
68 3300006353 Ga0075370_10057500 Ga0075370_100575002 218
69 3300006353 Ga0075370_10316976 Ga0075370_103169761 218
70 3300006852 Ga0075433_10014097 Ga0075433_100140975 218
71 3300006871 Ga0075434_100019051 Ga0075434_1000190513 218
72 3300007076 Ga0075435_100058900 Ga0075435_1000589004 218
73 3300009177 Ga0105248_11280631 Ga0105248_112806311 218
74 3300025949 Ga0207667_10030151 Ga0207667_100301513 218
75 3300027866 Ga0209813_10046244 Ga0209813_100462442 218
76 3300031456 Ga0307513_10044731 Ga0307513_100447312 218
77 3300041453 Ga0451797_0498566 Ga0451797_0498566_806_1540 218
78 3300046660 Ga0495625_0003005 Ga0495625_0003005_5881_6609 218
79 3300050490 nmdc:mga03n38_134106_c1 nmdc:mga03n38_134106_c1_329_1063 218
80 3300050491 nmdc:mga00v17_1626_c1 nmdc:mga00v17_1626_c1_10157_10891 218
81 3300050492 nmdc:mga0yw44_13994_c1 nmdc:mga0yw44_13994_c1_2967_3701 218
82 3300050493 nmdc:mga0k408_464040_c1 nmdc:mga0k408_464040_c1_46_735 218
83 3300050495 nmdc:mga04h51_76280_c1 nmdc:mga04h51_76280_c1_68_802 218
84 3300050496 nmdc:mga07m45_2073_c1 nmdc:mga07m45_2073_c1_5687_6421 218
85 3300050512 nmdc:mga0n895_63233_c1 nmdc:mga0n895_63233_c1_1370_2062 218
86 3300050513 nmdc:mga0rr50_84822_c1 nmdc:mga0rr50_84822_c1_757_1449 218
87 3300050515 nmdc:mga0a205_9437_c1 nmdc:mga0a205_9437_c1_4160_4852 218
88 3300053092 Ga0500583_0004231 Ga0500583_0004231_2390_3136 218
89 3300031548 Ga0307408_100699876 Ga0307408_1006998762 219
90 3300031616 Ga0307508_10001066 Ga0307508_1000106623 219
91 3300037471 Ga0395905_0008608 Ga0395905_0008608_1516_2247 219
92 3300037471 Ga0395905_0071099 Ga0395905_0071099_1204_1938 219
93 3300042003 Ga0439443_011547 Ga0439443_011547_477_1211 219
94 3300044656 Ga0466969_0010615 Ga0466969_0010615_1117_1848 220
95 3300044684 Ga0466966_0001704 Ga0466966_0001704_10822_11553 220
96 3300044693 Ga0466961_0002399 Ga0466961_0002399_1371_2102 220
97 3300044765 Ga0466970_0104719 Ga0466970_0104719_537_1268 220
98 3300045049 Ga0466959_0118021 Ga0466959_0118021_913_1644 220
99 3300048905 Ga0496102_0010655 Ga0496102_0010655_967_1695 220
100 3300048912 Ga0496109_0040768 Ga0496109_0040768_3161_3895 220
101 3300005444 Ga0070694_100315567 Ga0070694_1003155672 221
102 3300005844 Ga0068862_100408709 Ga0068862_1004087092 221
103 3300006847 Ga0075431_100127572 Ga0075431_1001275723 221
104 3300009094 Ga0111539_10195776 Ga0111539_101957762 221
105 3300028380 Ga0268265_10436908 Ga0268265_104369082 221
106 3300050510 nmdc:mga06r32_50162_c2 nmdc:mga06r32_50162_c2_1472_2206 221
107 3300002739 JGI25158J39367_1011392 JGI25158J39367_10113921 223
108 3300002773 JGI25152J39213_1003919 JGI25152J39213_10039195 223
109 3300002987 JGI25159J45721_1007697 JGI25159J45721_10076972 223
110 3300003187 JGI25151J46595_10002892 JGI25151J46595_100028928 223
111 3300003215 JGI25153J46596_10002836 JGI25153J46596_100028365 223
112 3300003354 JGI25160J50197_1004870 JGI25160J50197_10048707 223
113 3300003374 JGI25161J50226_1004966 JGI25161J50226_10049663 223
114 3300003578 Ga0006562J51391_1039354 Ga0006562J51391_10393544 223
115 3300003781 Ga0055536_1002259 Ga0055536_100225910 223
116 3300003791 Ga0055530_10000386 Ga0055530_100003869 223
117 3300003792 Ga0055540_1003175 Ga0055540_10031757 223
118 3300003794 Ga0055531_10002998 Ga0055531_1000299810 223
119 3300004625 Ga0055543_1002930 Ga0055543_10029304 223
120 3300005262 Ga0065165_1007714 Ga0065165_10077145 223
121 3300006353 Ga0075370_10234274 Ga0075370_102342742 223
122 3300025208 Ga0209436_103113 Ga0209436_1031134 223
123 3300025245 Ga0207425_1001598 Ga0207425_10015985 223
124 3300025258 Ga0209129_1004064 Ga0209129_10040643 223
125 3300025273 Ga0209673_1000377 Ga0209673_100037715 223
126 3300025284 Ga0209130_1000614 Ga0209130_10006149 223
127 3300025284 Ga0209130_1002698 Ga0209130_10026985 223
128 3300025291 Ga0209675_1001146 Ga0209675_10011467 223
129 3300025292 Ga0209676_1000202 Ga0209676_100020251 223
130 3300025294 Ga0209025_1008848 Ga0209025_10088488 223
131 3300025295 Ga0209564_1000223 Ga0209564_1000223123 223
132 3300025297 Ga0209758_1005313 Ga0209758_10053138 223
133 3300025298 Ga0209050_1000224 Ga0209050_10002249 223
134 3300025299 Ga0209256_1000174 Ga0209256_1000174123 223
135 3300025302 Ga0207426_1000232 Ga0207426_1000232123 223
136 3300025303 Ga0209051_1000497 Ga0209051_100049721 223
137 3300025304 Ga0209257_1000163 Ga0209257_1000163123 223
138 3300026116 Ga0207674_10540593 Ga0207674_105405932 223
139 3300031824 Ga0307413_10127522 Ga0307413_101275222 223
140 3300031911 Ga0307412_10368520 Ga0307412_103685201 223
141 3300032002 Ga0307416_100134249 Ga0307416_1001342492 223
142 3300032126 Ga0307415_100036188 Ga0307415_1000361883 223
143 3300005295 Ga0065707_10107161 Ga0065707_101071613 224
144 3300005336 Ga0070680_100242916 Ga0070680_1002429162 224
145 3300005353 Ga0070669_100009114 Ga0070669_1000091142 224
146 3300005366 Ga0070659_100410456 Ga0070659_1004104562 224
147 3300005577 Ga0068857_100010788 Ga0068857_1000107882 224
148 3300005618 Ga0068864_100200674 Ga0068864_1002006742 224
149 3300005844 Ga0068862_100440109 Ga0068862_1004401092 224
150 3300006844 Ga0075428_100029742 Ga0075428_1000297425 224
151 3300006846 Ga0075430_100159976 Ga0075430_1001599762 224
152 3300006847 Ga0075431_100037295 Ga0075431_1000372953 224
153 3300006880 Ga0075429_100046639 Ga0075429_1000466392 224
154 3300006880 Ga0075429_100242620 Ga0075429_1002426202 224
155 3300009094 Ga0111539_10004096 Ga0111539_100040965 224
156 3300009094 Ga0111539_10090659 Ga0111539_100906594 224
157 3300011119 Ga0105246_10068482 Ga0105246_100684823 224
158 3300014326 Ga0157380_10013927 Ga0157380_100139273 224
159 3300014745 Ga0157377_10013920 Ga0157377_100139202 224
160 3300025901 Ga0207688_10231300 Ga0207688_102313001 224
161 3300025961 Ga0207712_10150562 Ga0207712_101505622 224
162 3300026116 Ga0207674_10191311 Ga0207674_101913112 224
163 3300027907 Ga0207428_10006671 Ga0207428_100066716 224
164 3300027907 Ga0207428_10174792 Ga0207428_101747922 224
165 3300050508 nmdc:mga09592_6498_c1 nmdc:mga09592_6498_c1_8654_9388 224
166 3300050511 nmdc:mga08y16_10534_c1 nmdc:mga08y16_10534_c1_3327_4061 224
167 3300050511 nmdc:mga08y16_251151_c1 nmdc:mga08y16_251151_c1_24_758 224
168 3300006871 Ga0075434_100149383 Ga0075434_1001493833 225
169 3300007076 Ga0075435_100779332 Ga0075435_1007793321 225
170 3300005365 Ga0070688_100567095 Ga0070688_1005670951 226
171 3300003323 rootH1_10158496 rootH1_101584963 227
172 3300048911 Ga0496108_0095002 Ga0496108_0095002_770_1504 227
173 3300053154 Ga0500619_000179 Ga0500619_000179_8722_9447 227
174 3300003792 Ga0055540_1002089 Ga0055540_10020899 228
175 3300003794 Ga0055531_10003465 Ga0055531_100034656 228
176 3300005328 Ga0070676_10445860 Ga0070676_104458601 228
177 3300005329 Ga0070683_100035296 Ga0070683_1000352961 228
178 3300005333 Ga0070677_10107040 Ga0070677_101070402 228
179 3300005356 Ga0070674_100435859 Ga0070674_1004358592 228
180 3300005456 Ga0070678_100161737 Ga0070678_1001617372 228
181 3300005458 Ga0070681_10092205 Ga0070681_100922053 228
182 3300005459 Ga0068867_100048820 Ga0068867_1000488202 228
183 3300005548 Ga0070665_100525164 Ga0070665_1005251642 228
184 3300007788 Ga0099795_10000252 Ga0099795_100002524 228
185 3300009093 Ga0105240_10205219 Ga0105240_102052192 228
186 3300009551 Ga0105238_10204784 Ga0105238_102047842 228
187 3300010159 Ga0099796_10000338 Ga0099796_100003385 228
188 3300013105 Ga0157369_10046134 Ga0157369_100461345 228
189 3300013105 Ga0157369_10095033 Ga0157369_100950332 228
190 3300013307 Ga0157372_10085056 Ga0157372_100850565 228
191 3300013307 Ga0157372_10141315 Ga0157372_101413152 228
192 3300014326 Ga0157380_10017083 Ga0157380_100170835 228
193 3300025273 Ga0209673_1013907 Ga0209673_10139072 228
194 3300025303 Ga0209051_1000972 Ga0209051_100097212 228
195 3300025304 Ga0209257_1000144 Ga0209257_1000144189 228
196 3300025907 Ga0207645_10041034 Ga0207645_100410344 228
197 3300025912 Ga0207707_10027781 Ga0207707_100277812 228
198 3300025913 Ga0207695_10634927 Ga0207695_106349272 228
199 3300025921 Ga0207652_10119385 Ga0207652_101193852 228
200 3300025937 Ga0207669_10521660 Ga0207669_105216602 228
201 3300025944 Ga0207661_10032621 Ga0207661_100326215 228
202 3300025949 Ga0207667_10025177 Ga0207667_100251773 228
203 3300028017 Ga0265356_1000850 Ga0265356_10008503 228
204 3300030760 Ga0265762_1023378 Ga0265762_10233782 228
205 3300031824 Ga0307413_10051656 Ga0307413_100516563 228
206 3300031995 Ga0307409_100293450 Ga0307409_1002934502 228
207 3300044901 Ga0466960_0010312 Ga0466960_0010312_2933_3628 228
208 3300045051 Ga0451576_0121103 Ga0451576_0121103_1536_2267 228
209 3300046522 Ga0495643_0014410 Ga0495643_0014410_2923_3651 228
210 3300046660 Ga0495625_0031201 Ga0495625_0031201_24_755 228
211 3300050510 nmdc:mga06r32_150619_c1 nmdc:mga06r32_150619_c1_306_995 228
212 3300053139 Ga0500568_0027934 Ga0500568_0027934_571_1302 228
213 iso_pu_bacteria 2585428062 2587756494 228
214 3300001989 JGI24739J22299_10107636 JGI24739J22299_101076361 229
215 3300002704 JGI25155J39150_1000041 JGI25155J39150_100004116 229
216 3300002705 JGI25156J39149_1000031 JGI25156J39149_100003166 229
217 3300002738 JGI25154J39366_1000049 JGI25154J39366_100004947 229
218 3300002741 JGI25157J39369_1000041 JGI25157J39369_100004147 229
219 3300002773 JGI25152J39213_1001385 JGI25152J39213_10013855 229
220 3300002774 JGI25150J39212_1004083 JGI25150J39212_10040832 229
221 3300002987 JGI25159J45721_1002044 JGI25159J45721_10020447 229
222 3300002987 JGI25159J45721_1004046 JGI25159J45721_10040463 229
223 3300002987 JGI25159J45721_1027216 JGI25159J45721_10272161 229
224 3300003187 JGI25151J46595_10002148 JGI25151J46595_100021489 229
225 3300003187 JGI25151J46595_10002546 JGI25151J46595_100025467 229
226 3300003187 JGI25151J46595_10012456 JGI25151J46595_100124565 229
227 3300003187 JGI25151J46595_10035283 JGI25151J46595_100352832 229
228 3300003187 JGI25151J46595_10040471 JGI25151J46595_100404712 229
229 3300003215 JGI25153J46596_10001619 JGI25153J46596_100016198 229
230 3300003316 rootH1_10029614 rootH1_100296147 229
231 3300003320 rootH2_10145589 rootH2_101455891 229
232 3300003354 JGI25160J50197_1000684 JGI25160J50197_10006845 229
233 3300003354 JGI25160J50197_1001665 JGI25160J50197_10016655 229
234 3300003374 JGI25161J50226_1000042 JGI25161J50226_100004211 229
235 3300003374 JGI25161J50226_1012128 JGI25161J50226_10121281 229
236 3300003761 Ga0055535_1000192 Ga0055535_10001928 229
237 3300003762 Ga0055542_1000058 Ga0055542_100005851 229
238 3300003771 Ga0055526_1006434 Ga0055526_10064343 229
239 3300003771 Ga0055526_1008120 Ga0055526_10081205 229
240 3300003771 Ga0055526_1008276 Ga0055526_10082765 229
241 3300003773 Ga0055537_1000865 Ga0055537_100086510 229
242 3300003773 Ga0055537_1000915 Ga0055537_10009159 229
243 3300003775 Ga0055524_1000260 Ga0055524_100026021 229
244 3300003775 Ga0055524_1004565 Ga0055524_10045653 229
245 3300003784 Ga0055534_1001009 Ga0055534_10010099 229
246 3300003784 Ga0055534_1002221 Ga0055534_10022212 229
247 3300003784 Ga0055534_1019916 Ga0055534_10199162 229
248 3300003790 Ga0055528_1001308 Ga0055528_100130811 229
249 3300003790 Ga0055528_1008604 Ga0055528_10086046 229
250 3300003791 Ga0055530_10000553 Ga0055530_1000055321 229
251 3300003791 Ga0055530_10007037 Ga0055530_100070375 229
252 3300003792 Ga0055540_1000010 Ga0055540_100001021 229
253 3300003792 Ga0055540_1001280 Ga0055540_10012809 229
254 3300003792 Ga0055540_1020075 Ga0055540_10200752 229
255 3300003794 Ga0055531_10001065 Ga0055531_1000106514 229
256 3300003794 Ga0055531_10001780 Ga0055531_100017809 229
257 3300003794 Ga0055531_10003566 Ga0055531_100035668 229
258 3300004625 Ga0055543_1000279 Ga0055543_10002798 229
259 3300004625 Ga0055543_1000922 Ga0055543_10009225 229
260 3300005262 Ga0065165_1002803 Ga0065165_10028035 229
261 3300005262 Ga0065165_1008412 Ga0065165_10084123 229
262 3300005262 Ga0065165_1008974 Ga0065165_10089743 229
263 3300005293 Ga0065715_10105842 Ga0065715_101058423 229
264 3300005293 Ga0065715_10168814 Ga0065715_101688142 229
265 3300005295 Ga0065707_10005231 Ga0065707_100052313 229
266 3300005295 Ga0065707_10082114 Ga0065707_100821149 229
267 3300005295 Ga0065707_10123977 Ga0065707_101239772 229
268 3300005328 Ga0070676_10090163 Ga0070676_100901631 229
269 3300005329 Ga0070683_100021428 Ga0070683_1000214282 229
270 3300005330 Ga0070690_100078474 Ga0070690_1000784742 229
271 3300005331 Ga0070670_100245844 Ga0070670_1002458441 229
272 3300005331 Ga0070670_100731007 Ga0070670_1007310071 229
273 3300005334 Ga0068869_100094676 Ga0068869_1000946763 229
274 3300005334 Ga0068869_100205532 Ga0068869_1002055322 229
275 3300005337 Ga0070682_100345692 Ga0070682_1003456922 229
276 3300005338 Ga0068868_100584430 Ga0068868_1005844301 229
277 3300005339 Ga0070660_100119996 Ga0070660_1001199962 229
278 3300005339 Ga0070660_100278148 Ga0070660_1002781482 229
279 3300005340 Ga0070689_100001812 Ga0070689_10000181210 229
280 3300005340 Ga0070689_100043554 Ga0070689_1000435544 229
281 3300005343 Ga0070687_100015192 Ga0070687_1000151922 229
282 3300005353 Ga0070669_100003380 Ga0070669_1000033808 229
283 3300005353 Ga0070669_100039261 Ga0070669_1000392612 229
284 3300005354 Ga0070675_100108096 Ga0070675_1001080962 229
285 3300005354 Ga0070675_100365796 Ga0070675_1003657962 229
286 3300005355 Ga0070671_100045984 Ga0070671_1000459844 229
287 3300005356 Ga0070674_100245741 Ga0070674_1002457412 229
288 3300005356 Ga0070674_100456435 Ga0070674_1004564351 229
289 3300005364 Ga0070673_100135404 Ga0070673_1001354042 229
290 3300005364 Ga0070673_100183174 Ga0070673_1001831742 229
291 3300005364 Ga0070673_100244687 Ga0070673_1002446872 229
292 3300005365 Ga0070688_100022761 Ga0070688_1000227612 229
293 3300005365 Ga0070688_100367980 Ga0070688_1003679801 229
294 3300005366 Ga0070659_100225401 Ga0070659_1002254012 229
295 3300005367 Ga0070667_100185086 Ga0070667_1001850862 229
296 3300005440 Ga0070705_100067429 Ga0070705_1000674292 229
297 3300005441 Ga0070700_100002005 Ga0070700_1000020056 229
298 3300005441 Ga0070700_100044838 Ga0070700_1000448384 229
299 3300005441 Ga0070700_100307412 Ga0070700_1003074122 229
300 3300005444 Ga0070694_100002855 Ga0070694_1000028556 229
301 3300005456 Ga0070678_100036820 Ga0070678_1000368202 229
302 3300005456 Ga0070678_100059787 Ga0070678_1000597873 229
303 3300005457 Ga0070662_100016502 Ga0070662_1000165024 229
304 3300005457 Ga0070662_100018289 Ga0070662_1000182893 229
305 3300005459 Ga0068867_100000042 Ga0068867_10000004250 229
306 3300005459 Ga0068867_100009240 Ga0068867_1000092404 229
307 3300005467 Ga0070706_100006362 Ga0070706_1000063624 229
308 3300005467 Ga0070706_100054184 Ga0070706_1000541842 229
309 3300005467 Ga0070706_100136563 Ga0070706_1001365632 229
310 3300005468 Ga0070707_100014136 Ga0070707_1000141366 229
311 3300005471 Ga0070698_100083197 Ga0070698_1000831973 229
312 3300005518 Ga0070699_100069382 Ga0070699_1000693823 229
313 3300005539 Ga0068853_100004595 Ga0068853_1000045959 229
314 3300005539 Ga0068853_100021439 Ga0068853_1000214394 229
315 3300005539 Ga0068853_100075897 Ga0068853_1000758974 229
316 3300005543 Ga0070672_100057979 Ga0070672_1000579792 229
317 3300005544 Ga0070686_100015782 Ga0070686_1000157824 229
318 3300005544 Ga0070686_100061239 Ga0070686_1000612393 229
319 3300005546 Ga0070696_100444715 Ga0070696_1004447151 229
320 3300005547 Ga0070693_100030718 Ga0070693_1000307181 229
321 3300005548 Ga0070665_100003695 Ga0070665_10000369511 229
322 3300005548 Ga0070665_100035690 Ga0070665_1000356903 229
323 3300005549 Ga0070704_100002098 Ga0070704_1000020985 229
324 3300005549 Ga0070704_100218470 Ga0070704_1002184702 229
325 3300005563 Ga0068855_100432269 Ga0068855_1004322692 229
326 3300005563 Ga0068855_100745602 Ga0068855_1007456022 229
327 3300005564 Ga0070664_100004106 Ga0070664_1000041067 229
328 3300005564 Ga0070664_100305096 Ga0070664_1003050962 229
329 3300005564 Ga0070664_100439725 Ga0070664_1004397252 229
330 3300005577 Ga0068857_100003699 Ga0068857_10000369910 229
331 3300005577 Ga0068857_100010135 Ga0068857_1000101353 229
332 3300005577 Ga0068857_100031414 Ga0068857_1000314144 229
333 3300005578 Ga0068854_100033283 Ga0068854_1000332832 229
334 3300005578 Ga0068854_100043779 Ga0068854_1000437794 229
335 3300005578 Ga0068854_100241690 Ga0068854_1002416902 229
336 3300005614 Ga0068856_100172206 Ga0068856_1001722063 229
337 3300005615 Ga0070702_100001656 Ga0070702_1000016568 229
338 3300005616 Ga0068852_100021501 Ga0068852_1000215015 229
339 3300005616 Ga0068852_100160793 Ga0068852_1001607932 229
340 3300005617 Ga0068859_100003913 Ga0068859_10000391313 229
341 3300005617 Ga0068859_100103230 Ga0068859_1001032303 229
342 3300005618 Ga0068864_100017265 Ga0068864_1000172654 229
343 3300005618 Ga0068864_100050776 Ga0068864_1000507763 229
344 3300005718 Ga0068866_10191716 Ga0068866_101917162 229
345 3300005719 Ga0068861_100001582 Ga0068861_1000015828 229
346 3300005719 Ga0068861_100001663 Ga0068861_10000166313 229
347 3300005719 Ga0068861_100016468 Ga0068861_1000164683 229
348 3300005834 Ga0068851_10037901 Ga0068851_100379012 229
349 3300005840 Ga0068870_10002226 Ga0068870_100022264 229
350 3300005842 Ga0068858_100148991 Ga0068858_1001489912 229
351 3300005843 Ga0068860_100120159 Ga0068860_1001201593 229
352 3300005843 Ga0068860_100544879 Ga0068860_1005448792 229
353 3300005844 Ga0068862_100012186 Ga0068862_1000121862 229
354 3300005844 Ga0068862_100070665 Ga0068862_1000706652 229
355 3300005937 Ga0081455_10000066 Ga0081455_1000006631 229
356 3300006038 Ga0075365_10101130 Ga0075365_101011302 229
357 3300006038 Ga0075365_10243622 Ga0075365_102436222 229
358 3300006042 Ga0075368_10138046 Ga0075368_101380462 229
359 3300006048 Ga0075363_100084158 Ga0075363_1000841582 229
360 3300006048 Ga0075363_100153068 Ga0075363_1001530682 229
361 3300006051 Ga0075364_10019429 Ga0075364_100194292 229
362 3300006051 Ga0075364_10257702 Ga0075364_102577022 229
363 3300006058 Ga0075432_10078416 Ga0075432_100784162 229
364 3300006177 Ga0075362_10034649 Ga0075362_100346493 229
365 3300006177 Ga0075362_10042494 Ga0075362_100424942 229
366 3300006178 Ga0075367_10006362 Ga0075367_100063623 229
367 3300006178 Ga0075367_10011215 Ga0075367_100112153 229
368 3300006178 Ga0075367_10024107 Ga0075367_100241072 229
369 3300006178 Ga0075367_10031771 Ga0075367_100317714 229
370 3300006178 Ga0075367_10272318 Ga0075367_102723182 229
371 3300006186 Ga0075369_10014370 Ga0075369_100143704 229
372 3300006195 Ga0075366_10004217 Ga0075366_100042175 229
373 3300006195 Ga0075366_10012200 Ga0075366_100122002 229
374 3300006195 Ga0075366_10013204 Ga0075366_100132042 229
375 3300006195 Ga0075366_10019104 Ga0075366_100191042 229
376 3300006195 Ga0075366_10030349 Ga0075366_100303492 229
377 3300006195 Ga0075366_10031403 Ga0075366_100314032 229
378 3300006195 Ga0075366_10070035 Ga0075366_100700352 229
379 3300006195 Ga0075366_10179727 Ga0075366_101797272 229
380 3300006237 Ga0097621_100187141 Ga0097621_1001871413 229
381 3300006237 Ga0097621_100241906 Ga0097621_1002419062 229
382 3300006353 Ga0075370_10000059 Ga0075370_1000005926 229
383 3300006353 Ga0075370_10000220 Ga0075370_100002207 229
384 3300006353 Ga0075370_10008504 Ga0075370_100085043 229
385 3300006353 Ga0075370_10028264 Ga0075370_100282642 229
386 3300006353 Ga0075370_10043563 Ga0075370_100435633 229
387 3300006358 Ga0068871_100012030 Ga0068871_1000120302 229
388 3300006358 Ga0068871_100056557 Ga0068871_1000565573 229
389 3300006358 Ga0068871_100198273 Ga0068871_1001982733 229
390 3300006844 Ga0075428_100008577 Ga0075428_1000085778 229
391 3300006846 Ga0075430_100069168 Ga0075430_1000691682 229
392 3300006847 Ga0075431_100330878 Ga0075431_1003308781 229
393 3300006871 Ga0075434_100029189 Ga0075434_1000291892 229
394 3300006880 Ga0075429_100120549 Ga0075429_1001205493 229
395 3300006881 Ga0068865_100029574 Ga0068865_1000295743 229
396 3300006931 Ga0097620_100003912 Ga0097620_1000039125 229
397 3300006931 Ga0097620_100103227 Ga0097620_1001032273 229
398 3300006948 Ga0099826_10078446 Ga0099826_100784462 229
399 3300009036 Ga0105244_10004022 Ga0105244_100040228 229
400 3300009093 Ga0105240_10449574 Ga0105240_104495742 229
401 3300009094 Ga0111539_10024487 Ga0111539_100244873 229
402 3300009094 Ga0111539_10102418 Ga0111539_101024182 229
403 3300009094 Ga0111539_10582489 Ga0111539_105824892 229
404 3300009098 Ga0105245_10040873 Ga0105245_100408732 229
405 3300009101 Ga0105247_10080016 Ga0105247_100800162 229
406 3300009147 Ga0114129_10031517 Ga0114129_100315175 229
407 3300009147 Ga0114129_10183832 Ga0114129_101838321 229
408 3300009148 Ga0105243_10002909 Ga0105243_100029095 229
409 3300009148 Ga0105243_10003902 Ga0105243_100039027 229
410 3300009148 Ga0105243_10043728 Ga0105243_100437283 229
411 3300009148 Ga0105243_10213304 Ga0105243_102133042 229
412 3300009148 Ga0105243_10439307 Ga0105243_104393072 229
413 3300009148 Ga0105243_10752693 Ga0105243_107526932 229
414 3300009545 Ga0105237_10016231 Ga0105237_100162313 229
415 3300009545 Ga0105237_10320957 Ga0105237_103209572 229
416 3300009551 Ga0105238_10103384 Ga0105238_101033842 229
417 3300009551 Ga0105238_10255685 Ga0105238_102556852 229
418 3300009553 Ga0105249_10017219 Ga0105249_100172192 229
419 3300010375 Ga0105239_10014343 Ga0105239_100143434 229
420 3300010375 Ga0105239_10067146 Ga0105239_100671463 229
421 3300010375 Ga0105239_10095285 Ga0105239_100952854 229
422 3300013100 Ga0157373_10069518 Ga0157373_100695183 229
423 3300013102 Ga0157371_10033042 Ga0157371_100330423 229
424 3300013104 Ga0157370_10264616 Ga0157370_102646162 229
425 3300013104 Ga0157370_10563101 Ga0157370_105631011 229
426 3300013105 Ga0157369_10006986 Ga0157369_100069868 229
427 3300013296 Ga0157374_10476220 Ga0157374_104762202 229
428 3300013297 Ga0157378_10714149 Ga0157378_107141492 229
429 3300013307 Ga0157372_11251759 Ga0157372_112517592 229
430 3300013308 Ga0157375_10001087 Ga0157375_100010878 229
431 3300014326 Ga0157380_10051650 Ga0157380_100516504 229
432 3300014326 Ga0157380_10097494 Ga0157380_100974942 229
433 3300014745 Ga0157377_10000038 Ga0157377_1000003849 229
434 3300014969 Ga0157376_10024319 Ga0157376_100243194 229
435 3300014969 Ga0157376_10129325 Ga0157376_101293252 229
436 3300015261 Ga0182006_1001206 Ga0182006_10012068 229
437 3300015262 Ga0182007_10001393 Ga0182007_100013938 229
438 3300017792 Ga0163161_10100239 Ga0163161_101002392 229
439 3300017792 Ga0163161_10755358 Ga0163161_107553581 229
440 3300025206 Ga0209435_100014 Ga0209435_10001447 229
441 3300025208 Ga0209436_103101 Ga0209436_1031014 229
442 3300025208 Ga0209436_107346 Ga0209436_1073463 229
443 3300025228 Ga0209672_100539 Ga0209672_10053917 229
444 3300025242 Ga0209258_100147 Ga0209258_100147104 229
445 3300025245 Ga0207425_1000518 Ga0207425_100051819 229
446 3300025245 Ga0207425_1007663 Ga0207425_10076633 229
447 3300025246 Ga0209646_1000001 Ga0209646_100000148 229
448 3300025250 Ga0209026_1000073 Ga0209026_100007347 229
449 3300025254 Ga0209148_1000122 Ga0209148_100012251 229
450 3300025256 Ga0209759_1000013 Ga0209759_100001348 229
451 3300025258 Ga0209129_1000601 Ga0209129_10006019 229
452 3300025258 Ga0209129_1003026 Ga0209129_10030263 229
453 3300025263 Ga0209565_1000248 Ga0209565_100024813 229
454 3300025263 Ga0209565_1000462 Ga0209565_100046227 229
455 3300025263 Ga0209565_1001796 Ga0209565_10017965 229
456 3300025273 Ga0209673_1000008 Ga0209673_1000008438 229
457 3300025273 Ga0209673_1000681 Ga0209673_100068112 229
458 3300025273 Ga0209673_1028266 Ga0209673_10282661 229
459 3300025284 Ga0209130_1000216 Ga0209130_100021665 229
460 3300025284 Ga0209130_1000218 Ga0209130_10002188 229
461 3300025284 Ga0209130_1000269 Ga0209130_10002695 229
462 3300025291 Ga0209675_1000136 Ga0209675_10001365 229
463 3300025291 Ga0209675_1000673 Ga0209675_100067323 229
464 3300025291 Ga0209675_1002838 Ga0209675_10028385 229
465 3300025292 Ga0209676_1000007 Ga0209676_100000747 229
466 3300025292 Ga0209676_1002009 Ga0209676_10020099 229
467 3300025292 Ga0209676_1008703 Ga0209676_10087034 229
468 3300025294 Ga0209025_1000285 Ga0209025_100028561 229
469 3300025294 Ga0209025_1001205 Ga0209025_100120511 229
470 3300025294 Ga0209025_1003664 Ga0209025_100366410 229
471 3300025294 Ga0209025_1006058 Ga0209025_10060587 229
472 3300025294 Ga0209025_1011994 Ga0209025_10119944 229
473 3300025294 Ga0209025_1046211 Ga0209025_10462112 229
474 3300025295 Ga0209564_1000226 Ga0209564_100022610 229
475 3300025295 Ga0209564_1000443 Ga0209564_100044360 229
476 3300025295 Ga0209564_1002033 Ga0209564_100203311 229
477 3300025295 Ga0209564_1004696 Ga0209564_10046965 229
478 3300025297 Ga0209758_1000142 Ga0209758_100014248 229
479 3300025297 Ga0209758_1009291 Ga0209758_10092915 229
480 3300025298 Ga0209050_1000003 Ga0209050_10000031461 229
481 3300025298 Ga0209050_1002324 Ga0209050_100232411 229
482 3300025298 Ga0209050_1004327 Ga0209050_10043275 229
483 3300025299 Ga0209256_1000001 Ga0209256_10000011463 229
484 3300025299 Ga0209256_1000114 Ga0209256_100011448 229
485 3300025302 Ga0207426_1000117 Ga0207426_100011720 229
486 3300025302 Ga0207426_1000162 Ga0207426_100016247 229
487 3300025302 Ga0207426_1001659 Ga0207426_100165916 229
488 3300025303 Ga0209051_1000003 Ga0209051_10000031461 229
489 3300025303 Ga0209051_1000112 Ga0209051_100011295 229
490 3300025303 Ga0209051_1005424 Ga0209051_10054242 229
491 3300025304 Ga0209257_1000020 Ga0209257_100002047 229
492 3300025304 Ga0209257_1000290 Ga0209257_100029042 229
493 3300025304 Ga0209257_1003943 Ga0209257_10039437 229
494 3300025304 Ga0209257_1005848 Ga0209257_10058488 229
495 3300025315 Ga0207697_10042161 Ga0207697_100421613 229
496 3300025321 Ga0207656_10026641 Ga0207656_100266412 229
497 3300025899 Ga0207642_10272558 Ga0207642_102725582 229
498 3300025904 Ga0207647_10111140 Ga0207647_101111402 229
499 3300025910 Ga0207684_10041981 Ga0207684_100419812 229
500 3300025910 Ga0207684_10129711 Ga0207684_101297112 229
501 3300025910 Ga0207684_10285769 Ga0207684_102857692 229
502 3300025913 Ga0207695_10157766 Ga0207695_101577662 229
503 3300025923 Ga0207681_10015517 Ga0207681_100155174 229
504 3300025924 Ga0207694_10060771 Ga0207694_100607713 229
505 3300025924 Ga0207694_10288135 Ga0207694_102881352 229
506 3300025926 Ga0207659_10558599 Ga0207659_105585992 229
507 3300025933 Ga0207706_10010502 Ga0207706_100105026 229
508 3300025933 Ga0207706_10035248 Ga0207706_100352482 229
509 3300025935 Ga0207709_10003119 Ga0207709_100031197 229
510 3300025935 Ga0207709_10007578 Ga0207709_100075786 229
511 3300025935 Ga0207709_10025141 Ga0207709_100251413 229
512 3300025935 Ga0207709_10033920 Ga0207709_100339202 229
513 3300025936 Ga0207670_10001881 Ga0207670_100018818 229
514 3300025936 Ga0207670_10166726 Ga0207670_101667262 229
515 3300025938 Ga0207704_10114209 Ga0207704_101142092 229
516 3300025940 Ga0207691_10021260 Ga0207691_100212603 229
517 3300025940 Ga0207691_10039139 Ga0207691_100391394 229
518 3300025942 Ga0207689_10110651 Ga0207689_101106513 229
519 3300025945 Ga0207679_10224793 Ga0207679_102247932 229
520 3300025945 Ga0207679_10326337 Ga0207679_103263372 229
521 3300025949 Ga0207667_10072804 Ga0207667_100728044 229
522 3300025960 Ga0207651_10062152 Ga0207651_100621523 229
523 3300025960 Ga0207651_10151872 Ga0207651_101518722 229
524 3300025960 Ga0207651_10295395 Ga0207651_102953952 229
525 3300025972 Ga0207668_10116877 Ga0207668_101168772 229
526 3300025981 Ga0207640_10060057 Ga0207640_100600572 229
527 3300025981 Ga0207640_10210971 Ga0207640_102109712 229
528 3300025986 Ga0207658_10345273 Ga0207658_103452732 229
529 3300025986 Ga0207658_10432214 Ga0207658_104322141 229
530 3300026023 Ga0207677_10069488 Ga0207677_100694883 229
531 3300026035 Ga0207703_10287408 Ga0207703_102874082 229
532 3300026041 Ga0207639_10009374 Ga0207639_100093745 229
533 3300026041 Ga0207639_10436471 Ga0207639_104364712 229
534 3300026075 Ga0207708_10079713 Ga0207708_100797133 229
535 3300026075 Ga0207708_10542762 Ga0207708_105427622 229
536 3300026078 Ga0207702_10149432 Ga0207702_101494322 229
537 3300026088 Ga0207641_10209908 Ga0207641_102099082 229
538 3300026088 Ga0207641_10461748 Ga0207641_104617482 229
539 3300026089 Ga0207648_10000118 Ga0207648_1000011849 229
540 3300026089 Ga0207648_10025275 Ga0207648_100252757 229
541 3300026089 Ga0207648_10338590 Ga0207648_103385902 229
542 3300026095 Ga0207676_10030832 Ga0207676_100308325 229
543 3300026095 Ga0207676_10111168 Ga0207676_101111682 229
544 3300026116 Ga0207674_10004373 Ga0207674_100043738 229
545 3300026118 Ga0207675_100001909 Ga0207675_10000190913 229
546 3300026118 Ga0207675_100003206 Ga0207675_1000032068 229
547 3300026118 Ga0207675_100118645 Ga0207675_1001186453 229
548 3300026118 Ga0207675_100323945 Ga0207675_1003239452 229
549 3300026121 Ga0207683_10031188 Ga0207683_100311885 229
550 3300026121 Ga0207683_10098527 Ga0207683_100985272 229
551 3300026121 Ga0207683_10183076 Ga0207683_101830762 229
552 3300026142 Ga0207698_10014731 Ga0207698_100147312 229
553 3300027866 Ga0209813_10038861 Ga0209813_100388612 229
554 3300027907 Ga0207428_10001170 Ga0207428_1000117026 229
555 3300027907 Ga0207428_10201953 Ga0207428_102019532 229
556 3300028379 Ga0268266_10005779 Ga0268266_100057795 229
557 3300028379 Ga0268266_10040624 Ga0268266_100406244 229
558 3300028380 Ga0268265_10000211 Ga0268265_1000021152 229
559 3300028380 Ga0268265_10019102 Ga0268265_100191025 229
560 3300028380 Ga0268265_10129149 Ga0268265_101291492 229
561 3300028381 Ga0268264_10053673 Ga0268264_100536735 229
562 3300028381 Ga0268264_10270193 Ga0268264_102701932 229
563 3300028786 Ga0307517_10115800 Ga0307517_101158003 229
564 3300028786 Ga0307517_10340346 Ga0307517_103403461 229
565 3300028794 Ga0307515_10020040 Ga0307515_100200403 229
566 3300028794 Ga0307515_10025281 Ga0307515_100252818 229
567 3300030731 Ga0316177_1035019 Ga0316177_10350192 229
568 3300030742 Ga0316183_1052862 Ga0316183_10528622 229
569 3300031456 Ga0307513_10199121 Ga0307513_101991212 229
570 3300031456 Ga0307513_10223745 Ga0307513_102237452 229
571 3300031507 Ga0307509_10053248 Ga0307509_100532483 229
572 3300031507 Ga0307509_10129081 Ga0307509_101290813 229
573 3300031548 Ga0307408_100185844 Ga0307408_1001858442 229
574 3300031616 Ga0307508_10003935 Ga0307508_100039358 229
575 3300031730 Ga0307516_10195279 Ga0307516_101952792 229
576 3300031730 Ga0307516_10232181 Ga0307516_102321812 229
577 3300031911 Ga0307412_10301105 Ga0307412_103011052 229
578 3300032002 Ga0307416_100351469 Ga0307416_1003514692 229
579 3300032004 Ga0307414_10205839 Ga0307414_102058392 229
580 3300033179 Ga0307507_10027456 Ga0307507_100274566 229
581 3300035115 Ga0373941_0149261 Ga0373941_0149261_55_789 229
582 3300035121 Ga0373960_0122837 Ga0373960_0122837_69_803 229
583 3300035241 Ga0373961_0012887 Ga0373961_0012887_585_1319 229
584 3300035691 Ga0373931_0019924 Ga0373931_0019924_2082_2819 229
585 3300037471 Ga0395905_0201748 Ga0395905_0201748_322_1059 229
586 3300045051 Ga0451576_0024633 Ga0451576_0024633_2318_3052 229
587 3300045051 Ga0451576_0750886 Ga0451576_0750886_280_1014 229
588 3300046460 Ga0495638_0004001 Ga0495638_0004001_3651_4385 229
589 3300046460 Ga0495638_0018848 Ga0495638_0018848_3309_3998 229
590 3300046512 Ga0495610_0048720 Ga0495610_0048720_757_1491 229
591 3300046513 Ga0495616_0000903 Ga0495616_0000903_9897_10586 229
592 3300046515 Ga0495620_0059966 Ga0495620_0059966_227_961 229
593 3300046515 Ga0495620_0071235 Ga0495620_0071235_262_951 229
594 3300046518 Ga0495631_0000405 Ga0495631_0000405_6190_6879 229
595 3300046519 Ga0495632_0018997 Ga0495632_0018997_2403_3137 229
596 3300046520 Ga0495637_0006352 Ga0495637_0006352_674_1363 229
597 3300046522 Ga0495643_0082312 Ga0495643_0082312_210_947 229
598 3300046530 Ga0495654_0002419 Ga0495654_0002419_8733_9422 229
599 3300046539 Ga0495621_0000849 Ga0495621_0000849_2420_3154 229
600 3300046539 Ga0495621_0007576 Ga0495621_0007576_1852_2541 229
601 3300046542 Ga0495597_0009643 Ga0495597_0009643_2550_3287 229
602 3300046615 Ga0495656_0198836 Ga0495656_0198836_191_925 229
603 3300046660 Ga0495625_0025776 Ga0495625_0025776_1750_2484 229
604 3300046684 Ga0495669_0152867 Ga0495669_0152867_187_879 229
605 3300046694 Ga0495649_0015636 Ga0495649_0015636_370_1104 229
606 3300046810 Ga0495660_0033942 Ga0495660_0033942_1177_1911 229
607 3300047321 Ga0495676_0131003 Ga0495676_0131003_515_1279 229
608 3300047443 Ga0495687_000367 Ga0495687_000367_28065_28802 229
609 3300047673 Ga0495593_0026567 Ga0495593_0026567_387_1151 229
610 3300048089 Ga0495614_0061535 Ga0495614_0061535_431_1195 229
611 3300048091 Ga0495626_0037802 Ga0495626_0037802_1087_1821 229
612 3300048913 Ga0496110_0005495 Ga0496110_0005495_946_1680 229
613 3300048913 Ga0496110_0364409 Ga0496110_0364409_68_802 229
614 3300048919 Ga0496116_0006960 Ga0496116_0006960_166_903 229
615 3300048920 Ga0496117_0023345 Ga0496117_0023345_280_1017 229
616 3300048921 Ga0496118_0006317 Ga0496118_0006317_10915_11652 229
617 3300048922 Ga0496119_0040656 Ga0496119_0040656_1530_2219 229
618 3300048924 Ga0496121_0062431 Ga0496121_0062431_341_1075 229
619 3300048924 Ga0496121_0062648 Ga0496121_0062648_2227_2916 229
620 3300048925 Ga0496122_0260567 Ga0496122_0260567_262_951 229
621 3300048926 Ga0496123_0068013 Ga0496123_0068013_315_1004 229
622 3300048927 Ga0496124_0009873 Ga0496124_0009873_3486_4223 229
623 3300048927 Ga0496124_0161996 Ga0496124_0161996_691_1380 229
624 3300048927 Ga0496124_0350974 Ga0496124_0350974_107_838 229
625 3300048928 Ga0496125_0005801 Ga0496125_0005801_5464_6201 229
626 3300048928 Ga0496125_0067138 Ga0496125_0067138_287_1018 229
627 3300049571 Ga0501034_0238524 Ga0501034_0238524_381_1115 229
628 3300049578 Ga0501042_0374636 Ga0501042_0374636_284_991 229
629 3300049585 Ga0501069_0081778 Ga0501069_0081778_137_871 229
630 3300049744 Ga0501083_0381891 Ga0501083_0381891_167_901 229
631 3300050489 nmdc:mga03683_42303_c1 nmdc:mga03683_42303_c1_717_1472 229
632 3300050489 nmdc:mga03683_67770_c1 nmdc:mga03683_67770_c1_711_1475 229
633 3300050490 nmdc:mga03n38_114388_c1 nmdc:mga03n38_114388_c1_447_1181 229
634 3300050490 nmdc:mga03n38_116052_c1 nmdc:mga03n38_116052_c1_432_1169 229
635 3300050490 nmdc:mga03n38_60058_c1 nmdc:mga03n38_60058_c1_587_1342 229
636 3300050491 nmdc:mga00v17_15333_c1 nmdc:mga00v17_15333_c1_2585_3319 229
637 3300050493 nmdc:mga0k408_11238_c1 nmdc:mga0k408_11238_c1_712_1446 229
638 3300050493 nmdc:mga0k408_2439_c2 nmdc:mga0k408_2439_c2_4328_5062 229
639 3300050493 nmdc:mga0k408_275487_c1 nmdc:mga0k408_275487_c1_85_840 229
640 3300050493 nmdc:mga0k408_28428_c1 nmdc:mga0k408_28428_c1_2385_3119 229
641 3300050493 nmdc:mga0k408_313557_c1 nmdc:mga0k408_313557_c1_48_785 229
642 3300050494 nmdc:mga06z11_219155_c1 nmdc:mga06z11_219155_c1_133_870 229
643 3300050494 nmdc:mga06z11_74118_c1 nmdc:mga06z11_74118_c1_863_1597 229
644 3300050495 nmdc:mga04h51_139875_c1 nmdc:mga04h51_139875_c1_52_795 229
645 3300050495 nmdc:mga04h51_38788_c1 nmdc:mga04h51_38788_c1_519_1253 229
646 3300050496 nmdc:mga07m45_2098_c1 nmdc:mga07m45_2098_c1_1053_1784 229
647 3300050496 nmdc:mga07m45_210_c1 nmdc:mga07m45_210_c1_20315_21049 229
648 3300050496 nmdc:mga07m45_32993_c1 nmdc:mga07m45_32993_c1_1241_2005 229
649 3300050496 nmdc:mga07m45_46242_c1 nmdc:mga07m45_46242_c1_1213_1956 229
650 3300050496 nmdc:mga07m45_95836_c1 nmdc:mga07m45_95836_c1_461_1192 229
651 3300050496 nmdc:mga07m45_99617_c1 nmdc:mga07m45_99617_c1_889_1623 229
652 3300050507 nmdc:mga05p37_124482_c1 nmdc:mga05p37_124482_c1_219_953 229
653 3300050508 nmdc:mga09592_280536_c1 nmdc:mga09592_280536_c1_434_1168 229
654 3300050509 nmdc:mga0qj67_78225_c1 nmdc:mga0qj67_78225_c1_991_1725 229
655 3300050510 nmdc:mga06r32_344796_c1 nmdc:mga06r32_344796_c1_718_1452 229
656 3300050511 nmdc:mga08y16_12596_c1 nmdc:mga08y16_12596_c1_5038_5772 229
657 3300050511 nmdc:mga08y16_215271_c1 nmdc:mga08y16_215271_c1_656_1390 229
658 3300050511 nmdc:mga08y16_224500_c1 nmdc:mga08y16_224500_c1_596_1330 229
659 3300050512 nmdc:mga0n895_97541_c1 nmdc:mga0n895_97541_c1_138_872 229
660 3300050515 nmdc:mga0a205_5674_c1 nmdc:mga0a205_5674_c1_4293_5027 229
661 3300053079 Ga0500610_0040772 Ga0500610_0040772_1188_1919 229
662 3300053086 Ga0500578_0089688 Ga0500578_0089688_1164_1898 229
663 3300053088 Ga0500644_0001224 Ga0500644_0001224_4158_4913 229
664 3300053093 Ga0500651_0000217 Ga0500651_0000217_29974_30738 229
665 3300053093 Ga0500651_0173020 Ga0500651_0173020_60_794 229
666 3300053094 Ga0500566_0084204 Ga0500566_0084204_983_1747 229
667 3300053110 Ga0500571_002139 Ga0500571_002139_2812_3576 229
668 3300053117 Ga0500593_000770 Ga0500593_000770_3338_4093 229
669 3300053118 Ga0500594_0003486 Ga0500594_0003486_115_804 229
670 3300053122 Ga0500608_005510 Ga0500608_005510_2678_3409 229
671 3300053128 Ga0500626_002518 Ga0500626_002518_1459_2148 229
672 3300053129 Ga0500628_003253 Ga0500628_003253_216_971 229
673 3300053130 Ga0500642_0081137 Ga0500642_0081137_218_952 229
674 3300053133 Ga0500655_001011 Ga0500655_001011_2799_3563 229
675 3300053134 Ga0500658_0000686 Ga0500658_0000686_4680_5369 229
676 3300053134 Ga0500658_0000800 Ga0500658_0000800_7659_8423 229
677 3300053134 Ga0500658_0027843 Ga0500658_0027843_1274_2020 229
678 3300053136 Ga0500559_0014533 Ga0500559_0014533_2533_3222 229
679 3300053138 Ga0500564_016563 Ga0500564_016563_721_1485 229
680 3300053139 Ga0500568_0004042 Ga0500568_0004042_5647_6336 229
681 3300053148 Ga0500590_039194 Ga0500590_039194_199_933 229
682 3300053153 Ga0500616_0000030 Ga0500616_0000030_141903_142637 229
683 3300053153 Ga0500616_0227635 Ga0500616_0227635_51_785 229
684 3300053162 Ga0500638_036650 Ga0500638_036650_539_1303 229
685 iso_pu_bacteria 2511231002 2511247321 229
686 iso_pu_bacteria 2513020051 2513229188 229
687 iso_pu_bacteria 2599185214 2599626812 229
688 iso_pu_bacteria 2599185226 2599676058 229
689 iso_pu_bacteria 2599185227 2599684349 229
690 iso_pu_bacteria 2599185229 2599696363 229
691 iso_pu_bacteria 2643221672 2644398137 229
692 iso_pu_bacteria 2818991446 2819601889 229
693 iso_pu_bacteria 2831265667 2831269470 229
694 iso_pu_bacteria 2838054893 2838060964 229
695 iso_pu_bacteria 2885198086 2885199946 229
696 iso_pu_bacteria 2885211737 2885213533 229
697 iso_pu_bacteria 2899924645 2899926473 229
698 iso_pu_bacteria 2928037797 2928039807 229
699 iso_pu_bacteria 2928044640 2928047444 229
700 iso_pu_bacteria 2928051484 2928058581 229
701 iso_pu_bacteria 2928064002 2928070383 229
702 iso_pu_bacteria 2928070936 2928072842 229
703 iso_pu_bacteria 2928084124 2928090547 229
704 iso_pu_bacteria 2954767861 2954769352 229

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d79-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas fragi 0.4016 10 210
6d79-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas fragi 0.3815 10 210
6d79-assembly1.cif.gz_A structure of cysz, a sulfate permease from pseudomonas fragi 0.317 10 191
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.2892 3 208
6d79-assembly1.cif.gz_A structure of cysz, a sulfate permease from pseudomonas fragi 0.285 10 191
ID Description Score Start End Superfamily
af_I1KKE2_86_367_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.471 34 207 1.50.40.10
af_Q9XVL4_1_176_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4467 134 229 1.20.140.150
af_I1KKE2_86_367_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.3747 34 207 1.50.40.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3697 4 227 1.20.1070.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3425 4 227 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7C2PDH1-F1-model_v4 DUF4129 domain-containing protein 0.9477 3 228 GO:0016020
AF-A0A257CB62-F1-model_v4 DUF4129 domain-containing protein 0.9473 3 228 GO:0016020
AF-A0A7C2PDH1-F1-model_v4 DUF4129 domain-containing protein 0.9318 3 228 GO:0016020
AF-A0A536WSP7-F1-model_v4 DUF4129 domain-containing protein 0.9244 1 228 GO:0016020
AF-A0A257CB62-F1-model_v4 DUF4129 domain-containing protein 0.9235 3 228 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map