F476375
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 355 | 683 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300047321|Ga0495676_0131003|Ga0495676_0131003_515_1279 |
| Length | 254 |
| Sequence | VPLLLLQRLKTVQVDGLAIALRPRPMAEAADLGVQLVRNHARSVWRTFLPVYIVTVLLALCTVEIAGWLPSLLIFWLKPWFDRSLLFIHSRAVFGQETRWSDLWQNRRVVWGGQLLRTLLWRRLSPWRSFTQAIDQLEGQRGGARRKRRTQLLRGRRGAATGMQMVFANVEMALDICLLSLLFWFAPEGSARDLFGWLTQSDVPLQSLLTAGAYALVIGVLEPFYVAAGFAMYLNRRVELEAWDIEQEFRRGFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 9 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 10 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 11 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 12 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 13 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 14 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 15 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 16 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 17 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 18 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 19 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 20 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 21 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 27 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 28 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 29 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 30 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 38 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 52 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 234 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 235 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 236 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 237 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 238 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 262 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 309 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 339 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 343 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 344 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 345 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 347 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 0.28 |
| Isolates | 2.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 32.39 |
| Nodule | 0.28 |
| Rhizoplane | 1.56 |
| Rhizosphere | 56.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10107636 | 3300001989 | Bacteria | 838 |
| 2 | JGI25155J39150_1000041 | 3300002704 | Bacteria | 88843 |
| 3 | JGI25156J39149_1000031 | 3300002705 | Bacteria | 124983 |
| 4 | JGI25154J39366_1000049 | 3300002738 | Bacteria | 124995 |
| 5 | JGI25158J39367_1011392 | 3300002739 | Bacteria | 1187 |
| 6 | JGI25157J39369_1000041 | 3300002741 | Bacteria | 124982 |
| 7 | JGI25152J39213_1001385 | 3300002773 | Bacteria | 10512 |
| 8 | JGI25152J39213_1003919 | 3300002773 | Bacteria | 4881 |
| 9 | JGI25150J39212_1004083 | 3300002774 | Bacteria | 3303 |
| 10 | JGI25159J45721_1002044 | 3300002987 | Bacteria | 7985 |
| 11 | JGI25159J45721_1004046 | 3300002987 | Bacteria | 4986 |
| 12 | JGI25159J45721_1007697 | 3300002987 | Bacteria | 3054 |
| 13 | JGI25159J45721_1027216 | 3300002987 | Bacteria | 974 |
| 14 | JGI25151J46595_10002148 | 3300003187 | Bacteria | 12247 |
| 15 | JGI25151J46595_10002546 | 3300003187 | Bacteria | 10815 |
| 16 | JGI25151J46595_10002892 | 3300003187 | Bacteria | 9846 |
| 17 | JGI25151J46595_10012456 | 3300003187 | Bacteria | 3866 |
| 18 | JGI25151J46595_10035283 | 3300003187 | Bacteria | 1901 |
| 19 | JGI25151J46595_10040471 | 3300003187 | Bacteria | 1706 |
| 20 | JGI25153J46596_10001619 | 3300003215 | Bacteria | 13360 |
| 21 | JGI25153J46596_10002836 | 3300003215 | Bacteria | 9847 |
| 22 | rootH1_10029614 | 3300003316 | Bacteria | 6153 |
| 23 | rootH2_10145589 | 3300003320 | Bacteria | 1883 |
| 24 | rootH1_10158496 | 3300003323 | Bacteria | 4214 |
| 25 | JGI25160J50197_1000684 | 3300003354 | Bacteria | 18764 |
| 26 | JGI25160J50197_1001665 | 3300003354 | Bacteria | 10845 |
| 27 | JGI25160J50197_1004870 | 3300003354 | Bacteria | 5716 |
| 28 | JGI25161J50226_1000042 | 3300003374 | Bacteria | 123841 |
| 29 | JGI25161J50226_1004966 | 3300003374 | Bacteria | 2689 |
| 30 | JGI25161J50226_1012128 | 3300003374 | Bacteria | 1045 |
| 31 | Ga0006562J51391_1039354 | 3300003578 | Bacteria | 3790 |
| 32 | Ga0055535_1000192 | 3300003761 | Bacteria | 64814 |
| 33 | Ga0055542_1000058 | 3300003762 | Bacteria | 162781 |
| 34 | Ga0055526_1006434 | 3300003771 | Bacteria | 6370 |
| 35 | Ga0055526_1008120 | 3300003771 | Bacteria | 5292 |
| 36 | Ga0055526_1008276 | 3300003771 | Bacteria | 5218 |
| 37 | Ga0055537_1000865 | 3300003773 | Bacteria | 14531 |
| 38 | Ga0055537_1000915 | 3300003773 | Bacteria | 13891 |
| 39 | Ga0055524_1000260 | 3300003775 | Bacteria | 53486 |
| 40 | Ga0055524_1004565 | 3300003775 | Bacteria | 6370 |
| 41 | Ga0055536_1002259 | 3300003781 | Bacteria | 10963 |
| 42 | Ga0055534_1001009 | 3300003784 | Bacteria | 12390 |
| 43 | Ga0055534_1002221 | 3300003784 | Bacteria | 6891 |
| 44 | Ga0055534_1019916 | 3300003784 | Bacteria | 1143 |
| 45 | Ga0055528_1001308 | 3300003790 | Bacteria | 15606 |
| 46 | Ga0055528_1008604 | 3300003790 | Bacteria | 4347 |
| 47 | Ga0055530_10000386 | 3300003791 | Bacteria | 39620 |
| 48 | Ga0055530_10000553 | 3300003791 | Bacteria | 32445 |
| 49 | Ga0055530_10007037 | 3300003791 | Bacteria | 4838 |
| 50 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 51 | Ga0055540_1001280 | 3300003792 | Bacteria | 15303 |
| 52 | Ga0055540_1002089 | 3300003792 | Bacteria | 10966 |
| 53 | Ga0055540_1003175 | 3300003792 | Bacteria | 8109 |
| 54 | Ga0055540_1020075 | 3300003792 | Bacteria | 1780 |
| 55 | Ga0055531_10001065 | 3300003794 | Bacteria | 21587 |
| 56 | Ga0055531_10001780 | 3300003794 | Bacteria | 15303 |
| 57 | Ga0055531_10002998 | 3300003794 | Bacteria | 10960 |
| 58 | Ga0055531_10003465 | 3300003794 | Bacteria | 10039 |
| 59 | Ga0055531_10003566 | 3300003794 | Bacteria | 9876 |
| 60 | Ga0055543_1000279 | 3300004625 | Bacteria | 37669 |
| 61 | Ga0055543_1000922 | 3300004625 | Bacteria | 13701 |
| 62 | Ga0055543_1002930 | 3300004625 | Bacteria | 5333 |
| 63 | Ga0065165_1002803 | 3300005262 | Bacteria | 13701 |
| 64 | Ga0065165_1007714 | 3300005262 | Bacteria | 5210 |
| 65 | Ga0065165_1008412 | 3300005262 | Bacteria | 4833 |
| 66 | Ga0065165_1008974 | 3300005262 | Bacteria | 4573 |
| 67 | Ga0065715_10102963 | 3300005293 | Unclassified | 3068 |
| 68 | Ga0065715_10105842 | 3300005293 | Unclassified | 2867 |
| 69 | Ga0065715_10168814 | 3300005293 | Bacteria | 1564 |
| 70 | Ga0065707_10005231 | 3300005295 | Bacteria | 3372 |
| 71 | Ga0065707_10082114 | 3300005295 | Bacteria | 21501 |
| 72 | Ga0065707_10107161 | 3300005295 | Bacteria | 2566 |
| 73 | Ga0065707_10123977 | 3300005295 | Unclassified | 2054 |
| 74 | Ga0070676_10090163 | 3300005328 | Bacteria | 1877 |
| 75 | Ga0070676_10445860 | 3300005328 | Bacteria | 909 |
| 76 | Ga0070683_100021428 | 3300005329 | Bacteria | 5768 |
| 77 | Ga0070683_100035296 | 3300005329 | Bacteria | 4571 |
| 78 | Ga0070690_100078474 | 3300005330 | Bacteria | 2157 |
| 79 | Ga0070670_100245844 | 3300005331 | Bacteria | 1558 |
| 80 | Ga0070670_100731007 | 3300005331 | Unclassified | 891 |
| 81 | Ga0070677_10107040 | 3300005333 | Bacteria | 1242 |
| 82 | Ga0068869_100094676 | 3300005334 | Bacteria | 2252 |
| 83 | Ga0068869_100205532 | 3300005334 | Bacteria | 1555 |
| 84 | Ga0070680_100242916 | 3300005336 | Bacteria | 1522 |
| 85 | Ga0070682_100345692 | 3300005337 | Bacteria | 1107 |
| 86 | Ga0068868_100584430 | 3300005338 | Bacteria | 988 |
| 87 | Ga0070660_100119996 | 3300005339 | Bacteria | 2098 |
| 88 | Ga0070660_100278148 | 3300005339 | Bacteria | 1369 |
| 89 | Ga0070689_100001812 | 3300005340 | Bacteria | 13734 |
| 90 | Ga0070689_100043554 | 3300005340 | Bacteria | 3450 |
| 91 | Ga0070687_100015192 | 3300005343 | Bacteria | 3474 |
| 92 | Ga0070669_100003380 | 3300005353 | Bacteria | 11478 |
| 93 | Ga0070669_100009114 | 3300005353 | Bacteria | 7072 |
| 94 | Ga0070669_100039261 | 3300005353 | Bacteria | 3439 |
| 95 | Ga0070675_100108096 | 3300005354 | Bacteria | 2349 |
| 96 | Ga0070675_100365796 | 3300005354 | Bacteria | 1281 |
| 97 | Ga0070671_100045984 | 3300005355 | Bacteria | 3630 |
| 98 | Ga0070674_100245741 | 3300005356 | Bacteria | 1403 |
| 99 | Ga0070674_100435859 | 3300005356 | Bacteria | 1079 |
| 100 | Ga0070674_100456435 | 3300005356 | Bacteria | 1056 |
| 101 | Ga0070673_100135404 | 3300005364 | Bacteria | 2073 |
| 102 | Ga0070673_100183174 | 3300005364 | Unclassified | 1794 |
| 103 | Ga0070673_100244687 | 3300005364 | Bacteria | 1561 |
| 104 | Ga0070688_100022761 | 3300005365 | Bacteria | 3678 |
| 105 | Ga0070688_100367980 | 3300005365 | Unclassified | 1057 |
| 106 | Ga0070688_100567095 | 3300005365 | Bacteria | 865 |
| 107 | Ga0070659_100225401 | 3300005366 | Bacteria | 1548 |
| 108 | Ga0070659_100410456 | 3300005366 | Bacteria | 1144 |
| 109 | Ga0070667_100185086 | 3300005367 | Bacteria | 1843 |
| 110 | Ga0070705_100067429 | 3300005440 | Bacteria | 2149 |
| 111 | Ga0070700_100002005 | 3300005441 | Bacteria | 10342 |
| 112 | Ga0070700_100044838 | 3300005441 | Unclassified | 2725 |
| 113 | Ga0070700_100307412 | 3300005441 | Bacteria | 1160 |
| 114 | Ga0070694_100002855 | 3300005444 | Bacteria | 10258 |
| 115 | Ga0070694_100315567 | 3300005444 | Bacteria | 1202 |
| 116 | Ga0070663_100009363 | 3300005455 | Bacteria | 6062 |
| 117 | Ga0070678_100036820 | 3300005456 | Bacteria | 3429 |
| 118 | Ga0070678_100059787 | 3300005456 | Unclassified | 2802 |
| 119 | Ga0070678_100161737 | 3300005456 | Bacteria | 1815 |
| 120 | Ga0070662_100016502 | 3300005457 | Bacteria | 4960 |
| 121 | Ga0070662_100018289 | 3300005457 | Bacteria | 4739 |
| 122 | Ga0070681_10092205 | 3300005458 | Unclassified | 2978 |
| 123 | Ga0068867_100000042 | 3300005459 | Bacteria | 77140 |
| 124 | Ga0068867_100009240 | 3300005459 | Bacteria | 6956 |
| 125 | Ga0068867_100048820 | 3300005459 | Bacteria | 3115 |
| 126 | Ga0068867_100766957 | 3300005459 | Bacteria | 857 |
| 127 | Ga0070706_100006362 | 3300005467 | Bacteria | 11153 |
| 128 | Ga0070706_100054184 | 3300005467 | Bacteria | 3702 |
| 129 | Ga0070706_100136563 | 3300005467 | Unclassified | 2289 |
| 130 | Ga0070707_100014136 | 3300005468 | Bacteria | 7481 |
| 131 | Ga0070698_100083197 | 3300005471 | Bacteria | 3191 |
| 132 | Ga0070699_100069382 | 3300005518 | Bacteria | 3063 |
| 133 | Ga0068853_100004595 | 3300005539 | Bacteria | 10712 |
| 134 | Ga0068853_100021439 | 3300005539 | Bacteria | 5388 |
| 135 | Ga0068853_100075897 | 3300005539 | Bacteria | 2934 |
| 136 | Ga0068853_100087384 | 3300005539 | Bacteria | 2736 |
| 137 | Ga0070672_100057979 | 3300005543 | Bacteria | 3041 |
| 138 | Ga0070686_100015782 | 3300005544 | Bacteria | 4384 |
| 139 | Ga0070686_100061239 | 3300005544 | Bacteria | 2431 |
| 140 | Ga0070696_100444715 | 3300005546 | Bacteria | 1022 |
| 141 | Ga0070693_100030718 | 3300005547 | Bacteria | 2939 |
| 142 | Ga0070665_100003695 | 3300005548 | Bacteria | 16205 |
| 143 | Ga0070665_100035690 | 3300005548 | Bacteria | 5000 |
| 144 | Ga0070665_100525164 | 3300005548 | Bacteria | 1195 |
| 145 | Ga0070704_100002098 | 3300005549 | Bacteria | 11090 |
| 146 | Ga0070704_100218470 | 3300005549 | Bacteria | 1548 |
| 147 | Ga0068855_100009405 | 3300005563 | Bacteria | 11802 |
| 148 | Ga0068855_100432269 | 3300005563 | Bacteria | 1439 |
| 149 | Ga0068855_100745602 | 3300005563 | Bacteria | 1045 |
| 150 | Ga0070664_100004106 | 3300005564 | Bacteria | 11696 |
| 151 | Ga0070664_100305096 | 3300005564 | Bacteria | 1439 |
| 152 | Ga0070664_100439725 | 3300005564 | Unclassified | 1196 |
| 153 | Ga0068857_100003699 | 3300005577 | Bacteria | 12830 |
| 154 | Ga0068857_100010135 | 3300005577 | Bacteria | 8189 |
| 155 | Ga0068857_100010788 | 3300005577 | Bacteria | 7952 |
| 156 | Ga0068857_100031414 | 3300005577 | Bacteria | 4693 |
| 157 | Ga0068854_100033283 | 3300005578 | Bacteria | 3593 |
| 158 | Ga0068854_100043779 | 3300005578 | Bacteria | 3175 |
| 159 | Ga0068854_100241690 | 3300005578 | Bacteria | 1438 |
| 160 | Ga0068856_100172206 | 3300005614 | Bacteria | 2177 |
| 161 | Ga0070702_100001656 | 3300005615 | Bacteria | 9240 |
| 162 | Ga0068852_100021501 | 3300005616 | Bacteria | 5154 |
| 163 | Ga0068852_100160793 | 3300005616 | Bacteria | 2097 |
| 164 | Ga0068852_100396283 | 3300005616 | Bacteria | 1357 |
| 165 | Ga0068859_100003913 | 3300005617 | Bacteria | 15203 |
| 166 | Ga0068859_100103230 | 3300005617 | Bacteria | 2909 |
| 167 | Ga0068864_100017265 | 3300005618 | Bacteria | 6018 |
| 168 | Ga0068864_100050776 | 3300005618 | Bacteria | 3571 |
| 169 | Ga0068864_100200674 | 3300005618 | Bacteria | 1832 |
| 170 | Ga0068866_10191716 | 3300005718 | Unclassified | 1215 |
| 171 | Ga0068861_100001582 | 3300005719 | Bacteria | 14478 |
| 172 | Ga0068861_100001663 | 3300005719 | Bacteria | 14225 |
| 173 | Ga0068861_100016468 | 3300005719 | Bacteria | 5232 |
| 174 | Ga0068851_10037901 | 3300005834 | Bacteria | 2418 |
| 175 | Ga0068870_10002226 | 3300005840 | Bacteria | 8048 |
| 176 | Ga0068858_100148991 | 3300005842 | Bacteria | 2199 |
| 177 | Ga0068860_100120159 | 3300005843 | Bacteria | 2516 |
| 178 | Ga0068860_100544879 | 3300005843 | Bacteria | 1162 |
| 179 | Ga0068862_100012186 | 3300005844 | Bacteria | 7107 |
| 180 | Ga0068862_100070665 | 3300005844 | Bacteria | 3014 |
| 181 | Ga0068862_100408709 | 3300005844 | Unclassified | 1271 |
| 182 | Ga0068862_100440109 | 3300005844 | Bacteria | 1227 |
| 183 | Ga0081455_10000066 | 3300005937 | Bacteria | 115221 |
| 184 | Ga0075365_10053529 | 3300006038 | Bacteria | 2673 |
| 185 | Ga0075365_10101130 | 3300006038 | Bacteria | 1974 |
| 186 | Ga0075365_10243622 | 3300006038 | Bacteria | 1263 |
| 187 | Ga0075368_10053596 | 3300006042 | Bacteria | 1606 |
| 188 | Ga0075368_10138046 | 3300006042 | Bacteria | 1015 |
| 189 | Ga0075363_100084158 | 3300006048 | Bacteria | 1744 |
| 190 | Ga0075363_100153068 | 3300006048 | Bacteria | 1302 |
| 191 | Ga0075363_100209016 | 3300006048 | Bacteria | 1117 |
| 192 | Ga0075364_10019429 | 3300006051 | Bacteria | 4265 |
| 193 | Ga0075364_10257702 | 3300006051 | Bacteria | 1186 |
| 194 | Ga0075364_10289634 | 3300006051 | Bacteria | 1114 |
| 195 | Ga0075432_10078416 | 3300006058 | Bacteria | 1195 |
| 196 | Ga0075362_10034649 | 3300006177 | Bacteria | 2201 |
| 197 | Ga0075362_10042494 | 3300006177 | Bacteria | 2009 |
| 198 | Ga0075362_10069115 | 3300006177 | Bacteria | 1610 |
| 199 | Ga0075362_10126482 | 3300006177 | Bacteria | 1213 |
| 200 | Ga0075367_10006362 | 3300006178 | Bacteria | 5958 |
| 201 | Ga0075367_10011215 | 3300006178 | Bacteria | 4732 |
| 202 | Ga0075367_10024107 | 3300006178 | Bacteria | 3431 |
| 203 | Ga0075367_10031771 | 3300006178 | Bacteria | 3033 |
| 204 | Ga0075367_10090669 | 3300006178 | Bacteria | 1859 |
| 205 | Ga0075367_10272318 | 3300006178 | Bacteria | 1063 |
| 206 | Ga0075369_10014370 | 3300006186 | Bacteria | 3162 |
| 207 | Ga0075366_10004217 | 3300006195 | Bacteria | 7707 |
| 208 | Ga0075366_10012200 | 3300006195 | Bacteria | 4871 |
| 209 | Ga0075366_10013204 | 3300006195 | Bacteria | 4698 |
| 210 | Ga0075366_10019104 | 3300006195 | Bacteria | 3960 |
| 211 | Ga0075366_10030349 | 3300006195 | Bacteria | 3178 |
| 212 | Ga0075366_10031403 | 3300006195 | Bacteria | 3125 |
| 213 | Ga0075366_10070035 | 3300006195 | Bacteria | 2088 |
| 214 | Ga0075366_10179727 | 3300006195 | Bacteria | 1285 |
| 215 | Ga0075366_10250723 | 3300006195 | Bacteria | 1080 |
| 216 | Ga0097621_100187141 | 3300006237 | Unclassified | 1791 |
| 217 | Ga0097621_100241906 | 3300006237 | Bacteria | 1578 |
| 218 | Ga0075370_10000059 | 3300006353 | Bacteria | 32632 |
| 219 | Ga0075370_10000220 | 3300006353 | Bacteria | 20375 |
| 220 | Ga0075370_10008504 | 3300006353 | Bacteria | 5286 |
| 221 | Ga0075370_10028264 | 3300006353 | Bacteria | 3116 |
| 222 | Ga0075370_10043563 | 3300006353 | Bacteria | 2536 |
| 223 | Ga0075370_10057500 | 3300006353 | Bacteria | 2211 |
| 224 | Ga0075370_10234274 | 3300006353 | Bacteria | 1087 |
| 225 | Ga0075370_10316976 | 3300006353 | Bacteria | 929 |
| 226 | Ga0068871_100012030 | 3300006358 | Bacteria | 6369 |
| 227 | Ga0068871_100056557 | 3300006358 | Bacteria | 3189 |
| 228 | Ga0068871_100198273 | 3300006358 | Unclassified | 1732 |
| 229 | Ga0075428_100008577 | 3300006844 | Bacteria | 11337 |
| 230 | Ga0075428_100029742 | 3300006844 | Bacteria | 6042 |
| 231 | Ga0075430_100069168 | 3300006846 | Bacteria | 2962 |
| 232 | Ga0075430_100159976 | 3300006846 | Bacteria | 1875 |
| 233 | Ga0075431_100037295 | 3300006847 | Bacteria | 5009 |
| 234 | Ga0075431_100127572 | 3300006847 | Bacteria | 2625 |
| 235 | Ga0075431_100330878 | 3300006847 | Bacteria | 1534 |
| 236 | Ga0075433_10014097 | 3300006852 | Bacteria | 6518 |
| 237 | Ga0075434_100019051 | 3300006871 | Bacteria | 6634 |
| 238 | Ga0075434_100029189 | 3300006871 | Bacteria | 5424 |
| 239 | Ga0075434_100149383 | 3300006871 | Bacteria | 2357 |
| 240 | Ga0075429_100046639 | 3300006880 | Bacteria | 3770 |
| 241 | Ga0075429_100120549 | 3300006880 | Unclassified | 2293 |
| 242 | Ga0075429_100242620 | 3300006880 | Bacteria | 1578 |
| 243 | Ga0068865_100029574 | 3300006881 | Bacteria | 3637 |
| 244 | Ga0097620_100003912 | 3300006931 | Bacteria | 15203 |
| 245 | Ga0097620_100103227 | 3300006931 | Bacteria | 2909 |
| 246 | Ga0099826_10078446 | 3300006948 | Bacteria | 2068 |
| 247 | Ga0075435_100058900 | 3300007076 | Bacteria | 3112 |
| 248 | Ga0075435_100779332 | 3300007076 | Bacteria | 832 |
| 249 | Ga0099795_10000252 | 3300007788 | Bacteria | 9530 |
| 250 | Ga0105244_10004022 | 3300009036 | Bacteria | 10269 |
| 251 | Ga0105240_10007179 | 3300009093 | Bacteria | 16222 |
| 252 | Ga0105240_10205219 | 3300009093 | Unclassified | 2307 |
| 253 | Ga0105240_10449574 | 3300009093 | Bacteria | 1442 |
| 254 | Ga0111539_10004096 | 3300009094 | Bacteria | 19126 |
| 255 | Ga0111539_10005321 | 3300009094 | Bacteria | 16657 |
| 256 | Ga0111539_10024487 | 3300009094 | Bacteria | 7403 |
| 257 | Ga0111539_10090659 | 3300009094 | Bacteria | 3592 |
| 258 | Ga0111539_10102418 | 3300009094 | Bacteria | 3360 |
| 259 | Ga0111539_10195776 | 3300009094 | Unclassified | 2357 |
| 260 | Ga0111539_10582489 | 3300009094 | Bacteria | 1303 |
| 261 | Ga0105245_10040873 | 3300009098 | Bacteria | 4132 |
| 262 | Ga0105247_10080016 | 3300009101 | Bacteria | 2057 |
| 263 | Ga0114129_10031517 | 3300009147 | Bacteria | 7493 |
| 264 | Ga0114129_10183832 | 3300009147 | Bacteria | 2843 |
| 265 | Ga0105243_10002909 | 3300009148 | Bacteria | 14178 |
| 266 | Ga0105243_10003902 | 3300009148 | Bacteria | 11904 |
| 267 | Ga0105243_10043728 | 3300009148 | Bacteria | 3511 |
| 268 | Ga0105243_10213304 | 3300009148 | Bacteria | 1701 |
| 269 | Ga0105243_10439307 | 3300009148 | Bacteria | 1221 |
| 270 | Ga0105243_10752693 | 3300009148 | Bacteria | 955 |
| 271 | Ga0105248_11280631 | 3300009177 | Unclassified | 829 |
| 272 | Ga0105237_10013241 | 3300009545 | Bacteria | 8654 |
| 273 | Ga0105237_10016231 | 3300009545 | Bacteria | 7744 |
| 274 | Ga0105237_10320957 | 3300009545 | Bacteria | 1552 |
| 275 | Ga0105238_10103384 | 3300009551 | Bacteria | 2830 |
| 276 | Ga0105238_10204784 | 3300009551 | Bacteria | 1949 |
| 277 | Ga0105238_10255685 | 3300009551 | Bacteria | 1731 |
| 278 | Ga0105249_10000719 | 3300009553 | Bacteria | 30139 |
| 279 | Ga0105249_10017219 | 3300009553 | Bacteria | 6416 |
| 280 | Ga0099796_10000338 | 3300010159 | Bacteria | 7589 |
| 281 | Ga0105239_10000328 | 3300010375 | Bacteria | 70165 |
| 282 | Ga0105239_10014343 | 3300010375 | Bacteria | 8792 |
| 283 | Ga0105239_10067146 | 3300010375 | Bacteria | 3939 |
| 284 | Ga0105239_10095285 | 3300010375 | Bacteria | 3288 |
| 285 | Ga0105246_10068482 | 3300011119 | Bacteria | 2490 |
| 286 | Ga0157373_10069518 | 3300013100 | Bacteria | 2489 |
| 287 | Ga0157371_10033042 | 3300013102 | Bacteria | 3720 |
| 288 | Ga0157370_10264616 | 3300013104 | Bacteria | 1589 |
| 289 | Ga0157370_10563101 | 3300013104 | Bacteria | 1044 |
| 290 | Ga0157369_10006986 | 3300013105 | Bacteria | 13022 |
| 291 | Ga0157369_10046134 | 3300013105 | Bacteria | 4737 |
| 292 | Ga0157369_10095033 | 3300013105 | Bacteria | 3181 |
| 293 | Ga0157374_10476220 | 3300013296 | Bacteria | 1251 |
| 294 | Ga0157378_10714149 | 3300013297 | Bacteria | 1023 |
| 295 | Ga0157372_10085056 | 3300013307 | Bacteria | 3587 |
| 296 | Ga0157372_10141315 | 3300013307 | Bacteria | 2774 |
| 297 | Ga0157372_11251759 | 3300013307 | Bacteria | 857 |
| 298 | Ga0157375_10001087 | 3300013308 | Bacteria | 23575 |
| 299 | Ga0157380_10013927 | 3300014326 | Bacteria | 5873 |
| 300 | Ga0157380_10017083 | 3300014326 | Bacteria | 5364 |
| 301 | Ga0157380_10051650 | 3300014326 | Unclassified | 3252 |
| 302 | Ga0157380_10097494 | 3300014326 | Bacteria | 2440 |
| 303 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 304 | Ga0157377_10013920 | 3300014745 | Bacteria | 4082 |
| 305 | Ga0157376_10024319 | 3300014969 | Bacteria | 4753 |
| 306 | Ga0157376_10129325 | 3300014969 | Bacteria | 2251 |
| 307 | Ga0182006_1001206 | 3300015261 | Bacteria | 16155 |
| 308 | Ga0182007_10001393 | 3300015262 | Bacteria | 13006 |
| 309 | Ga0163161_10100239 | 3300017792 | Bacteria | 2155 |
| 310 | Ga0163161_10755358 | 3300017792 | Unclassified | 814 |
| 311 | Ga0209435_100014 | 3300025206 | Bacteria | 322129 |
| 312 | Ga0209436_103101 | 3300025208 | Bacteria | 4578 |
| 313 | Ga0209436_103113 | 3300025208 | Bacteria | 4561 |
| 314 | Ga0209436_107346 | 3300025208 | Bacteria | 2310 |
| 315 | Ga0209672_100539 | 3300025228 | Bacteria | 20575 |
| 316 | Ga0209258_100147 | 3300025242 | Bacteria | 162823 |
| 317 | Ga0207425_1000518 | 3300025245 | Bacteria | 23516 |
| 318 | Ga0207425_1001598 | 3300025245 | Bacteria | 9177 |
| 319 | Ga0207425_1007663 | 3300025245 | Bacteria | 2827 |
| 320 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 321 | Ga0209026_1000073 | 3300025250 | Bacteria | 205399 |
| 322 | Ga0209148_1000122 | 3300025254 | Bacteria | 186071 |
| 323 | Ga0209759_1000013 | 3300025256 | Bacteria | 399300 |
| 324 | Ga0209129_1000601 | 3300025258 | Bacteria | 24463 |
| 325 | Ga0209129_1003026 | 3300025258 | Bacteria | 7634 |
| 326 | Ga0209129_1004064 | 3300025258 | Bacteria | 5964 |
| 327 | Ga0209565_1000248 | 3300025263 | Bacteria | 57592 |
| 328 | Ga0209565_1000462 | 3300025263 | Bacteria | 30996 |
| 329 | Ga0209565_1001796 | 3300025263 | Bacteria | 8652 |
| 330 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 331 | Ga0209673_1000377 | 3300025273 | Bacteria | 80360 |
| 332 | Ga0209673_1000681 | 3300025273 | Bacteria | 48925 |
| 333 | Ga0209673_1013907 | 3300025273 | Bacteria | 3147 |
| 334 | Ga0209673_1028266 | 3300025273 | Bacteria | 1809 |
| 335 | Ga0209130_1000216 | 3300025284 | Bacteria | 75536 |
| 336 | Ga0209130_1000218 | 3300025284 | Bacteria | 75339 |
| 337 | Ga0209130_1000269 | 3300025284 | Bacteria | 65107 |
| 338 | Ga0209130_1000614 | 3300025284 | Bacteria | 34072 |
| 339 | Ga0209130_1002698 | 3300025284 | Bacteria | 8454 |
| 340 | Ga0209675_1000136 | 3300025291 | Bacteria | 99301 |
| 341 | Ga0209675_1000673 | 3300025291 | Bacteria | 23959 |
| 342 | Ga0209675_1001146 | 3300025291 | Bacteria | 16153 |
| 343 | Ga0209675_1002838 | 3300025291 | Bacteria | 8619 |
| 344 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 345 | Ga0209676_1000202 | 3300025292 | Bacteria | 133078 |
| 346 | Ga0209676_1002009 | 3300025292 | Bacteria | 16042 |
| 347 | Ga0209676_1008703 | 3300025292 | Bacteria | 4482 |
| 348 | Ga0209025_1000285 | 3300025294 | Bacteria | 114575 |
| 349 | Ga0209025_1001205 | 3300025294 | Bacteria | 36303 |
| 350 | Ga0209025_1003664 | 3300025294 | Bacteria | 14218 |
| 351 | Ga0209025_1006058 | 3300025294 | Bacteria | 9563 |
| 352 | Ga0209025_1008848 | 3300025294 | Bacteria | 7143 |
| 353 | Ga0209025_1011994 | 3300025294 | Bacteria | 5619 |
| 354 | Ga0209025_1046211 | 3300025294 | Bacteria | 1794 |
| 355 | Ga0209564_1000223 | 3300025295 | Bacteria | 128117 |
| 356 | Ga0209564_1000226 | 3300025295 | Bacteria | 125693 |
| 357 | Ga0209564_1000443 | 3300025295 | Bacteria | 71364 |
| 358 | Ga0209564_1002033 | 3300025295 | Bacteria | 17545 |
| 359 | Ga0209564_1004696 | 3300025295 | Bacteria | 8192 |
| 360 | Ga0209758_1000142 | 3300025297 | Bacteria | 171779 |
| 361 | Ga0209758_1005313 | 3300025297 | Bacteria | 10045 |
| 362 | Ga0209758_1009291 | 3300025297 | Bacteria | 6141 |
| 363 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 364 | Ga0209050_1000224 | 3300025298 | Bacteria | 125433 |
| 365 | Ga0209050_1002324 | 3300025298 | Bacteria | 16727 |
| 366 | Ga0209050_1004327 | 3300025298 | Bacteria | 9688 |
| 367 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 368 | Ga0209256_1000114 | 3300025299 | Bacteria | 173999 |
| 369 | Ga0209256_1000174 | 3300025299 | Bacteria | 128117 |
| 370 | Ga0207426_1000117 | 3300025302 | Bacteria | 224652 |
| 371 | Ga0207426_1000162 | 3300025302 | Bacteria | 172643 |
| 372 | Ga0207426_1000232 | 3300025302 | Bacteria | 128117 |
| 373 | Ga0207426_1001659 | 3300025302 | Bacteria | 17304 |
| 374 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 375 | Ga0209051_1000112 | 3300025303 | Bacteria | 152667 |
| 376 | Ga0209051_1000497 | 3300025303 | Bacteria | 50521 |
| 377 | Ga0209051_1000972 | 3300025303 | Bacteria | 27946 |
| 378 | Ga0209051_1005424 | 3300025303 | Bacteria | 7461 |
| 379 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 380 | Ga0209257_1000144 | 3300025304 | Bacteria | 197078 |
| 381 | Ga0209257_1000163 | 3300025304 | Bacteria | 175355 |
| 382 | Ga0209257_1000290 | 3300025304 | Bacteria | 110826 |
| 383 | Ga0209257_1003943 | 3300025304 | Bacteria | 12048 |
| 384 | Ga0209257_1005848 | 3300025304 | Bacteria | 8335 |
| 385 | Ga0207697_10042161 | 3300025315 | Unclassified | 1874 |
| 386 | Ga0207656_10026641 | 3300025321 | Bacteria | 2359 |
| 387 | Ga0207642_10272558 | 3300025899 | Unclassified | 970 |
| 388 | Ga0207688_10176626 | 3300025901 | Unclassified | 1272 |
| 389 | Ga0207688_10231300 | 3300025901 | Bacteria | 1116 |
| 390 | Ga0207647_10111140 | 3300025904 | Bacteria | 1620 |
| 391 | Ga0207645_10041034 | 3300025907 | Bacteria | 2963 |
| 392 | Ga0207684_10041981 | 3300025910 | Bacteria | 3877 |
| 393 | Ga0207684_10129711 | 3300025910 | Bacteria | 2164 |
| 394 | Ga0207684_10285769 | 3300025910 | Bacteria | 1422 |
| 395 | Ga0207707_10027781 | 3300025912 | Bacteria | 4947 |
| 396 | Ga0207695_10015535 | 3300025913 | Bacteria | 8955 |
| 397 | Ga0207695_10157766 | 3300025913 | Bacteria | 2203 |
| 398 | Ga0207695_10634927 | 3300025913 | Bacteria | 949 |
| 399 | Ga0207671_10009035 | 3300025914 | Bacteria | 8383 |
| 400 | Ga0207652_10119385 | 3300025921 | Unclassified | 2345 |
| 401 | Ga0207681_10015517 | 3300025923 | Bacteria | 4752 |
| 402 | Ga0207694_10060771 | 3300025924 | Bacteria | 2941 |
| 403 | Ga0207694_10288135 | 3300025924 | Bacteria | 1350 |
| 404 | Ga0207659_10558599 | 3300025926 | Bacteria | 973 |
| 405 | Ga0207706_10010502 | 3300025933 | Bacteria | 8463 |
| 406 | Ga0207706_10035248 | 3300025933 | Bacteria | 4449 |
| 407 | Ga0207709_10003119 | 3300025935 | Bacteria | 9969 |
| 408 | Ga0207709_10007578 | 3300025935 | Bacteria | 6030 |
| 409 | Ga0207709_10025141 | 3300025935 | Bacteria | 3407 |
| 410 | Ga0207709_10033920 | 3300025935 | Bacteria | 3003 |
| 411 | Ga0207670_10001881 | 3300025936 | Bacteria | 10967 |
| 412 | Ga0207670_10166726 | 3300025936 | Bacteria | 1648 |
| 413 | Ga0207669_10521660 | 3300025937 | Unclassified | 954 |
| 414 | Ga0207704_10114209 | 3300025938 | Bacteria | 1833 |
| 415 | Ga0207691_10021260 | 3300025940 | Bacteria | 6129 |
| 416 | Ga0207691_10039139 | 3300025940 | Bacteria | 4387 |
| 417 | Ga0207689_10110651 | 3300025942 | Bacteria | 2257 |
| 418 | Ga0207661_10032621 | 3300025944 | Bacteria | 4037 |
| 419 | Ga0207679_10224793 | 3300025945 | Bacteria | 1581 |
| 420 | Ga0207679_10326337 | 3300025945 | Unclassified | 1331 |
| 421 | Ga0207667_10025177 | 3300025949 | Bacteria | 6520 |
| 422 | Ga0207667_10030151 | 3300025949 | Bacteria | 5870 |
| 423 | Ga0207667_10072804 | 3300025949 | Bacteria | 3571 |
| 424 | Ga0207651_10062152 | 3300025960 | Bacteria | 2601 |
| 425 | Ga0207651_10151872 | 3300025960 | Unclassified | 1804 |
| 426 | Ga0207651_10295395 | 3300025960 | Unclassified | 1345 |
| 427 | Ga0207712_10150562 | 3300025961 | Bacteria | 1797 |
| 428 | Ga0207668_10116877 | 3300025972 | Bacteria | 2012 |
| 429 | Ga0207640_10060057 | 3300025981 | Bacteria | 2511 |
| 430 | Ga0207640_10210971 | 3300025981 | Unclassified | 1479 |
| 431 | Ga0207658_10345273 | 3300025986 | Bacteria | 1295 |
| 432 | Ga0207658_10432214 | 3300025986 | Bacteria | 1163 |
| 433 | Ga0207677_10069488 | 3300026023 | Bacteria | 2477 |
| 434 | Ga0207703_10287408 | 3300026035 | Bacteria | 1496 |
| 435 | Ga0207639_10009374 | 3300026041 | Bacteria | 6750 |
| 436 | Ga0207639_10242487 | 3300026041 | Bacteria | 1568 |
| 437 | Ga0207639_10436471 | 3300026041 | Bacteria | 1186 |
| 438 | Ga0207678_10019228 | 3300026067 | Bacteria | 5999 |
| 439 | Ga0207708_10079713 | 3300026075 | Bacteria | 2515 |
| 440 | Ga0207708_10542762 | 3300026075 | Bacteria | 979 |
| 441 | Ga0207702_10149432 | 3300026078 | Bacteria | 2124 |
| 442 | Ga0207641_10209908 | 3300026088 | Bacteria | 1800 |
| 443 | Ga0207641_10461748 | 3300026088 | Bacteria | 1229 |
| 444 | Ga0207648_10000118 | 3300026089 | Bacteria | 77144 |
| 445 | Ga0207648_10025275 | 3300026089 | Bacteria | 5292 |
| 446 | Ga0207648_10338590 | 3300026089 | Bacteria | 1354 |
| 447 | Ga0207648_10740892 | 3300026089 | Bacteria | 912 |
| 448 | Ga0207676_10030832 | 3300026095 | Bacteria | 4028 |
| 449 | Ga0207676_10111168 | 3300026095 | Bacteria | 2293 |
| 450 | Ga0207674_10004373 | 3300026116 | Bacteria | 17040 |
| 451 | Ga0207674_10191311 | 3300026116 | Bacteria | 1996 |
| 452 | Ga0207674_10540593 | 3300026116 | Bacteria | 1126 |
| 453 | Ga0207675_100001909 | 3300026118 | Bacteria | 20795 |
| 454 | Ga0207675_100003206 | 3300026118 | Bacteria | 16048 |
| 455 | Ga0207675_100118645 | 3300026118 | Unclassified | 2502 |
| 456 | Ga0207675_100323945 | 3300026118 | Bacteria | 1505 |
| 457 | Ga0207683_10031188 | 3300026121 | Bacteria | 4626 |
| 458 | Ga0207683_10098527 | 3300026121 | Unclassified | 2608 |
| 459 | Ga0207683_10183076 | 3300026121 | Bacteria | 1900 |
| 460 | Ga0207698_10014731 | 3300026142 | Bacteria | 5209 |
| 461 | Ga0209813_10038861 | 3300027866 | Bacteria | 1440 |
| 462 | Ga0209813_10046244 | 3300027866 | Bacteria | 1344 |
| 463 | Ga0209974_10004756 | 3300027876 | Bacteria | 4820 |
| 464 | Ga0207428_10001170 | 3300027907 | Bacteria | 28244 |
| 465 | Ga0207428_10006671 | 3300027907 | Bacteria | 10599 |
| 466 | Ga0207428_10174792 | 3300027907 | Bacteria | 1625 |
| 467 | Ga0207428_10201953 | 3300027907 | Bacteria | 1495 |
| 468 | Ga0265356_1000850 | 3300028017 | Bacteria | 5023 |
| 469 | Ga0268266_10005779 | 3300028379 | Bacteria | 11456 |
| 470 | Ga0268266_10040624 | 3300028379 | Bacteria | 3965 |
| 471 | Ga0268265_10000211 | 3300028380 | Bacteria | 68076 |
| 472 | Ga0268265_10019102 | 3300028380 | Bacteria | 4757 |
| 473 | Ga0268265_10129149 | 3300028380 | Bacteria | 2097 |
| 474 | Ga0268265_10436908 | 3300028380 | Bacteria | 1219 |
| 475 | Ga0268264_10053673 | 3300028381 | Bacteria | 3363 |
| 476 | Ga0268264_10270193 | 3300028381 | Bacteria | 1588 |
| 477 | Ga0307517_10012260 | 3300028786 | Bacteria | 11787 |
| 478 | Ga0307517_10115800 | 3300028786 | Bacteria | 2010 |
| 479 | Ga0307517_10340346 | 3300028786 | Unclassified | 820 |
| 480 | Ga0307515_10002735 | 3300028794 | Bacteria | 37724 |
| 481 | Ga0307515_10004327 | 3300028794 | Bacteria | 29456 |
| 482 | Ga0307515_10009775 | 3300028794 | Bacteria | 18483 |
| 483 | Ga0307515_10020040 | 3300028794 | Bacteria | 11971 |
| 484 | Ga0307515_10025281 | 3300028794 | Bacteria | 10285 |
| 485 | Ga0307515_10135482 | 3300028794 | Bacteria | 2681 |
| 486 | Ga0307515_10136765 | 3300028794 | Bacteria | 2658 |
| 487 | Ga0307515_10208838 | 3300028794 | Unclassified | 1803 |
| 488 | Ga0307512_10016074 | 3300030522 | Bacteria | 6916 |
| 489 | Ga0316177_1035019 | 3300030731 | Bacteria | 1718 |
| 490 | Ga0316183_1052862 | 3300030742 | Bacteria | 1580 |
| 491 | Ga0265762_1023378 | 3300030760 | Unclassified | 1145 |
| 492 | Ga0307513_10003908 | 3300031456 | Bacteria | 20030 |
| 493 | Ga0307513_10044731 | 3300031456 | Bacteria | 4847 |
| 494 | Ga0307513_10199121 | 3300031456 | Bacteria | 1846 |
| 495 | Ga0307513_10223745 | 3300031456 | Bacteria | 1700 |
| 496 | Ga0307509_10053248 | 3300031507 | Bacteria | 4316 |
| 497 | Ga0307509_10129081 | 3300031507 | Bacteria | 2487 |
| 498 | Ga0307509_10191987 | 3300031507 | Bacteria | 1892 |
| 499 | Ga0307408_100178609 | 3300031548 | Bacteria | 1701 |
| 500 | Ga0307408_100185844 | 3300031548 | Bacteria | 1670 |
| 501 | Ga0307408_100699876 | 3300031548 | Bacteria | 911 |
| 502 | Ga0307508_10000050 | 3300031616 | Bacteria | 135222 |
| 503 | Ga0307508_10001066 | 3300031616 | Bacteria | 31732 |
| 504 | Ga0307508_10003935 | 3300031616 | Bacteria | 14738 |
| 505 | Ga0307514_10045004 | 3300031649 | Bacteria | 3455 |
| 506 | Ga0307516_10195279 | 3300031730 | Bacteria | 1747 |
| 507 | Ga0307516_10232181 | 3300031730 | Bacteria | 1548 |
| 508 | Ga0307413_10051656 | 3300031824 | Bacteria | 2478 |
| 509 | Ga0307413_10127522 | 3300031824 | Bacteria | 1735 |
| 510 | Ga0307412_10203925 | 3300031911 | Bacteria | 1504 |
| 511 | Ga0307412_10301105 | 3300031911 | Bacteria | 1267 |
| 512 | Ga0307412_10368520 | 3300031911 | Bacteria | 1159 |
| 513 | Ga0307409_100293450 | 3300031995 | Bacteria | 1509 |
| 514 | Ga0307416_100134249 | 3300032002 | Bacteria | 2235 |
| 515 | Ga0307416_100351469 | 3300032002 | Bacteria | 1492 |
| 516 | Ga0307416_100674491 | 3300032002 | Bacteria | 1121 |
| 517 | Ga0307414_10205839 | 3300032004 | Bacteria | 1604 |
| 518 | Ga0307415_100036188 | 3300032126 | Bacteria | 3233 |
| 519 | Ga0307507_10027456 | 3300033179 | Bacteria | 6101 |
| 520 | Ga0373939_0179735 | 3300035114 | Bacteria | 788 |
| 521 | Ga0373941_0149261 | 3300035115 | Bacteria | 856 |
| 522 | Ga0373960_0122837 | 3300035121 | Bacteria | 863 |
| 523 | Ga0373961_0012887 | 3300035241 | Bacteria | 2100 |
| 524 | Ga0373931_0019924 | 3300035691 | Bacteria | 3352 |
| 525 | Ga0395905_0008608 | 3300037471 | Bacteria | 10052 |
| 526 | Ga0395905_0071099 | 3300037471 | Bacteria | 3262 |
| 527 | Ga0395905_0175917 | 3300037471 | Bacteria | 2009 |
| 528 | Ga0395905_0201748 | 3300037471 | Bacteria | 1864 |
| 529 | Ga0395901_0170162 | 3300038443 | Bacteria | 2286 |
| 530 | Ga0451797_0498566 | 3300041453 | Bacteria | 1587 |
| 531 | Ga0451853_0558546 | 3300041512 | Bacteria | 1410 |
| 532 | Ga0439443_011547 | 3300042003 | Bacteria | 1295 |
| 533 | Ga0450893_0004169 | 3300042532 | Bacteria | 2299 |
| 534 | Ga0466969_0010615 | 3300044656 | Bacteria | 4881 |
| 535 | Ga0466969_0028029 | 3300044656 | Bacteria | 2880 |
| 536 | Ga0466965_0009551 | 3300044683 | Bacteria | 4509 |
| 537 | Ga0466966_0001704 | 3300044684 | Bacteria | 14203 |
| 538 | Ga0466966_0009537 | 3300044684 | Bacteria | 6425 |
| 539 | Ga0466961_0002399 | 3300044693 | Bacteria | 11641 |
| 540 | Ga0466963_0017043 | 3300044694 | Bacteria | 4524 |
| 541 | Ga0466964_0001234 | 3300044706 | Bacteria | 8677 |
| 542 | Ga0466970_0032716 | 3300044765 | Bacteria | 2747 |
| 543 | Ga0466970_0104719 | 3300044765 | Bacteria | 1542 |
| 544 | Ga0466957_0040794 | 3300044842 | Bacteria | 2804 |
| 545 | Ga0466960_0010312 | 3300044901 | Bacteria | 3878 |
| 546 | Ga0466959_0000156 | 3300045049 | Bacteria | 44750 |
| 547 | Ga0466959_0118021 | 3300045049 | Bacteria | 1888 |
| 548 | Ga0451576_0024633 | 3300045051 | Bacteria | 6498 |
| 549 | Ga0451576_0121103 | 3300045051 | Bacteria | 2724 |
| 550 | Ga0451576_0750886 | 3300045051 | Bacteria | 1025 |
| 551 | Ga0466967_0001757 | 3300045976 | Bacteria | 12950 |
| 552 | Ga0495638_0004001 | 3300046460 | Bacteria | 11319 |
| 553 | Ga0495638_0018848 | 3300046460 | Bacteria | 4576 |
| 554 | Ga0495610_0048720 | 3300046512 | Bacteria | 2079 |
| 555 | Ga0495610_0050346 | 3300046512 | Bacteria | 2034 |
| 556 | Ga0495616_0000903 | 3300046513 | Bacteria | 21412 |
| 557 | Ga0495620_0059966 | 3300046515 | Bacteria | 1588 |
| 558 | Ga0495620_0071235 | 3300046515 | Bacteria | 1422 |
| 559 | Ga0495631_0000405 | 3300046518 | Bacteria | 29764 |
| 560 | Ga0495632_0018997 | 3300046519 | Bacteria | 3753 |
| 561 | Ga0495632_0095570 | 3300046519 | Bacteria | 1404 |
| 562 | Ga0495637_0006352 | 3300046520 | Bacteria | 5940 |
| 563 | Ga0495643_0014410 | 3300046522 | Bacteria | 4704 |
| 564 | Ga0495643_0082312 | 3300046522 | Bacteria | 1673 |
| 565 | Ga0495654_0002419 | 3300046530 | Bacteria | 12027 |
| 566 | Ga0495621_0000849 | 3300046539 | Bacteria | 7787 |
| 567 | Ga0495621_0007576 | 3300046539 | Bacteria | 3221 |
| 568 | Ga0495597_0009643 | 3300046542 | Bacteria | 4760 |
| 569 | Ga0495656_0198836 | 3300046615 | Bacteria | 994 |
| 570 | Ga0495625_0003005 | 3300046660 | Bacteria | 17395 |
| 571 | Ga0495625_0025776 | 3300046660 | Unclassified | 4452 |
| 572 | Ga0495625_0031201 | 3300046660 | Bacteria | 3966 |
| 573 | Ga0495625_0403263 | 3300046660 | Bacteria | 854 |
| 574 | Ga0495658_0059128 | 3300046683 | Bacteria | 2194 |
| 575 | Ga0495669_0152867 | 3300046684 | Unclassified | 1093 |
| 576 | Ga0495649_0015636 | 3300046694 | Bacteria | 4314 |
| 577 | Ga0495660_0033942 | 3300046810 | Bacteria | 2858 |
| 578 | Ga0495676_0131003 | 3300047321 | Bacteria | 1810 |
| 579 | Ga0495687_000367 | 3300047443 | Bacteria | 56387 |
| 580 | Ga0495593_0026567 | 3300047673 | Bacteria | 3195 |
| 581 | Ga0495614_0061535 | 3300048089 | Bacteria | 1613 |
| 582 | Ga0495626_0037802 | 3300048091 | Bacteria | 2292 |
| 583 | Ga0496102_0010655 | 3300048905 | Bacteria | 7919 |
| 584 | Ga0496105_0508115 | 3300048908 | Bacteria | 945 |
| 585 | Ga0496106_0686821 | 3300048909 | Bacteria | 816 |
| 586 | Ga0496108_0095002 | 3300048911 | Bacteria | 2538 |
| 587 | Ga0496109_0040768 | 3300048912 | Bacteria | 4206 |
| 588 | Ga0496110_0005495 | 3300048913 | Bacteria | 9942 |
| 589 | Ga0496110_0364409 | 3300048913 | Bacteria | 1317 |
| 590 | Ga0496116_0006960 | 3300048919 | Bacteria | 10135 |
| 591 | Ga0496117_0023345 | 3300048920 | Bacteria | 4932 |
| 592 | Ga0496118_0006317 | 3300048921 | Bacteria | 13093 |
| 593 | Ga0496119_0040656 | 3300048922 | Bacteria | 2971 |
| 594 | Ga0496121_0062431 | 3300048924 | Unclassified | 3052 |
| 595 | Ga0496121_0062648 | 3300048924 | Bacteria | 3044 |
| 596 | Ga0496122_0260567 | 3300048925 | Bacteria | 962 |
| 597 | Ga0496123_0068013 | 3300048926 | Bacteria | 2246 |
| 598 | Ga0496124_0009873 | 3300048927 | Bacteria | 9762 |
| 599 | Ga0496124_0161996 | 3300048927 | Bacteria | 1742 |
| 600 | Ga0496124_0350974 | 3300048927 | Bacteria | 1043 |
| 601 | Ga0496125_0005801 | 3300048928 | Bacteria | 13563 |
| 602 | Ga0496125_0067138 | 3300048928 | Bacteria | 2828 |
| 603 | Ga0501034_0238524 | 3300049571 | Bacteria | 1765 |
| 604 | Ga0501042_0374636 | 3300049578 | Unclassified | 1030 |
| 605 | Ga0501069_0081778 | 3300049585 | Bacteria | 1820 |
| 606 | Ga0501083_0381891 | 3300049744 | Bacteria | 916 |
| 607 | nmdc:mga03683_13290_c1 | 3300050489 | Bacteria | 3026 |
| 608 | nmdc:mga03683_42303_c1 | 3300050489 | Bacteria | 1874 |
| 609 | nmdc:mga03683_67770_c1 | 3300050489 | Bacteria | 1520 |
| 610 | nmdc:mga03n38_114388_c1 | 3300050490 | Bacteria | 1318 |
| 611 | nmdc:mga03n38_116052_c1 | 3300050490 | Bacteria | 1310 |
| 612 | nmdc:mga03n38_134106_c1 | 3300050490 | Bacteria | 1230 |
| 613 | nmdc:mga03n38_60058_c1 | 3300050490 | Bacteria | 1727 |
| 614 | nmdc:mga00v17_15333_c1 | 3300050491 | Bacteria | 4301 |
| 615 | nmdc:mga00v17_1626_c1 | 3300050491 | Bacteria | 11752 |
| 616 | nmdc:mga0yw44_13994_c1 | 3300050492 | Bacteria | 4243 |
| 617 | nmdc:mga0k408_11238_c1 | 3300050493 | Bacteria | 4867 |
| 618 | nmdc:mga0k408_2439_c2 | 3300050493 | Bacteria | 6617 |
| 619 | nmdc:mga0k408_275487_c1 | 3300050493 | Bacteria | 1004 |
| 620 | nmdc:mga0k408_28428_c1 | 3300050493 | Bacteria | 3179 |
| 621 | nmdc:mga0k408_30313_c2 | 3300050493 | Bacteria | 2256 |
| 622 | nmdc:mga0k408_313557_c1 | 3300050493 | Unclassified | 936 |
| 623 | nmdc:mga0k408_464040_c1 | 3300050493 | Bacteria | 751 |
| 624 | nmdc:mga06z11_219155_c1 | 3300050494 | Bacteria | 1111 |
| 625 | nmdc:mga06z11_74118_c1 | 3300050494 | Bacteria | 1809 |
| 626 | nmdc:mga04h51_139875_c1 | 3300050495 | Bacteria | 917 |
| 627 | nmdc:mga04h51_38788_c1 | 3300050495 | Unclassified | 1544 |
| 628 | nmdc:mga04h51_76280_c1 | 3300050495 | Bacteria | 1181 |
| 629 | nmdc:mga07m45_2073_c1 | 3300050496 | Bacteria | 9307 |
| 630 | nmdc:mga07m45_2098_c1 | 3300050496 | Bacteria | 9263 |
| 631 | nmdc:mga07m45_210_c1 | 3300050496 | Bacteria | 23070 |
| 632 | nmdc:mga07m45_32993_c1 | 3300050496 | Bacteria | 2874 |
| 633 | nmdc:mga07m45_46242_c1 | 3300050496 | Bacteria | 2445 |
| 634 | nmdc:mga07m45_63975_c1 | 3300050496 | Bacteria | 2087 |
| 635 | nmdc:mga07m45_95836_c1 | 3300050496 | Bacteria | 1702 |
| 636 | nmdc:mga07m45_99617_c1 | 3300050496 | Bacteria | 1669 |
| 637 | nmdc:mga05p37_124482_c1 | 3300050507 | Bacteria | 3166 |
| 638 | nmdc:mga09592_280536_c1 | 3300050508 | Unclassified | 1445 |
| 639 | nmdc:mga09592_6498_c1 | 3300050508 | Bacteria | 9523 |
| 640 | nmdc:mga0qj67_78225_c1 | 3300050509 | Bacteria | 2647 |
| 641 | nmdc:mga06r32_150619_c1 | 3300050510 | Unclassified | 2304 |
| 642 | nmdc:mga06r32_344796_c1 | 3300050510 | Bacteria | 1474 |
| 643 | nmdc:mga06r32_50162_c2 | 3300050510 | Bacteria | 2633 |
| 644 | nmdc:mga08y16_10534_c1 | 3300050511 | Bacteria | 9704 |
| 645 | nmdc:mga08y16_12596_c1 | 3300050511 | Bacteria | 8896 |
| 646 | nmdc:mga08y16_215271_c1 | 3300050511 | Bacteria | 1989 |
| 647 | nmdc:mga08y16_224500_c1 | 3300050511 | Unclassified | 1944 |
| 648 | nmdc:mga08y16_251151_c1 | 3300050511 | Unclassified | 1828 |
| 649 | nmdc:mga08y16_3599_c1 | 3300050511 | Bacteria | 16089 |
| 650 | nmdc:mga0n895_63233_c1 | 3300050512 | Unclassified | 3659 |
| 651 | nmdc:mga0n895_97541_c1 | 3300050512 | Bacteria | 2945 |
| 652 | nmdc:mga0rr50_84822_c1 | 3300050513 | Unclassified | 2453 |
| 653 | nmdc:mga0a205_5674_c1 | 3300050515 | Bacteria | 11245 |
| 654 | nmdc:mga0a205_9437_c1 | 3300050515 | Bacteria | 8919 |
| 655 | Ga0500610_0040772 | 3300053079 | Bacteria | 2400 |
| 656 | Ga0500578_0089688 | 3300053086 | Bacteria | 1952 |
| 657 | Ga0500644_0001224 | 3300053088 | Bacteria | 7134 |
| 658 | Ga0500583_0004231 | 3300053092 | Bacteria | 4646 |
| 659 | Ga0500651_0000217 | 3300053093 | Bacteria | 36081 |
| 660 | Ga0500651_0173020 | 3300053093 | Bacteria | 1286 |
| 661 | Ga0500566_0084204 | 3300053094 | Bacteria | 1765 |
| 662 | Ga0500562_044030 | 3300053108 | Bacteria | 1188 |
| 663 | Ga0500571_002139 | 3300053110 | Bacteria | 9692 |
| 664 | Ga0500593_000770 | 3300053117 | Bacteria | 12006 |
| 665 | Ga0500594_0003486 | 3300053118 | Bacteria | 3460 |
| 666 | Ga0500608_005510 | 3300053122 | Bacteria | 5041 |
| 667 | Ga0500626_002518 | 3300053128 | Bacteria | 6354 |
| 668 | Ga0500628_003253 | 3300053129 | Bacteria | 2675 |
| 669 | Ga0500642_0081137 | 3300053130 | Bacteria | 1490 |
| 670 | Ga0500655_001011 | 3300053133 | Bacteria | 5426 |
| 671 | Ga0500658_0000686 | 3300053134 | Bacteria | 13986 |
| 672 | Ga0500658_0000800 | 3300053134 | Bacteria | 13026 |
| 673 | Ga0500658_0027843 | 3300053134 | Bacteria | 2189 |
| 674 | Ga0500559_0014533 | 3300053136 | Bacteria | 3327 |
| 675 | Ga0500564_016563 | 3300053138 | Bacteria | 3340 |
| 676 | Ga0500568_0004042 | 3300053139 | Bacteria | 7949 |
| 677 | Ga0500568_0027934 | 3300053139 | Bacteria | 2356 |
| 678 | Ga0500590_039194 | 3300053148 | Bacteria | 2442 |
| 679 | Ga0500616_0000030 | 3300053153 | Bacteria | 415224 |
| 680 | Ga0500616_0227635 | 3300053153 | Bacteria | 809 |
| 681 | Ga0500619_000179 | 3300053154 | Bacteria | 15172 |
| 682 | Ga0500638_036650 | 3300053162 | Bacteria | 2378 |
| 683 | Ga0500587_000509 | 3300053739 | Bacteria | 4702 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006177 | Ga0075362_10069115 | Ga0075362_100691152 | 182 |
| 2 | 3300050489 | nmdc:mga03683_13290_c1 | nmdc:mga03683_13290_c1_1032_1766 | 182 |
| 3 | 3300042532 | Ga0450893_0004169 | Ga0450893_0004169_583_1317 | 197 |
| 4 | 3300048909 | Ga0496106_0686821 | Ga0496106_0686821_167_769 | 199 |
| 5 | 3300009094 | Ga0111539_10005321 | Ga0111539_1000532110 | 200 |
| 6 | 3300009553 | Ga0105249_10000719 | Ga0105249_1000071911 | 200 |
| 7 | 3300050511 | nmdc:mga08y16_3599_c1 | nmdc:mga08y16_3599_c1_6106_6711 | 200 |
| 8 | 3300048908 | Ga0496105_0508115 | Ga0496105_0508115_19_750 | 201 |
| 9 | 3300027876 | Ga0209974_10004756 | Ga0209974_100047562 | 203 |
| 10 | 3300037471 | Ga0395905_0175917 | Ga0395905_0175917_1101_1832 | 206 |
| 11 | 3300038443 | Ga0395901_0170162 | Ga0395901_0170162_1337_2068 | 206 |
| 12 | 3300030522 | Ga0307512_10016074 | Ga0307512_100160748 | 207 |
| 13 | 3300035114 | Ga0373939_0179735 | Ga0373939_0179735_13_708 | 207 |
| 14 | 3300031649 | Ga0307514_10045004 | Ga0307514_100450042 | 208 |
| 15 | 3300025901 | Ga0207688_10176626 | Ga0207688_101766262 | 211 |
| 16 | 3300053108 | Ga0500562_044030 | Ga0500562_044030_15_650 | 211 |
| 17 | 3300028794 | Ga0307515_10135482 | Ga0307515_101354822 | 212 |
| 18 | 3300005459 | Ga0068867_100766957 | Ga0068867_1007669571 | 213 |
| 19 | 3300005539 | Ga0068853_100087384 | Ga0068853_1000873842 | 213 |
| 20 | 3300005616 | Ga0068852_100396283 | Ga0068852_1003962832 | 213 |
| 21 | 3300009093 | Ga0105240_10007179 | Ga0105240_100071794 | 213 |
| 22 | 3300009545 | Ga0105237_10013241 | Ga0105237_100132415 | 213 |
| 23 | 3300010375 | Ga0105239_10000328 | Ga0105239_1000032816 | 213 |
| 24 | 3300025913 | Ga0207695_10015535 | Ga0207695_100155357 | 213 |
| 25 | 3300025914 | Ga0207671_10009035 | Ga0207671_100090356 | 213 |
| 26 | 3300026041 | Ga0207639_10242487 | Ga0207639_102424872 | 213 |
| 27 | 3300026089 | Ga0207648_10740892 | Ga0207648_107408922 | 213 |
| 28 | 3300028794 | Ga0307515_10004327 | Ga0307515_100043275 | 214 |
| 29 | 3300046683 | Ga0495658_0059128 | Ga0495658_0059128_373_1101 | 214 |
| 30 | 3300028794 | Ga0307515_10002735 | Ga0307515_1000273535 | 215 |
| 31 | 3300031456 | Ga0307513_10003908 | Ga0307513_100039088 | 215 |
| 32 | 3300031507 | Ga0307509_10191987 | Ga0307509_101919872 | 215 |
| 33 | 3300031616 | Ga0307508_10000050 | Ga0307508_1000005081 | 215 |
| 34 | 3300005455 | Ga0070663_100009363 | Ga0070663_1000093633 | 216 |
| 35 | 3300006177 | Ga0075362_10126482 | Ga0075362_101264822 | 216 |
| 36 | 3300026067 | Ga0207678_10019228 | Ga0207678_100192284 | 216 |
| 37 | 3300028794 | Ga0307515_10009775 | Ga0307515_1000977513 | 216 |
| 38 | 3300041512 | Ga0451853_0558546 | Ga0451853_0558546_453_1181 | 216 |
| 39 | 3300044656 | Ga0466969_0028029 | Ga0466969_0028029_1256_2038 | 216 |
| 40 | 3300044683 | Ga0466965_0009551 | Ga0466965_0009551_2048_2830 | 216 |
| 41 | 3300044684 | Ga0466966_0009537 | Ga0466966_0009537_4442_5224 | 216 |
| 42 | 3300044694 | Ga0466963_0017043 | Ga0466963_0017043_683_1465 | 216 |
| 43 | 3300044706 | Ga0466964_0001234 | Ga0466964_0001234_7536_8318 | 216 |
| 44 | 3300044765 | Ga0466970_0032716 | Ga0466970_0032716_723_1505 | 216 |
| 45 | 3300044842 | Ga0466957_0040794 | Ga0466957_0040794_1719_2501 | 216 |
| 46 | 3300045049 | Ga0466959_0000156 | Ga0466959_0000156_14201_14983 | 216 |
| 47 | 3300045976 | Ga0466967_0001757 | Ga0466967_0001757_2484_3266 | 216 |
| 48 | 3300053739 | Ga0500587_000509 | Ga0500587_000509_20_706 | 216 |
| 49 | 3300028786 | Ga0307517_10012260 | Ga0307517_100122608 | 217 |
| 50 | 3300028794 | Ga0307515_10136765 | Ga0307515_101367651 | 217 |
| 51 | 3300028794 | Ga0307515_10208838 | Ga0307515_102088383 | 217 |
| 52 | 3300031548 | Ga0307408_100178609 | Ga0307408_1001786092 | 217 |
| 53 | 3300031911 | Ga0307412_10203925 | Ga0307412_102039252 | 217 |
| 54 | 3300032002 | Ga0307416_100674491 | Ga0307416_1006744912 | 217 |
| 55 | 3300046512 | Ga0495610_0050346 | Ga0495610_0050346_126_854 | 217 |
| 56 | 3300046519 | Ga0495632_0095570 | Ga0495632_0095570_204_938 | 217 |
| 57 | 3300046660 | Ga0495625_0403263 | Ga0495625_0403263_42_776 | 217 |
| 58 | 3300050493 | nmdc:mga0k408_30313_c2 | nmdc:mga0k408_30313_c2_463_1191 | 217 |
| 59 | 3300050496 | nmdc:mga07m45_63975_c1 | nmdc:mga07m45_63975_c1_906_1634 | 217 |
| 60 | 3300005293 | Ga0065715_10102963 | Ga0065715_101029632 | 218 |
| 61 | 3300005563 | Ga0068855_100009405 | Ga0068855_1000094055 | 218 |
| 62 | 3300006038 | Ga0075365_10053529 | Ga0075365_100535293 | 218 |
| 63 | 3300006042 | Ga0075368_10053596 | Ga0075368_100535962 | 218 |
| 64 | 3300006048 | Ga0075363_100209016 | Ga0075363_1002090162 | 218 |
| 65 | 3300006051 | Ga0075364_10289634 | Ga0075364_102896342 | 218 |
| 66 | 3300006178 | Ga0075367_10090669 | Ga0075367_100906692 | 218 |
| 67 | 3300006195 | Ga0075366_10250723 | Ga0075366_102507232 | 218 |
| 68 | 3300006353 | Ga0075370_10057500 | Ga0075370_100575002 | 218 |
| 69 | 3300006353 | Ga0075370_10316976 | Ga0075370_103169761 | 218 |
| 70 | 3300006852 | Ga0075433_10014097 | Ga0075433_100140975 | 218 |
| 71 | 3300006871 | Ga0075434_100019051 | Ga0075434_1000190513 | 218 |
| 72 | 3300007076 | Ga0075435_100058900 | Ga0075435_1000589004 | 218 |
| 73 | 3300009177 | Ga0105248_11280631 | Ga0105248_112806311 | 218 |
| 74 | 3300025949 | Ga0207667_10030151 | Ga0207667_100301513 | 218 |
| 75 | 3300027866 | Ga0209813_10046244 | Ga0209813_100462442 | 218 |
| 76 | 3300031456 | Ga0307513_10044731 | Ga0307513_100447312 | 218 |
| 77 | 3300041453 | Ga0451797_0498566 | Ga0451797_0498566_806_1540 | 218 |
| 78 | 3300046660 | Ga0495625_0003005 | Ga0495625_0003005_5881_6609 | 218 |
| 79 | 3300050490 | nmdc:mga03n38_134106_c1 | nmdc:mga03n38_134106_c1_329_1063 | 218 |
| 80 | 3300050491 | nmdc:mga00v17_1626_c1 | nmdc:mga00v17_1626_c1_10157_10891 | 218 |
| 81 | 3300050492 | nmdc:mga0yw44_13994_c1 | nmdc:mga0yw44_13994_c1_2967_3701 | 218 |
| 82 | 3300050493 | nmdc:mga0k408_464040_c1 | nmdc:mga0k408_464040_c1_46_735 | 218 |
| 83 | 3300050495 | nmdc:mga04h51_76280_c1 | nmdc:mga04h51_76280_c1_68_802 | 218 |
| 84 | 3300050496 | nmdc:mga07m45_2073_c1 | nmdc:mga07m45_2073_c1_5687_6421 | 218 |
| 85 | 3300050512 | nmdc:mga0n895_63233_c1 | nmdc:mga0n895_63233_c1_1370_2062 | 218 |
| 86 | 3300050513 | nmdc:mga0rr50_84822_c1 | nmdc:mga0rr50_84822_c1_757_1449 | 218 |
| 87 | 3300050515 | nmdc:mga0a205_9437_c1 | nmdc:mga0a205_9437_c1_4160_4852 | 218 |
| 88 | 3300053092 | Ga0500583_0004231 | Ga0500583_0004231_2390_3136 | 218 |
| 89 | 3300031548 | Ga0307408_100699876 | Ga0307408_1006998762 | 219 |
| 90 | 3300031616 | Ga0307508_10001066 | Ga0307508_1000106623 | 219 |
| 91 | 3300037471 | Ga0395905_0008608 | Ga0395905_0008608_1516_2247 | 219 |
| 92 | 3300037471 | Ga0395905_0071099 | Ga0395905_0071099_1204_1938 | 219 |
| 93 | 3300042003 | Ga0439443_011547 | Ga0439443_011547_477_1211 | 219 |
| 94 | 3300044656 | Ga0466969_0010615 | Ga0466969_0010615_1117_1848 | 220 |
| 95 | 3300044684 | Ga0466966_0001704 | Ga0466966_0001704_10822_11553 | 220 |
| 96 | 3300044693 | Ga0466961_0002399 | Ga0466961_0002399_1371_2102 | 220 |
| 97 | 3300044765 | Ga0466970_0104719 | Ga0466970_0104719_537_1268 | 220 |
| 98 | 3300045049 | Ga0466959_0118021 | Ga0466959_0118021_913_1644 | 220 |
| 99 | 3300048905 | Ga0496102_0010655 | Ga0496102_0010655_967_1695 | 220 |
| 100 | 3300048912 | Ga0496109_0040768 | Ga0496109_0040768_3161_3895 | 220 |
| 101 | 3300005444 | Ga0070694_100315567 | Ga0070694_1003155672 | 221 |
| 102 | 3300005844 | Ga0068862_100408709 | Ga0068862_1004087092 | 221 |
| 103 | 3300006847 | Ga0075431_100127572 | Ga0075431_1001275723 | 221 |
| 104 | 3300009094 | Ga0111539_10195776 | Ga0111539_101957762 | 221 |
| 105 | 3300028380 | Ga0268265_10436908 | Ga0268265_104369082 | 221 |
| 106 | 3300050510 | nmdc:mga06r32_50162_c2 | nmdc:mga06r32_50162_c2_1472_2206 | 221 |
| 107 | 3300002739 | JGI25158J39367_1011392 | JGI25158J39367_10113921 | 223 |
| 108 | 3300002773 | JGI25152J39213_1003919 | JGI25152J39213_10039195 | 223 |
| 109 | 3300002987 | JGI25159J45721_1007697 | JGI25159J45721_10076972 | 223 |
| 110 | 3300003187 | JGI25151J46595_10002892 | JGI25151J46595_100028928 | 223 |
| 111 | 3300003215 | JGI25153J46596_10002836 | JGI25153J46596_100028365 | 223 |
| 112 | 3300003354 | JGI25160J50197_1004870 | JGI25160J50197_10048707 | 223 |
| 113 | 3300003374 | JGI25161J50226_1004966 | JGI25161J50226_10049663 | 223 |
| 114 | 3300003578 | Ga0006562J51391_1039354 | Ga0006562J51391_10393544 | 223 |
| 115 | 3300003781 | Ga0055536_1002259 | Ga0055536_100225910 | 223 |
| 116 | 3300003791 | Ga0055530_10000386 | Ga0055530_100003869 | 223 |
| 117 | 3300003792 | Ga0055540_1003175 | Ga0055540_10031757 | 223 |
| 118 | 3300003794 | Ga0055531_10002998 | Ga0055531_1000299810 | 223 |
| 119 | 3300004625 | Ga0055543_1002930 | Ga0055543_10029304 | 223 |
| 120 | 3300005262 | Ga0065165_1007714 | Ga0065165_10077145 | 223 |
| 121 | 3300006353 | Ga0075370_10234274 | Ga0075370_102342742 | 223 |
| 122 | 3300025208 | Ga0209436_103113 | Ga0209436_1031134 | 223 |
| 123 | 3300025245 | Ga0207425_1001598 | Ga0207425_10015985 | 223 |
| 124 | 3300025258 | Ga0209129_1004064 | Ga0209129_10040643 | 223 |
| 125 | 3300025273 | Ga0209673_1000377 | Ga0209673_100037715 | 223 |
| 126 | 3300025284 | Ga0209130_1000614 | Ga0209130_10006149 | 223 |
| 127 | 3300025284 | Ga0209130_1002698 | Ga0209130_10026985 | 223 |
| 128 | 3300025291 | Ga0209675_1001146 | Ga0209675_10011467 | 223 |
| 129 | 3300025292 | Ga0209676_1000202 | Ga0209676_100020251 | 223 |
| 130 | 3300025294 | Ga0209025_1008848 | Ga0209025_10088488 | 223 |
| 131 | 3300025295 | Ga0209564_1000223 | Ga0209564_1000223123 | 223 |
| 132 | 3300025297 | Ga0209758_1005313 | Ga0209758_10053138 | 223 |
| 133 | 3300025298 | Ga0209050_1000224 | Ga0209050_10002249 | 223 |
| 134 | 3300025299 | Ga0209256_1000174 | Ga0209256_1000174123 | 223 |
| 135 | 3300025302 | Ga0207426_1000232 | Ga0207426_1000232123 | 223 |
| 136 | 3300025303 | Ga0209051_1000497 | Ga0209051_100049721 | 223 |
| 137 | 3300025304 | Ga0209257_1000163 | Ga0209257_1000163123 | 223 |
| 138 | 3300026116 | Ga0207674_10540593 | Ga0207674_105405932 | 223 |
| 139 | 3300031824 | Ga0307413_10127522 | Ga0307413_101275222 | 223 |
| 140 | 3300031911 | Ga0307412_10368520 | Ga0307412_103685201 | 223 |
| 141 | 3300032002 | Ga0307416_100134249 | Ga0307416_1001342492 | 223 |
| 142 | 3300032126 | Ga0307415_100036188 | Ga0307415_1000361883 | 223 |
| 143 | 3300005295 | Ga0065707_10107161 | Ga0065707_101071613 | 224 |
| 144 | 3300005336 | Ga0070680_100242916 | Ga0070680_1002429162 | 224 |
| 145 | 3300005353 | Ga0070669_100009114 | Ga0070669_1000091142 | 224 |
| 146 | 3300005366 | Ga0070659_100410456 | Ga0070659_1004104562 | 224 |
| 147 | 3300005577 | Ga0068857_100010788 | Ga0068857_1000107882 | 224 |
| 148 | 3300005618 | Ga0068864_100200674 | Ga0068864_1002006742 | 224 |
| 149 | 3300005844 | Ga0068862_100440109 | Ga0068862_1004401092 | 224 |
| 150 | 3300006844 | Ga0075428_100029742 | Ga0075428_1000297425 | 224 |
| 151 | 3300006846 | Ga0075430_100159976 | Ga0075430_1001599762 | 224 |
| 152 | 3300006847 | Ga0075431_100037295 | Ga0075431_1000372953 | 224 |
| 153 | 3300006880 | Ga0075429_100046639 | Ga0075429_1000466392 | 224 |
| 154 | 3300006880 | Ga0075429_100242620 | Ga0075429_1002426202 | 224 |
| 155 | 3300009094 | Ga0111539_10004096 | Ga0111539_100040965 | 224 |
| 156 | 3300009094 | Ga0111539_10090659 | Ga0111539_100906594 | 224 |
| 157 | 3300011119 | Ga0105246_10068482 | Ga0105246_100684823 | 224 |
| 158 | 3300014326 | Ga0157380_10013927 | Ga0157380_100139273 | 224 |
| 159 | 3300014745 | Ga0157377_10013920 | Ga0157377_100139202 | 224 |
| 160 | 3300025901 | Ga0207688_10231300 | Ga0207688_102313001 | 224 |
| 161 | 3300025961 | Ga0207712_10150562 | Ga0207712_101505622 | 224 |
| 162 | 3300026116 | Ga0207674_10191311 | Ga0207674_101913112 | 224 |
| 163 | 3300027907 | Ga0207428_10006671 | Ga0207428_100066716 | 224 |
| 164 | 3300027907 | Ga0207428_10174792 | Ga0207428_101747922 | 224 |
| 165 | 3300050508 | nmdc:mga09592_6498_c1 | nmdc:mga09592_6498_c1_8654_9388 | 224 |
| 166 | 3300050511 | nmdc:mga08y16_10534_c1 | nmdc:mga08y16_10534_c1_3327_4061 | 224 |
| 167 | 3300050511 | nmdc:mga08y16_251151_c1 | nmdc:mga08y16_251151_c1_24_758 | 224 |
| 168 | 3300006871 | Ga0075434_100149383 | Ga0075434_1001493833 | 225 |
| 169 | 3300007076 | Ga0075435_100779332 | Ga0075435_1007793321 | 225 |
| 170 | 3300005365 | Ga0070688_100567095 | Ga0070688_1005670951 | 226 |
| 171 | 3300003323 | rootH1_10158496 | rootH1_101584963 | 227 |
| 172 | 3300048911 | Ga0496108_0095002 | Ga0496108_0095002_770_1504 | 227 |
| 173 | 3300053154 | Ga0500619_000179 | Ga0500619_000179_8722_9447 | 227 |
| 174 | 3300003792 | Ga0055540_1002089 | Ga0055540_10020899 | 228 |
| 175 | 3300003794 | Ga0055531_10003465 | Ga0055531_100034656 | 228 |
| 176 | 3300005328 | Ga0070676_10445860 | Ga0070676_104458601 | 228 |
| 177 | 3300005329 | Ga0070683_100035296 | Ga0070683_1000352961 | 228 |
| 178 | 3300005333 | Ga0070677_10107040 | Ga0070677_101070402 | 228 |
| 179 | 3300005356 | Ga0070674_100435859 | Ga0070674_1004358592 | 228 |
| 180 | 3300005456 | Ga0070678_100161737 | Ga0070678_1001617372 | 228 |
| 181 | 3300005458 | Ga0070681_10092205 | Ga0070681_100922053 | 228 |
| 182 | 3300005459 | Ga0068867_100048820 | Ga0068867_1000488202 | 228 |
| 183 | 3300005548 | Ga0070665_100525164 | Ga0070665_1005251642 | 228 |
| 184 | 3300007788 | Ga0099795_10000252 | Ga0099795_100002524 | 228 |
| 185 | 3300009093 | Ga0105240_10205219 | Ga0105240_102052192 | 228 |
| 186 | 3300009551 | Ga0105238_10204784 | Ga0105238_102047842 | 228 |
| 187 | 3300010159 | Ga0099796_10000338 | Ga0099796_100003385 | 228 |
| 188 | 3300013105 | Ga0157369_10046134 | Ga0157369_100461345 | 228 |
| 189 | 3300013105 | Ga0157369_10095033 | Ga0157369_100950332 | 228 |
| 190 | 3300013307 | Ga0157372_10085056 | Ga0157372_100850565 | 228 |
| 191 | 3300013307 | Ga0157372_10141315 | Ga0157372_101413152 | 228 |
| 192 | 3300014326 | Ga0157380_10017083 | Ga0157380_100170835 | 228 |
| 193 | 3300025273 | Ga0209673_1013907 | Ga0209673_10139072 | 228 |
| 194 | 3300025303 | Ga0209051_1000972 | Ga0209051_100097212 | 228 |
| 195 | 3300025304 | Ga0209257_1000144 | Ga0209257_1000144189 | 228 |
| 196 | 3300025907 | Ga0207645_10041034 | Ga0207645_100410344 | 228 |
| 197 | 3300025912 | Ga0207707_10027781 | Ga0207707_100277812 | 228 |
| 198 | 3300025913 | Ga0207695_10634927 | Ga0207695_106349272 | 228 |
| 199 | 3300025921 | Ga0207652_10119385 | Ga0207652_101193852 | 228 |
| 200 | 3300025937 | Ga0207669_10521660 | Ga0207669_105216602 | 228 |
| 201 | 3300025944 | Ga0207661_10032621 | Ga0207661_100326215 | 228 |
| 202 | 3300025949 | Ga0207667_10025177 | Ga0207667_100251773 | 228 |
| 203 | 3300028017 | Ga0265356_1000850 | Ga0265356_10008503 | 228 |
| 204 | 3300030760 | Ga0265762_1023378 | Ga0265762_10233782 | 228 |
| 205 | 3300031824 | Ga0307413_10051656 | Ga0307413_100516563 | 228 |
| 206 | 3300031995 | Ga0307409_100293450 | Ga0307409_1002934502 | 228 |
| 207 | 3300044901 | Ga0466960_0010312 | Ga0466960_0010312_2933_3628 | 228 |
| 208 | 3300045051 | Ga0451576_0121103 | Ga0451576_0121103_1536_2267 | 228 |
| 209 | 3300046522 | Ga0495643_0014410 | Ga0495643_0014410_2923_3651 | 228 |
| 210 | 3300046660 | Ga0495625_0031201 | Ga0495625_0031201_24_755 | 228 |
| 211 | 3300050510 | nmdc:mga06r32_150619_c1 | nmdc:mga06r32_150619_c1_306_995 | 228 |
| 212 | 3300053139 | Ga0500568_0027934 | Ga0500568_0027934_571_1302 | 228 |
| 213 | iso_pu_bacteria | 2585428062 | 2587756494 | 228 |
| 214 | 3300001989 | JGI24739J22299_10107636 | JGI24739J22299_101076361 | 229 |
| 215 | 3300002704 | JGI25155J39150_1000041 | JGI25155J39150_100004116 | 229 |
| 216 | 3300002705 | JGI25156J39149_1000031 | JGI25156J39149_100003166 | 229 |
| 217 | 3300002738 | JGI25154J39366_1000049 | JGI25154J39366_100004947 | 229 |
| 218 | 3300002741 | JGI25157J39369_1000041 | JGI25157J39369_100004147 | 229 |
| 219 | 3300002773 | JGI25152J39213_1001385 | JGI25152J39213_10013855 | 229 |
| 220 | 3300002774 | JGI25150J39212_1004083 | JGI25150J39212_10040832 | 229 |
| 221 | 3300002987 | JGI25159J45721_1002044 | JGI25159J45721_10020447 | 229 |
| 222 | 3300002987 | JGI25159J45721_1004046 | JGI25159J45721_10040463 | 229 |
| 223 | 3300002987 | JGI25159J45721_1027216 | JGI25159J45721_10272161 | 229 |
| 224 | 3300003187 | JGI25151J46595_10002148 | JGI25151J46595_100021489 | 229 |
| 225 | 3300003187 | JGI25151J46595_10002546 | JGI25151J46595_100025467 | 229 |
| 226 | 3300003187 | JGI25151J46595_10012456 | JGI25151J46595_100124565 | 229 |
| 227 | 3300003187 | JGI25151J46595_10035283 | JGI25151J46595_100352832 | 229 |
| 228 | 3300003187 | JGI25151J46595_10040471 | JGI25151J46595_100404712 | 229 |
| 229 | 3300003215 | JGI25153J46596_10001619 | JGI25153J46596_100016198 | 229 |
| 230 | 3300003316 | rootH1_10029614 | rootH1_100296147 | 229 |
| 231 | 3300003320 | rootH2_10145589 | rootH2_101455891 | 229 |
| 232 | 3300003354 | JGI25160J50197_1000684 | JGI25160J50197_10006845 | 229 |
| 233 | 3300003354 | JGI25160J50197_1001665 | JGI25160J50197_10016655 | 229 |
| 234 | 3300003374 | JGI25161J50226_1000042 | JGI25161J50226_100004211 | 229 |
| 235 | 3300003374 | JGI25161J50226_1012128 | JGI25161J50226_10121281 | 229 |
| 236 | 3300003761 | Ga0055535_1000192 | Ga0055535_10001928 | 229 |
| 237 | 3300003762 | Ga0055542_1000058 | Ga0055542_100005851 | 229 |
| 238 | 3300003771 | Ga0055526_1006434 | Ga0055526_10064343 | 229 |
| 239 | 3300003771 | Ga0055526_1008120 | Ga0055526_10081205 | 229 |
| 240 | 3300003771 | Ga0055526_1008276 | Ga0055526_10082765 | 229 |
| 241 | 3300003773 | Ga0055537_1000865 | Ga0055537_100086510 | 229 |
| 242 | 3300003773 | Ga0055537_1000915 | Ga0055537_10009159 | 229 |
| 243 | 3300003775 | Ga0055524_1000260 | Ga0055524_100026021 | 229 |
| 244 | 3300003775 | Ga0055524_1004565 | Ga0055524_10045653 | 229 |
| 245 | 3300003784 | Ga0055534_1001009 | Ga0055534_10010099 | 229 |
| 246 | 3300003784 | Ga0055534_1002221 | Ga0055534_10022212 | 229 |
| 247 | 3300003784 | Ga0055534_1019916 | Ga0055534_10199162 | 229 |
| 248 | 3300003790 | Ga0055528_1001308 | Ga0055528_100130811 | 229 |
| 249 | 3300003790 | Ga0055528_1008604 | Ga0055528_10086046 | 229 |
| 250 | 3300003791 | Ga0055530_10000553 | Ga0055530_1000055321 | 229 |
| 251 | 3300003791 | Ga0055530_10007037 | Ga0055530_100070375 | 229 |
| 252 | 3300003792 | Ga0055540_1000010 | Ga0055540_100001021 | 229 |
| 253 | 3300003792 | Ga0055540_1001280 | Ga0055540_10012809 | 229 |
| 254 | 3300003792 | Ga0055540_1020075 | Ga0055540_10200752 | 229 |
| 255 | 3300003794 | Ga0055531_10001065 | Ga0055531_1000106514 | 229 |
| 256 | 3300003794 | Ga0055531_10001780 | Ga0055531_100017809 | 229 |
| 257 | 3300003794 | Ga0055531_10003566 | Ga0055531_100035668 | 229 |
| 258 | 3300004625 | Ga0055543_1000279 | Ga0055543_10002798 | 229 |
| 259 | 3300004625 | Ga0055543_1000922 | Ga0055543_10009225 | 229 |
| 260 | 3300005262 | Ga0065165_1002803 | Ga0065165_10028035 | 229 |
| 261 | 3300005262 | Ga0065165_1008412 | Ga0065165_10084123 | 229 |
| 262 | 3300005262 | Ga0065165_1008974 | Ga0065165_10089743 | 229 |
| 263 | 3300005293 | Ga0065715_10105842 | Ga0065715_101058423 | 229 |
| 264 | 3300005293 | Ga0065715_10168814 | Ga0065715_101688142 | 229 |
| 265 | 3300005295 | Ga0065707_10005231 | Ga0065707_100052313 | 229 |
| 266 | 3300005295 | Ga0065707_10082114 | Ga0065707_100821149 | 229 |
| 267 | 3300005295 | Ga0065707_10123977 | Ga0065707_101239772 | 229 |
| 268 | 3300005328 | Ga0070676_10090163 | Ga0070676_100901631 | 229 |
| 269 | 3300005329 | Ga0070683_100021428 | Ga0070683_1000214282 | 229 |
| 270 | 3300005330 | Ga0070690_100078474 | Ga0070690_1000784742 | 229 |
| 271 | 3300005331 | Ga0070670_100245844 | Ga0070670_1002458441 | 229 |
| 272 | 3300005331 | Ga0070670_100731007 | Ga0070670_1007310071 | 229 |
| 273 | 3300005334 | Ga0068869_100094676 | Ga0068869_1000946763 | 229 |
| 274 | 3300005334 | Ga0068869_100205532 | Ga0068869_1002055322 | 229 |
| 275 | 3300005337 | Ga0070682_100345692 | Ga0070682_1003456922 | 229 |
| 276 | 3300005338 | Ga0068868_100584430 | Ga0068868_1005844301 | 229 |
| 277 | 3300005339 | Ga0070660_100119996 | Ga0070660_1001199962 | 229 |
| 278 | 3300005339 | Ga0070660_100278148 | Ga0070660_1002781482 | 229 |
| 279 | 3300005340 | Ga0070689_100001812 | Ga0070689_10000181210 | 229 |
| 280 | 3300005340 | Ga0070689_100043554 | Ga0070689_1000435544 | 229 |
| 281 | 3300005343 | Ga0070687_100015192 | Ga0070687_1000151922 | 229 |
| 282 | 3300005353 | Ga0070669_100003380 | Ga0070669_1000033808 | 229 |
| 283 | 3300005353 | Ga0070669_100039261 | Ga0070669_1000392612 | 229 |
| 284 | 3300005354 | Ga0070675_100108096 | Ga0070675_1001080962 | 229 |
| 285 | 3300005354 | Ga0070675_100365796 | Ga0070675_1003657962 | 229 |
| 286 | 3300005355 | Ga0070671_100045984 | Ga0070671_1000459844 | 229 |
| 287 | 3300005356 | Ga0070674_100245741 | Ga0070674_1002457412 | 229 |
| 288 | 3300005356 | Ga0070674_100456435 | Ga0070674_1004564351 | 229 |
| 289 | 3300005364 | Ga0070673_100135404 | Ga0070673_1001354042 | 229 |
| 290 | 3300005364 | Ga0070673_100183174 | Ga0070673_1001831742 | 229 |
| 291 | 3300005364 | Ga0070673_100244687 | Ga0070673_1002446872 | 229 |
| 292 | 3300005365 | Ga0070688_100022761 | Ga0070688_1000227612 | 229 |
| 293 | 3300005365 | Ga0070688_100367980 | Ga0070688_1003679801 | 229 |
| 294 | 3300005366 | Ga0070659_100225401 | Ga0070659_1002254012 | 229 |
| 295 | 3300005367 | Ga0070667_100185086 | Ga0070667_1001850862 | 229 |
| 296 | 3300005440 | Ga0070705_100067429 | Ga0070705_1000674292 | 229 |
| 297 | 3300005441 | Ga0070700_100002005 | Ga0070700_1000020056 | 229 |
| 298 | 3300005441 | Ga0070700_100044838 | Ga0070700_1000448384 | 229 |
| 299 | 3300005441 | Ga0070700_100307412 | Ga0070700_1003074122 | 229 |
| 300 | 3300005444 | Ga0070694_100002855 | Ga0070694_1000028556 | 229 |
| 301 | 3300005456 | Ga0070678_100036820 | Ga0070678_1000368202 | 229 |
| 302 | 3300005456 | Ga0070678_100059787 | Ga0070678_1000597873 | 229 |
| 303 | 3300005457 | Ga0070662_100016502 | Ga0070662_1000165024 | 229 |
| 304 | 3300005457 | Ga0070662_100018289 | Ga0070662_1000182893 | 229 |
| 305 | 3300005459 | Ga0068867_100000042 | Ga0068867_10000004250 | 229 |
| 306 | 3300005459 | Ga0068867_100009240 | Ga0068867_1000092404 | 229 |
| 307 | 3300005467 | Ga0070706_100006362 | Ga0070706_1000063624 | 229 |
| 308 | 3300005467 | Ga0070706_100054184 | Ga0070706_1000541842 | 229 |
| 309 | 3300005467 | Ga0070706_100136563 | Ga0070706_1001365632 | 229 |
| 310 | 3300005468 | Ga0070707_100014136 | Ga0070707_1000141366 | 229 |
| 311 | 3300005471 | Ga0070698_100083197 | Ga0070698_1000831973 | 229 |
| 312 | 3300005518 | Ga0070699_100069382 | Ga0070699_1000693823 | 229 |
| 313 | 3300005539 | Ga0068853_100004595 | Ga0068853_1000045959 | 229 |
| 314 | 3300005539 | Ga0068853_100021439 | Ga0068853_1000214394 | 229 |
| 315 | 3300005539 | Ga0068853_100075897 | Ga0068853_1000758974 | 229 |
| 316 | 3300005543 | Ga0070672_100057979 | Ga0070672_1000579792 | 229 |
| 317 | 3300005544 | Ga0070686_100015782 | Ga0070686_1000157824 | 229 |
| 318 | 3300005544 | Ga0070686_100061239 | Ga0070686_1000612393 | 229 |
| 319 | 3300005546 | Ga0070696_100444715 | Ga0070696_1004447151 | 229 |
| 320 | 3300005547 | Ga0070693_100030718 | Ga0070693_1000307181 | 229 |
| 321 | 3300005548 | Ga0070665_100003695 | Ga0070665_10000369511 | 229 |
| 322 | 3300005548 | Ga0070665_100035690 | Ga0070665_1000356903 | 229 |
| 323 | 3300005549 | Ga0070704_100002098 | Ga0070704_1000020985 | 229 |
| 324 | 3300005549 | Ga0070704_100218470 | Ga0070704_1002184702 | 229 |
| 325 | 3300005563 | Ga0068855_100432269 | Ga0068855_1004322692 | 229 |
| 326 | 3300005563 | Ga0068855_100745602 | Ga0068855_1007456022 | 229 |
| 327 | 3300005564 | Ga0070664_100004106 | Ga0070664_1000041067 | 229 |
| 328 | 3300005564 | Ga0070664_100305096 | Ga0070664_1003050962 | 229 |
| 329 | 3300005564 | Ga0070664_100439725 | Ga0070664_1004397252 | 229 |
| 330 | 3300005577 | Ga0068857_100003699 | Ga0068857_10000369910 | 229 |
| 331 | 3300005577 | Ga0068857_100010135 | Ga0068857_1000101353 | 229 |
| 332 | 3300005577 | Ga0068857_100031414 | Ga0068857_1000314144 | 229 |
| 333 | 3300005578 | Ga0068854_100033283 | Ga0068854_1000332832 | 229 |
| 334 | 3300005578 | Ga0068854_100043779 | Ga0068854_1000437794 | 229 |
| 335 | 3300005578 | Ga0068854_100241690 | Ga0068854_1002416902 | 229 |
| 336 | 3300005614 | Ga0068856_100172206 | Ga0068856_1001722063 | 229 |
| 337 | 3300005615 | Ga0070702_100001656 | Ga0070702_1000016568 | 229 |
| 338 | 3300005616 | Ga0068852_100021501 | Ga0068852_1000215015 | 229 |
| 339 | 3300005616 | Ga0068852_100160793 | Ga0068852_1001607932 | 229 |
| 340 | 3300005617 | Ga0068859_100003913 | Ga0068859_10000391313 | 229 |
| 341 | 3300005617 | Ga0068859_100103230 | Ga0068859_1001032303 | 229 |
| 342 | 3300005618 | Ga0068864_100017265 | Ga0068864_1000172654 | 229 |
| 343 | 3300005618 | Ga0068864_100050776 | Ga0068864_1000507763 | 229 |
| 344 | 3300005718 | Ga0068866_10191716 | Ga0068866_101917162 | 229 |
| 345 | 3300005719 | Ga0068861_100001582 | Ga0068861_1000015828 | 229 |
| 346 | 3300005719 | Ga0068861_100001663 | Ga0068861_10000166313 | 229 |
| 347 | 3300005719 | Ga0068861_100016468 | Ga0068861_1000164683 | 229 |
| 348 | 3300005834 | Ga0068851_10037901 | Ga0068851_100379012 | 229 |
| 349 | 3300005840 | Ga0068870_10002226 | Ga0068870_100022264 | 229 |
| 350 | 3300005842 | Ga0068858_100148991 | Ga0068858_1001489912 | 229 |
| 351 | 3300005843 | Ga0068860_100120159 | Ga0068860_1001201593 | 229 |
| 352 | 3300005843 | Ga0068860_100544879 | Ga0068860_1005448792 | 229 |
| 353 | 3300005844 | Ga0068862_100012186 | Ga0068862_1000121862 | 229 |
| 354 | 3300005844 | Ga0068862_100070665 | Ga0068862_1000706652 | 229 |
| 355 | 3300005937 | Ga0081455_10000066 | Ga0081455_1000006631 | 229 |
| 356 | 3300006038 | Ga0075365_10101130 | Ga0075365_101011302 | 229 |
| 357 | 3300006038 | Ga0075365_10243622 | Ga0075365_102436222 | 229 |
| 358 | 3300006042 | Ga0075368_10138046 | Ga0075368_101380462 | 229 |
| 359 | 3300006048 | Ga0075363_100084158 | Ga0075363_1000841582 | 229 |
| 360 | 3300006048 | Ga0075363_100153068 | Ga0075363_1001530682 | 229 |
| 361 | 3300006051 | Ga0075364_10019429 | Ga0075364_100194292 | 229 |
| 362 | 3300006051 | Ga0075364_10257702 | Ga0075364_102577022 | 229 |
| 363 | 3300006058 | Ga0075432_10078416 | Ga0075432_100784162 | 229 |
| 364 | 3300006177 | Ga0075362_10034649 | Ga0075362_100346493 | 229 |
| 365 | 3300006177 | Ga0075362_10042494 | Ga0075362_100424942 | 229 |
| 366 | 3300006178 | Ga0075367_10006362 | Ga0075367_100063623 | 229 |
| 367 | 3300006178 | Ga0075367_10011215 | Ga0075367_100112153 | 229 |
| 368 | 3300006178 | Ga0075367_10024107 | Ga0075367_100241072 | 229 |
| 369 | 3300006178 | Ga0075367_10031771 | Ga0075367_100317714 | 229 |
| 370 | 3300006178 | Ga0075367_10272318 | Ga0075367_102723182 | 229 |
| 371 | 3300006186 | Ga0075369_10014370 | Ga0075369_100143704 | 229 |
| 372 | 3300006195 | Ga0075366_10004217 | Ga0075366_100042175 | 229 |
| 373 | 3300006195 | Ga0075366_10012200 | Ga0075366_100122002 | 229 |
| 374 | 3300006195 | Ga0075366_10013204 | Ga0075366_100132042 | 229 |
| 375 | 3300006195 | Ga0075366_10019104 | Ga0075366_100191042 | 229 |
| 376 | 3300006195 | Ga0075366_10030349 | Ga0075366_100303492 | 229 |
| 377 | 3300006195 | Ga0075366_10031403 | Ga0075366_100314032 | 229 |
| 378 | 3300006195 | Ga0075366_10070035 | Ga0075366_100700352 | 229 |
| 379 | 3300006195 | Ga0075366_10179727 | Ga0075366_101797272 | 229 |
| 380 | 3300006237 | Ga0097621_100187141 | Ga0097621_1001871413 | 229 |
| 381 | 3300006237 | Ga0097621_100241906 | Ga0097621_1002419062 | 229 |
| 382 | 3300006353 | Ga0075370_10000059 | Ga0075370_1000005926 | 229 |
| 383 | 3300006353 | Ga0075370_10000220 | Ga0075370_100002207 | 229 |
| 384 | 3300006353 | Ga0075370_10008504 | Ga0075370_100085043 | 229 |
| 385 | 3300006353 | Ga0075370_10028264 | Ga0075370_100282642 | 229 |
| 386 | 3300006353 | Ga0075370_10043563 | Ga0075370_100435633 | 229 |
| 387 | 3300006358 | Ga0068871_100012030 | Ga0068871_1000120302 | 229 |
| 388 | 3300006358 | Ga0068871_100056557 | Ga0068871_1000565573 | 229 |
| 389 | 3300006358 | Ga0068871_100198273 | Ga0068871_1001982733 | 229 |
| 390 | 3300006844 | Ga0075428_100008577 | Ga0075428_1000085778 | 229 |
| 391 | 3300006846 | Ga0075430_100069168 | Ga0075430_1000691682 | 229 |
| 392 | 3300006847 | Ga0075431_100330878 | Ga0075431_1003308781 | 229 |
| 393 | 3300006871 | Ga0075434_100029189 | Ga0075434_1000291892 | 229 |
| 394 | 3300006880 | Ga0075429_100120549 | Ga0075429_1001205493 | 229 |
| 395 | 3300006881 | Ga0068865_100029574 | Ga0068865_1000295743 | 229 |
| 396 | 3300006931 | Ga0097620_100003912 | Ga0097620_1000039125 | 229 |
| 397 | 3300006931 | Ga0097620_100103227 | Ga0097620_1001032273 | 229 |
| 398 | 3300006948 | Ga0099826_10078446 | Ga0099826_100784462 | 229 |
| 399 | 3300009036 | Ga0105244_10004022 | Ga0105244_100040228 | 229 |
| 400 | 3300009093 | Ga0105240_10449574 | Ga0105240_104495742 | 229 |
| 401 | 3300009094 | Ga0111539_10024487 | Ga0111539_100244873 | 229 |
| 402 | 3300009094 | Ga0111539_10102418 | Ga0111539_101024182 | 229 |
| 403 | 3300009094 | Ga0111539_10582489 | Ga0111539_105824892 | 229 |
| 404 | 3300009098 | Ga0105245_10040873 | Ga0105245_100408732 | 229 |
| 405 | 3300009101 | Ga0105247_10080016 | Ga0105247_100800162 | 229 |
| 406 | 3300009147 | Ga0114129_10031517 | Ga0114129_100315175 | 229 |
| 407 | 3300009147 | Ga0114129_10183832 | Ga0114129_101838321 | 229 |
| 408 | 3300009148 | Ga0105243_10002909 | Ga0105243_100029095 | 229 |
| 409 | 3300009148 | Ga0105243_10003902 | Ga0105243_100039027 | 229 |
| 410 | 3300009148 | Ga0105243_10043728 | Ga0105243_100437283 | 229 |
| 411 | 3300009148 | Ga0105243_10213304 | Ga0105243_102133042 | 229 |
| 412 | 3300009148 | Ga0105243_10439307 | Ga0105243_104393072 | 229 |
| 413 | 3300009148 | Ga0105243_10752693 | Ga0105243_107526932 | 229 |
| 414 | 3300009545 | Ga0105237_10016231 | Ga0105237_100162313 | 229 |
| 415 | 3300009545 | Ga0105237_10320957 | Ga0105237_103209572 | 229 |
| 416 | 3300009551 | Ga0105238_10103384 | Ga0105238_101033842 | 229 |
| 417 | 3300009551 | Ga0105238_10255685 | Ga0105238_102556852 | 229 |
| 418 | 3300009553 | Ga0105249_10017219 | Ga0105249_100172192 | 229 |
| 419 | 3300010375 | Ga0105239_10014343 | Ga0105239_100143434 | 229 |
| 420 | 3300010375 | Ga0105239_10067146 | Ga0105239_100671463 | 229 |
| 421 | 3300010375 | Ga0105239_10095285 | Ga0105239_100952854 | 229 |
| 422 | 3300013100 | Ga0157373_10069518 | Ga0157373_100695183 | 229 |
| 423 | 3300013102 | Ga0157371_10033042 | Ga0157371_100330423 | 229 |
| 424 | 3300013104 | Ga0157370_10264616 | Ga0157370_102646162 | 229 |
| 425 | 3300013104 | Ga0157370_10563101 | Ga0157370_105631011 | 229 |
| 426 | 3300013105 | Ga0157369_10006986 | Ga0157369_100069868 | 229 |
| 427 | 3300013296 | Ga0157374_10476220 | Ga0157374_104762202 | 229 |
| 428 | 3300013297 | Ga0157378_10714149 | Ga0157378_107141492 | 229 |
| 429 | 3300013307 | Ga0157372_11251759 | Ga0157372_112517592 | 229 |
| 430 | 3300013308 | Ga0157375_10001087 | Ga0157375_100010878 | 229 |
| 431 | 3300014326 | Ga0157380_10051650 | Ga0157380_100516504 | 229 |
| 432 | 3300014326 | Ga0157380_10097494 | Ga0157380_100974942 | 229 |
| 433 | 3300014745 | Ga0157377_10000038 | Ga0157377_1000003849 | 229 |
| 434 | 3300014969 | Ga0157376_10024319 | Ga0157376_100243194 | 229 |
| 435 | 3300014969 | Ga0157376_10129325 | Ga0157376_101293252 | 229 |
| 436 | 3300015261 | Ga0182006_1001206 | Ga0182006_10012068 | 229 |
| 437 | 3300015262 | Ga0182007_10001393 | Ga0182007_100013938 | 229 |
| 438 | 3300017792 | Ga0163161_10100239 | Ga0163161_101002392 | 229 |
| 439 | 3300017792 | Ga0163161_10755358 | Ga0163161_107553581 | 229 |
| 440 | 3300025206 | Ga0209435_100014 | Ga0209435_10001447 | 229 |
| 441 | 3300025208 | Ga0209436_103101 | Ga0209436_1031014 | 229 |
| 442 | 3300025208 | Ga0209436_107346 | Ga0209436_1073463 | 229 |
| 443 | 3300025228 | Ga0209672_100539 | Ga0209672_10053917 | 229 |
| 444 | 3300025242 | Ga0209258_100147 | Ga0209258_100147104 | 229 |
| 445 | 3300025245 | Ga0207425_1000518 | Ga0207425_100051819 | 229 |
| 446 | 3300025245 | Ga0207425_1007663 | Ga0207425_10076633 | 229 |
| 447 | 3300025246 | Ga0209646_1000001 | Ga0209646_100000148 | 229 |
| 448 | 3300025250 | Ga0209026_1000073 | Ga0209026_100007347 | 229 |
| 449 | 3300025254 | Ga0209148_1000122 | Ga0209148_100012251 | 229 |
| 450 | 3300025256 | Ga0209759_1000013 | Ga0209759_100001348 | 229 |
| 451 | 3300025258 | Ga0209129_1000601 | Ga0209129_10006019 | 229 |
| 452 | 3300025258 | Ga0209129_1003026 | Ga0209129_10030263 | 229 |
| 453 | 3300025263 | Ga0209565_1000248 | Ga0209565_100024813 | 229 |
| 454 | 3300025263 | Ga0209565_1000462 | Ga0209565_100046227 | 229 |
| 455 | 3300025263 | Ga0209565_1001796 | Ga0209565_10017965 | 229 |
| 456 | 3300025273 | Ga0209673_1000008 | Ga0209673_1000008438 | 229 |
| 457 | 3300025273 | Ga0209673_1000681 | Ga0209673_100068112 | 229 |
| 458 | 3300025273 | Ga0209673_1028266 | Ga0209673_10282661 | 229 |
| 459 | 3300025284 | Ga0209130_1000216 | Ga0209130_100021665 | 229 |
| 460 | 3300025284 | Ga0209130_1000218 | Ga0209130_10002188 | 229 |
| 461 | 3300025284 | Ga0209130_1000269 | Ga0209130_10002695 | 229 |
| 462 | 3300025291 | Ga0209675_1000136 | Ga0209675_10001365 | 229 |
| 463 | 3300025291 | Ga0209675_1000673 | Ga0209675_100067323 | 229 |
| 464 | 3300025291 | Ga0209675_1002838 | Ga0209675_10028385 | 229 |
| 465 | 3300025292 | Ga0209676_1000007 | Ga0209676_100000747 | 229 |
| 466 | 3300025292 | Ga0209676_1002009 | Ga0209676_10020099 | 229 |
| 467 | 3300025292 | Ga0209676_1008703 | Ga0209676_10087034 | 229 |
| 468 | 3300025294 | Ga0209025_1000285 | Ga0209025_100028561 | 229 |
| 469 | 3300025294 | Ga0209025_1001205 | Ga0209025_100120511 | 229 |
| 470 | 3300025294 | Ga0209025_1003664 | Ga0209025_100366410 | 229 |
| 471 | 3300025294 | Ga0209025_1006058 | Ga0209025_10060587 | 229 |
| 472 | 3300025294 | Ga0209025_1011994 | Ga0209025_10119944 | 229 |
| 473 | 3300025294 | Ga0209025_1046211 | Ga0209025_10462112 | 229 |
| 474 | 3300025295 | Ga0209564_1000226 | Ga0209564_100022610 | 229 |
| 475 | 3300025295 | Ga0209564_1000443 | Ga0209564_100044360 | 229 |
| 476 | 3300025295 | Ga0209564_1002033 | Ga0209564_100203311 | 229 |
| 477 | 3300025295 | Ga0209564_1004696 | Ga0209564_10046965 | 229 |
| 478 | 3300025297 | Ga0209758_1000142 | Ga0209758_100014248 | 229 |
| 479 | 3300025297 | Ga0209758_1009291 | Ga0209758_10092915 | 229 |
| 480 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031461 | 229 |
| 481 | 3300025298 | Ga0209050_1002324 | Ga0209050_100232411 | 229 |
| 482 | 3300025298 | Ga0209050_1004327 | Ga0209050_10043275 | 229 |
| 483 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011463 | 229 |
| 484 | 3300025299 | Ga0209256_1000114 | Ga0209256_100011448 | 229 |
| 485 | 3300025302 | Ga0207426_1000117 | Ga0207426_100011720 | 229 |
| 486 | 3300025302 | Ga0207426_1000162 | Ga0207426_100016247 | 229 |
| 487 | 3300025302 | Ga0207426_1001659 | Ga0207426_100165916 | 229 |
| 488 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031461 | 229 |
| 489 | 3300025303 | Ga0209051_1000112 | Ga0209051_100011295 | 229 |
| 490 | 3300025303 | Ga0209051_1005424 | Ga0209051_10054242 | 229 |
| 491 | 3300025304 | Ga0209257_1000020 | Ga0209257_100002047 | 229 |
| 492 | 3300025304 | Ga0209257_1000290 | Ga0209257_100029042 | 229 |
| 493 | 3300025304 | Ga0209257_1003943 | Ga0209257_10039437 | 229 |
| 494 | 3300025304 | Ga0209257_1005848 | Ga0209257_10058488 | 229 |
| 495 | 3300025315 | Ga0207697_10042161 | Ga0207697_100421613 | 229 |
| 496 | 3300025321 | Ga0207656_10026641 | Ga0207656_100266412 | 229 |
| 497 | 3300025899 | Ga0207642_10272558 | Ga0207642_102725582 | 229 |
| 498 | 3300025904 | Ga0207647_10111140 | Ga0207647_101111402 | 229 |
| 499 | 3300025910 | Ga0207684_10041981 | Ga0207684_100419812 | 229 |
| 500 | 3300025910 | Ga0207684_10129711 | Ga0207684_101297112 | 229 |
| 501 | 3300025910 | Ga0207684_10285769 | Ga0207684_102857692 | 229 |
| 502 | 3300025913 | Ga0207695_10157766 | Ga0207695_101577662 | 229 |
| 503 | 3300025923 | Ga0207681_10015517 | Ga0207681_100155174 | 229 |
| 504 | 3300025924 | Ga0207694_10060771 | Ga0207694_100607713 | 229 |
| 505 | 3300025924 | Ga0207694_10288135 | Ga0207694_102881352 | 229 |
| 506 | 3300025926 | Ga0207659_10558599 | Ga0207659_105585992 | 229 |
| 507 | 3300025933 | Ga0207706_10010502 | Ga0207706_100105026 | 229 |
| 508 | 3300025933 | Ga0207706_10035248 | Ga0207706_100352482 | 229 |
| 509 | 3300025935 | Ga0207709_10003119 | Ga0207709_100031197 | 229 |
| 510 | 3300025935 | Ga0207709_10007578 | Ga0207709_100075786 | 229 |
| 511 | 3300025935 | Ga0207709_10025141 | Ga0207709_100251413 | 229 |
| 512 | 3300025935 | Ga0207709_10033920 | Ga0207709_100339202 | 229 |
| 513 | 3300025936 | Ga0207670_10001881 | Ga0207670_100018818 | 229 |
| 514 | 3300025936 | Ga0207670_10166726 | Ga0207670_101667262 | 229 |
| 515 | 3300025938 | Ga0207704_10114209 | Ga0207704_101142092 | 229 |
| 516 | 3300025940 | Ga0207691_10021260 | Ga0207691_100212603 | 229 |
| 517 | 3300025940 | Ga0207691_10039139 | Ga0207691_100391394 | 229 |
| 518 | 3300025942 | Ga0207689_10110651 | Ga0207689_101106513 | 229 |
| 519 | 3300025945 | Ga0207679_10224793 | Ga0207679_102247932 | 229 |
| 520 | 3300025945 | Ga0207679_10326337 | Ga0207679_103263372 | 229 |
| 521 | 3300025949 | Ga0207667_10072804 | Ga0207667_100728044 | 229 |
| 522 | 3300025960 | Ga0207651_10062152 | Ga0207651_100621523 | 229 |
| 523 | 3300025960 | Ga0207651_10151872 | Ga0207651_101518722 | 229 |
| 524 | 3300025960 | Ga0207651_10295395 | Ga0207651_102953952 | 229 |
| 525 | 3300025972 | Ga0207668_10116877 | Ga0207668_101168772 | 229 |
| 526 | 3300025981 | Ga0207640_10060057 | Ga0207640_100600572 | 229 |
| 527 | 3300025981 | Ga0207640_10210971 | Ga0207640_102109712 | 229 |
| 528 | 3300025986 | Ga0207658_10345273 | Ga0207658_103452732 | 229 |
| 529 | 3300025986 | Ga0207658_10432214 | Ga0207658_104322141 | 229 |
| 530 | 3300026023 | Ga0207677_10069488 | Ga0207677_100694883 | 229 |
| 531 | 3300026035 | Ga0207703_10287408 | Ga0207703_102874082 | 229 |
| 532 | 3300026041 | Ga0207639_10009374 | Ga0207639_100093745 | 229 |
| 533 | 3300026041 | Ga0207639_10436471 | Ga0207639_104364712 | 229 |
| 534 | 3300026075 | Ga0207708_10079713 | Ga0207708_100797133 | 229 |
| 535 | 3300026075 | Ga0207708_10542762 | Ga0207708_105427622 | 229 |
| 536 | 3300026078 | Ga0207702_10149432 | Ga0207702_101494322 | 229 |
| 537 | 3300026088 | Ga0207641_10209908 | Ga0207641_102099082 | 229 |
| 538 | 3300026088 | Ga0207641_10461748 | Ga0207641_104617482 | 229 |
| 539 | 3300026089 | Ga0207648_10000118 | Ga0207648_1000011849 | 229 |
| 540 | 3300026089 | Ga0207648_10025275 | Ga0207648_100252757 | 229 |
| 541 | 3300026089 | Ga0207648_10338590 | Ga0207648_103385902 | 229 |
| 542 | 3300026095 | Ga0207676_10030832 | Ga0207676_100308325 | 229 |
| 543 | 3300026095 | Ga0207676_10111168 | Ga0207676_101111682 | 229 |
| 544 | 3300026116 | Ga0207674_10004373 | Ga0207674_100043738 | 229 |
| 545 | 3300026118 | Ga0207675_100001909 | Ga0207675_10000190913 | 229 |
| 546 | 3300026118 | Ga0207675_100003206 | Ga0207675_1000032068 | 229 |
| 547 | 3300026118 | Ga0207675_100118645 | Ga0207675_1001186453 | 229 |
| 548 | 3300026118 | Ga0207675_100323945 | Ga0207675_1003239452 | 229 |
| 549 | 3300026121 | Ga0207683_10031188 | Ga0207683_100311885 | 229 |
| 550 | 3300026121 | Ga0207683_10098527 | Ga0207683_100985272 | 229 |
| 551 | 3300026121 | Ga0207683_10183076 | Ga0207683_101830762 | 229 |
| 552 | 3300026142 | Ga0207698_10014731 | Ga0207698_100147312 | 229 |
| 553 | 3300027866 | Ga0209813_10038861 | Ga0209813_100388612 | 229 |
| 554 | 3300027907 | Ga0207428_10001170 | Ga0207428_1000117026 | 229 |
| 555 | 3300027907 | Ga0207428_10201953 | Ga0207428_102019532 | 229 |
| 556 | 3300028379 | Ga0268266_10005779 | Ga0268266_100057795 | 229 |
| 557 | 3300028379 | Ga0268266_10040624 | Ga0268266_100406244 | 229 |
| 558 | 3300028380 | Ga0268265_10000211 | Ga0268265_1000021152 | 229 |
| 559 | 3300028380 | Ga0268265_10019102 | Ga0268265_100191025 | 229 |
| 560 | 3300028380 | Ga0268265_10129149 | Ga0268265_101291492 | 229 |
| 561 | 3300028381 | Ga0268264_10053673 | Ga0268264_100536735 | 229 |
| 562 | 3300028381 | Ga0268264_10270193 | Ga0268264_102701932 | 229 |
| 563 | 3300028786 | Ga0307517_10115800 | Ga0307517_101158003 | 229 |
| 564 | 3300028786 | Ga0307517_10340346 | Ga0307517_103403461 | 229 |
| 565 | 3300028794 | Ga0307515_10020040 | Ga0307515_100200403 | 229 |
| 566 | 3300028794 | Ga0307515_10025281 | Ga0307515_100252818 | 229 |
| 567 | 3300030731 | Ga0316177_1035019 | Ga0316177_10350192 | 229 |
| 568 | 3300030742 | Ga0316183_1052862 | Ga0316183_10528622 | 229 |
| 569 | 3300031456 | Ga0307513_10199121 | Ga0307513_101991212 | 229 |
| 570 | 3300031456 | Ga0307513_10223745 | Ga0307513_102237452 | 229 |
| 571 | 3300031507 | Ga0307509_10053248 | Ga0307509_100532483 | 229 |
| 572 | 3300031507 | Ga0307509_10129081 | Ga0307509_101290813 | 229 |
| 573 | 3300031548 | Ga0307408_100185844 | Ga0307408_1001858442 | 229 |
| 574 | 3300031616 | Ga0307508_10003935 | Ga0307508_100039358 | 229 |
| 575 | 3300031730 | Ga0307516_10195279 | Ga0307516_101952792 | 229 |
| 576 | 3300031730 | Ga0307516_10232181 | Ga0307516_102321812 | 229 |
| 577 | 3300031911 | Ga0307412_10301105 | Ga0307412_103011052 | 229 |
| 578 | 3300032002 | Ga0307416_100351469 | Ga0307416_1003514692 | 229 |
| 579 | 3300032004 | Ga0307414_10205839 | Ga0307414_102058392 | 229 |
| 580 | 3300033179 | Ga0307507_10027456 | Ga0307507_100274566 | 229 |
| 581 | 3300035115 | Ga0373941_0149261 | Ga0373941_0149261_55_789 | 229 |
| 582 | 3300035121 | Ga0373960_0122837 | Ga0373960_0122837_69_803 | 229 |
| 583 | 3300035241 | Ga0373961_0012887 | Ga0373961_0012887_585_1319 | 229 |
| 584 | 3300035691 | Ga0373931_0019924 | Ga0373931_0019924_2082_2819 | 229 |
| 585 | 3300037471 | Ga0395905_0201748 | Ga0395905_0201748_322_1059 | 229 |
| 586 | 3300045051 | Ga0451576_0024633 | Ga0451576_0024633_2318_3052 | 229 |
| 587 | 3300045051 | Ga0451576_0750886 | Ga0451576_0750886_280_1014 | 229 |
| 588 | 3300046460 | Ga0495638_0004001 | Ga0495638_0004001_3651_4385 | 229 |
| 589 | 3300046460 | Ga0495638_0018848 | Ga0495638_0018848_3309_3998 | 229 |
| 590 | 3300046512 | Ga0495610_0048720 | Ga0495610_0048720_757_1491 | 229 |
| 591 | 3300046513 | Ga0495616_0000903 | Ga0495616_0000903_9897_10586 | 229 |
| 592 | 3300046515 | Ga0495620_0059966 | Ga0495620_0059966_227_961 | 229 |
| 593 | 3300046515 | Ga0495620_0071235 | Ga0495620_0071235_262_951 | 229 |
| 594 | 3300046518 | Ga0495631_0000405 | Ga0495631_0000405_6190_6879 | 229 |
| 595 | 3300046519 | Ga0495632_0018997 | Ga0495632_0018997_2403_3137 | 229 |
| 596 | 3300046520 | Ga0495637_0006352 | Ga0495637_0006352_674_1363 | 229 |
| 597 | 3300046522 | Ga0495643_0082312 | Ga0495643_0082312_210_947 | 229 |
| 598 | 3300046530 | Ga0495654_0002419 | Ga0495654_0002419_8733_9422 | 229 |
| 599 | 3300046539 | Ga0495621_0000849 | Ga0495621_0000849_2420_3154 | 229 |
| 600 | 3300046539 | Ga0495621_0007576 | Ga0495621_0007576_1852_2541 | 229 |
| 601 | 3300046542 | Ga0495597_0009643 | Ga0495597_0009643_2550_3287 | 229 |
| 602 | 3300046615 | Ga0495656_0198836 | Ga0495656_0198836_191_925 | 229 |
| 603 | 3300046660 | Ga0495625_0025776 | Ga0495625_0025776_1750_2484 | 229 |
| 604 | 3300046684 | Ga0495669_0152867 | Ga0495669_0152867_187_879 | 229 |
| 605 | 3300046694 | Ga0495649_0015636 | Ga0495649_0015636_370_1104 | 229 |
| 606 | 3300046810 | Ga0495660_0033942 | Ga0495660_0033942_1177_1911 | 229 |
| 607 | 3300047321 | Ga0495676_0131003 | Ga0495676_0131003_515_1279 | 229 |
| 608 | 3300047443 | Ga0495687_000367 | Ga0495687_000367_28065_28802 | 229 |
| 609 | 3300047673 | Ga0495593_0026567 | Ga0495593_0026567_387_1151 | 229 |
| 610 | 3300048089 | Ga0495614_0061535 | Ga0495614_0061535_431_1195 | 229 |
| 611 | 3300048091 | Ga0495626_0037802 | Ga0495626_0037802_1087_1821 | 229 |
| 612 | 3300048913 | Ga0496110_0005495 | Ga0496110_0005495_946_1680 | 229 |
| 613 | 3300048913 | Ga0496110_0364409 | Ga0496110_0364409_68_802 | 229 |
| 614 | 3300048919 | Ga0496116_0006960 | Ga0496116_0006960_166_903 | 229 |
| 615 | 3300048920 | Ga0496117_0023345 | Ga0496117_0023345_280_1017 | 229 |
| 616 | 3300048921 | Ga0496118_0006317 | Ga0496118_0006317_10915_11652 | 229 |
| 617 | 3300048922 | Ga0496119_0040656 | Ga0496119_0040656_1530_2219 | 229 |
| 618 | 3300048924 | Ga0496121_0062431 | Ga0496121_0062431_341_1075 | 229 |
| 619 | 3300048924 | Ga0496121_0062648 | Ga0496121_0062648_2227_2916 | 229 |
| 620 | 3300048925 | Ga0496122_0260567 | Ga0496122_0260567_262_951 | 229 |
| 621 | 3300048926 | Ga0496123_0068013 | Ga0496123_0068013_315_1004 | 229 |
| 622 | 3300048927 | Ga0496124_0009873 | Ga0496124_0009873_3486_4223 | 229 |
| 623 | 3300048927 | Ga0496124_0161996 | Ga0496124_0161996_691_1380 | 229 |
| 624 | 3300048927 | Ga0496124_0350974 | Ga0496124_0350974_107_838 | 229 |
| 625 | 3300048928 | Ga0496125_0005801 | Ga0496125_0005801_5464_6201 | 229 |
| 626 | 3300048928 | Ga0496125_0067138 | Ga0496125_0067138_287_1018 | 229 |
| 627 | 3300049571 | Ga0501034_0238524 | Ga0501034_0238524_381_1115 | 229 |
| 628 | 3300049578 | Ga0501042_0374636 | Ga0501042_0374636_284_991 | 229 |
| 629 | 3300049585 | Ga0501069_0081778 | Ga0501069_0081778_137_871 | 229 |
| 630 | 3300049744 | Ga0501083_0381891 | Ga0501083_0381891_167_901 | 229 |
| 631 | 3300050489 | nmdc:mga03683_42303_c1 | nmdc:mga03683_42303_c1_717_1472 | 229 |
| 632 | 3300050489 | nmdc:mga03683_67770_c1 | nmdc:mga03683_67770_c1_711_1475 | 229 |
| 633 | 3300050490 | nmdc:mga03n38_114388_c1 | nmdc:mga03n38_114388_c1_447_1181 | 229 |
| 634 | 3300050490 | nmdc:mga03n38_116052_c1 | nmdc:mga03n38_116052_c1_432_1169 | 229 |
| 635 | 3300050490 | nmdc:mga03n38_60058_c1 | nmdc:mga03n38_60058_c1_587_1342 | 229 |
| 636 | 3300050491 | nmdc:mga00v17_15333_c1 | nmdc:mga00v17_15333_c1_2585_3319 | 229 |
| 637 | 3300050493 | nmdc:mga0k408_11238_c1 | nmdc:mga0k408_11238_c1_712_1446 | 229 |
| 638 | 3300050493 | nmdc:mga0k408_2439_c2 | nmdc:mga0k408_2439_c2_4328_5062 | 229 |
| 639 | 3300050493 | nmdc:mga0k408_275487_c1 | nmdc:mga0k408_275487_c1_85_840 | 229 |
| 640 | 3300050493 | nmdc:mga0k408_28428_c1 | nmdc:mga0k408_28428_c1_2385_3119 | 229 |
| 641 | 3300050493 | nmdc:mga0k408_313557_c1 | nmdc:mga0k408_313557_c1_48_785 | 229 |
| 642 | 3300050494 | nmdc:mga06z11_219155_c1 | nmdc:mga06z11_219155_c1_133_870 | 229 |
| 643 | 3300050494 | nmdc:mga06z11_74118_c1 | nmdc:mga06z11_74118_c1_863_1597 | 229 |
| 644 | 3300050495 | nmdc:mga04h51_139875_c1 | nmdc:mga04h51_139875_c1_52_795 | 229 |
| 645 | 3300050495 | nmdc:mga04h51_38788_c1 | nmdc:mga04h51_38788_c1_519_1253 | 229 |
| 646 | 3300050496 | nmdc:mga07m45_2098_c1 | nmdc:mga07m45_2098_c1_1053_1784 | 229 |
| 647 | 3300050496 | nmdc:mga07m45_210_c1 | nmdc:mga07m45_210_c1_20315_21049 | 229 |
| 648 | 3300050496 | nmdc:mga07m45_32993_c1 | nmdc:mga07m45_32993_c1_1241_2005 | 229 |
| 649 | 3300050496 | nmdc:mga07m45_46242_c1 | nmdc:mga07m45_46242_c1_1213_1956 | 229 |
| 650 | 3300050496 | nmdc:mga07m45_95836_c1 | nmdc:mga07m45_95836_c1_461_1192 | 229 |
| 651 | 3300050496 | nmdc:mga07m45_99617_c1 | nmdc:mga07m45_99617_c1_889_1623 | 229 |
| 652 | 3300050507 | nmdc:mga05p37_124482_c1 | nmdc:mga05p37_124482_c1_219_953 | 229 |
| 653 | 3300050508 | nmdc:mga09592_280536_c1 | nmdc:mga09592_280536_c1_434_1168 | 229 |
| 654 | 3300050509 | nmdc:mga0qj67_78225_c1 | nmdc:mga0qj67_78225_c1_991_1725 | 229 |
| 655 | 3300050510 | nmdc:mga06r32_344796_c1 | nmdc:mga06r32_344796_c1_718_1452 | 229 |
| 656 | 3300050511 | nmdc:mga08y16_12596_c1 | nmdc:mga08y16_12596_c1_5038_5772 | 229 |
| 657 | 3300050511 | nmdc:mga08y16_215271_c1 | nmdc:mga08y16_215271_c1_656_1390 | 229 |
| 658 | 3300050511 | nmdc:mga08y16_224500_c1 | nmdc:mga08y16_224500_c1_596_1330 | 229 |
| 659 | 3300050512 | nmdc:mga0n895_97541_c1 | nmdc:mga0n895_97541_c1_138_872 | 229 |
| 660 | 3300050515 | nmdc:mga0a205_5674_c1 | nmdc:mga0a205_5674_c1_4293_5027 | 229 |
| 661 | 3300053079 | Ga0500610_0040772 | Ga0500610_0040772_1188_1919 | 229 |
| 662 | 3300053086 | Ga0500578_0089688 | Ga0500578_0089688_1164_1898 | 229 |
| 663 | 3300053088 | Ga0500644_0001224 | Ga0500644_0001224_4158_4913 | 229 |
| 664 | 3300053093 | Ga0500651_0000217 | Ga0500651_0000217_29974_30738 | 229 |
| 665 | 3300053093 | Ga0500651_0173020 | Ga0500651_0173020_60_794 | 229 |
| 666 | 3300053094 | Ga0500566_0084204 | Ga0500566_0084204_983_1747 | 229 |
| 667 | 3300053110 | Ga0500571_002139 | Ga0500571_002139_2812_3576 | 229 |
| 668 | 3300053117 | Ga0500593_000770 | Ga0500593_000770_3338_4093 | 229 |
| 669 | 3300053118 | Ga0500594_0003486 | Ga0500594_0003486_115_804 | 229 |
| 670 | 3300053122 | Ga0500608_005510 | Ga0500608_005510_2678_3409 | 229 |
| 671 | 3300053128 | Ga0500626_002518 | Ga0500626_002518_1459_2148 | 229 |
| 672 | 3300053129 | Ga0500628_003253 | Ga0500628_003253_216_971 | 229 |
| 673 | 3300053130 | Ga0500642_0081137 | Ga0500642_0081137_218_952 | 229 |
| 674 | 3300053133 | Ga0500655_001011 | Ga0500655_001011_2799_3563 | 229 |
| 675 | 3300053134 | Ga0500658_0000686 | Ga0500658_0000686_4680_5369 | 229 |
| 676 | 3300053134 | Ga0500658_0000800 | Ga0500658_0000800_7659_8423 | 229 |
| 677 | 3300053134 | Ga0500658_0027843 | Ga0500658_0027843_1274_2020 | 229 |
| 678 | 3300053136 | Ga0500559_0014533 | Ga0500559_0014533_2533_3222 | 229 |
| 679 | 3300053138 | Ga0500564_016563 | Ga0500564_016563_721_1485 | 229 |
| 680 | 3300053139 | Ga0500568_0004042 | Ga0500568_0004042_5647_6336 | 229 |
| 681 | 3300053148 | Ga0500590_039194 | Ga0500590_039194_199_933 | 229 |
| 682 | 3300053153 | Ga0500616_0000030 | Ga0500616_0000030_141903_142637 | 229 |
| 683 | 3300053153 | Ga0500616_0227635 | Ga0500616_0227635_51_785 | 229 |
| 684 | 3300053162 | Ga0500638_036650 | Ga0500638_036650_539_1303 | 229 |
| 685 | iso_pu_bacteria | 2511231002 | 2511247321 | 229 |
| 686 | iso_pu_bacteria | 2513020051 | 2513229188 | 229 |
| 687 | iso_pu_bacteria | 2599185214 | 2599626812 | 229 |
| 688 | iso_pu_bacteria | 2599185226 | 2599676058 | 229 |
| 689 | iso_pu_bacteria | 2599185227 | 2599684349 | 229 |
| 690 | iso_pu_bacteria | 2599185229 | 2599696363 | 229 |
| 691 | iso_pu_bacteria | 2643221672 | 2644398137 | 229 |
| 692 | iso_pu_bacteria | 2818991446 | 2819601889 | 229 |
| 693 | iso_pu_bacteria | 2831265667 | 2831269470 | 229 |
| 694 | iso_pu_bacteria | 2838054893 | 2838060964 | 229 |
| 695 | iso_pu_bacteria | 2885198086 | 2885199946 | 229 |
| 696 | iso_pu_bacteria | 2885211737 | 2885213533 | 229 |
| 697 | iso_pu_bacteria | 2899924645 | 2899926473 | 229 |
| 698 | iso_pu_bacteria | 2928037797 | 2928039807 | 229 |
| 699 | iso_pu_bacteria | 2928044640 | 2928047444 | 229 |
| 700 | iso_pu_bacteria | 2928051484 | 2928058581 | 229 |
| 701 | iso_pu_bacteria | 2928064002 | 2928070383 | 229 |
| 702 | iso_pu_bacteria | 2928070936 | 2928072842 | 229 |
| 703 | iso_pu_bacteria | 2928084124 | 2928090547 | 229 |
| 704 | iso_pu_bacteria | 2954767861 | 2954769352 | 229 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d79-assembly1.cif.gz_B | structure of cysz, a sulfate permease from pseudomonas fragi | 0.4016 | 10 | 210 |
| 6d79-assembly1.cif.gz_B | structure of cysz, a sulfate permease from pseudomonas fragi | 0.3815 | 10 | 210 |
| 6d79-assembly1.cif.gz_A | structure of cysz, a sulfate permease from pseudomonas fragi | 0.317 | 10 | 191 |
| 7osf-assembly1.cif.gz_E | abc transporter complex nosdfyl, r-domain 1 | 0.2892 | 3 | 208 |
| 6d79-assembly1.cif.gz_A | structure of cysz, a sulfate permease from pseudomonas fragi | 0.285 | 10 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KKE2_86_367_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.471 | 34 | 207 | 1.50.40.10 |
| af_Q9XVL4_1_176_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4467 | 134 | 229 | 1.20.140.150 |
| af_I1KKE2_86_367_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.3747 | 34 | 207 | 1.50.40.10 |
| af_I1KMF2_37_348_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3697 | 4 | 227 | 1.20.1070.10 |
| af_I1KMF2_37_348_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3425 | 4 | 227 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2PDH1-F1-model_v4 | DUF4129 domain-containing protein | 0.9477 | 3 | 228 |
GO:0016020
|
| AF-A0A257CB62-F1-model_v4 | DUF4129 domain-containing protein | 0.9473 | 3 | 228 |
GO:0016020
|
| AF-A0A7C2PDH1-F1-model_v4 | DUF4129 domain-containing protein | 0.9318 | 3 | 228 |
GO:0016020
|
| AF-A0A536WSP7-F1-model_v4 | DUF4129 domain-containing protein | 0.9244 | 1 | 228 |
GO:0016020
|
| AF-A0A257CB62-F1-model_v4 | DUF4129 domain-containing protein | 0.9235 | 3 | 228 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar