F476357
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 399 | 700 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1037899|Ga0209025_10378992 |
| Length | 295 |
| Sequence | MTLPRRPLPFVLCSSNHGTMIVNYKDSRMVNATAGYGVGHQLLNNACFDPSEIDMVLQLLTARRRTAGDGVVALDCGANIGVHSIEWARHMHQWGRVLAFEAQERIYYALAGNIALNNCFNARAFHVALGERAGRLRIPQPDYNRSASFGSLELRRNSRTEYIGQNISYEDADCEQVDMMAIDDLCVEGMELDVLAGASRSIEKYKPLMLIEQIKVDSQRLQQWLKEKGYVVYPMGMNVLAIHPSDPVSTQLQVTPAQPRGPGLHPADGFVRRRPLNPGAPAQDAHSPVPRCEDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 5 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 6 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 7 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 9 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 11 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 13 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 14 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 15 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 16 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 17 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 22 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 23 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 24 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 25 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 277 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 280 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 384 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 385 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 390 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 398 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.4 |
| Nodule | 0.28 |
| Rhizoplane | 4.83 |
| Rhizosphere | 87.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_33951 | 2162886007 | Bacteria | 1922 |
| 2 | 2214828538 | 2209111006 | Bacteria | 9342 |
| 3 | ARcpr5oldR_c000313 | 3300000041 | Bacteria | 7024 |
| 4 | ARSoilYngRDRAFT_c00053 | 3300000042 | Bacteria | 18603 |
| 5 | ARcpr5yngRDRAFT_c000301 | 3300000043 | Bacteria | 6968 |
| 6 | ARSoilOldRDRAFT_c000153 | 3300000044 | Bacteria | 11685 |
| 7 | ARCol0oldRDRAFT_c00420 | 3300000045 | Bacteria | 4070 |
| 8 | ARCol0yngRDRAFT_1000331 | 3300000652 | Bacteria | 6976 |
| 9 | JGI24032J14994_100120 | 3300001430 | Bacteria | 3680 |
| 10 | JGI24741J21665_1003546 | 3300001915 | Bacteria | 3690 |
| 11 | JGI24752J21851_1002539 | 3300001976 | Bacteria | 2430 |
| 12 | JGI24746J21847_1000814 | 3300001977 | Bacteria | 4819 |
| 13 | JGI24747J21853_1009258 | 3300001978 | Bacteria | 971 |
| 14 | JGI24739J22299_10003550 | 3300001989 | Bacteria | 5961 |
| 15 | JGI24737J22298_10000601 | 3300001990 | Bacteria | 12667 |
| 16 | JGI24737J22298_10004158 | 3300001990 | Bacteria | 5058 |
| 17 | JGI24750J21931_1000123 | 3300002070 | Bacteria | 12402 |
| 18 | JGI24745J21846_1000297 | 3300002073 | Bacteria | 4247 |
| 19 | JGI24748J21848_1000892 | 3300002074 | Bacteria | 3232 |
| 20 | JGI24738J21930_10000038 | 3300002075 | Bacteria | 25424 |
| 21 | JGI24749J21850_1001514 | 3300002076 | Bacteria | 3286 |
| 22 | JGI24749J21850_1007311 | 3300002076 | Bacteria | 1539 |
| 23 | JGI24035J26624_1000111 | 3300002126 | Bacteria | 7064 |
| 24 | JGI24035J26624_1000136 | 3300002126 | Bacteria | 6497 |
| 25 | JGI24035J26624_1000723 | 3300002126 | Bacteria | 3091 |
| 26 | JGI24034J26672_10000166 | 3300002239 | Bacteria | 9279 |
| 27 | JGI24751J29686_10021534 | 3300002459 | Bacteria | 1336 |
| 28 | JGI25153J46596_10022247 | 3300003215 | Bacteria | 2343 |
| 29 | rootH2_10012201 | 3300003320 | Bacteria | 10572 |
| 30 | JGI25405J52794_10009992 | 3300003911 | Bacteria | 1801 |
| 31 | Ga0065716_1001869 | 3300005277 | Bacteria | 2953 |
| 32 | Ga0065704_10004708 | 3300005289 | Bacteria | 4266 |
| 33 | Ga0065712_10007259 | 3300005290 | Bacteria | 3518 |
| 34 | Ga0065712_10069569 | 3300005290 | Bacteria | 7041 |
| 35 | Ga0065712_10074939 | 3300005290 | Bacteria | 3975 |
| 36 | Ga0065715_10091436 | 3300005293 | Bacteria | 5771 |
| 37 | Ga0065707_10090977 | 3300005295 | Bacteria | 4028 |
| 38 | Ga0070676_10000799 | 3300005328 | Bacteria | 15558 |
| 39 | Ga0070683_100000121 | 3300005329 | Bacteria | 50845 |
| 40 | Ga0070683_100026074 | 3300005329 | Bacteria | 5257 |
| 41 | Ga0070683_100073252 | 3300005329 | Bacteria | 3198 |
| 42 | Ga0070683_100264664 | 3300005329 | Bacteria | 1636 |
| 43 | Ga0070690_100003148 | 3300005330 | Bacteria | 8985 |
| 44 | Ga0070690_100010712 | 3300005330 | Bacteria | 5345 |
| 45 | Ga0070670_100347819 | 3300005331 | Bacteria | 1302 |
| 46 | Ga0070677_10000173 | 3300005333 | Bacteria | 22439 |
| 47 | Ga0068869_100035313 | 3300005334 | Bacteria | 3542 |
| 48 | Ga0070666_10025730 | 3300005335 | Bacteria | 3839 |
| 49 | Ga0070680_100009394 | 3300005336 | Bacteria | 7513 |
| 50 | Ga0070680_100118497 | 3300005336 | Bacteria | 2208 |
| 51 | Ga0070680_100191574 | 3300005336 | Unclassified | 1723 |
| 52 | Ga0070680_100242891 | 3300005336 | Bacteria | 1522 |
| 53 | Ga0070680_100519650 | 3300005336 | Bacteria | 1019 |
| 54 | Ga0070682_100000657 | 3300005337 | Bacteria | 20972 |
| 55 | Ga0070682_100050171 | 3300005337 | Bacteria | 2604 |
| 56 | Ga0068868_100003270 | 3300005338 | Bacteria | 11282 |
| 57 | Ga0070660_100005245 | 3300005339 | Bacteria | 8959 |
| 58 | Ga0070660_100032617 | 3300005339 | Bacteria | 3920 |
| 59 | Ga0070689_100002414 | 3300005340 | Bacteria | 12212 |
| 60 | Ga0070691_10000646 | 3300005341 | Bacteria | 13462 |
| 61 | Ga0070661_100000532 | 3300005344 | Bacteria | 29218 |
| 62 | Ga0070661_100149064 | 3300005344 | Bacteria | 1767 |
| 63 | Ga0070661_100383775 | 3300005344 | Bacteria | 1108 |
| 64 | Ga0070692_10001016 | 3300005345 | Bacteria | 9656 |
| 65 | Ga0070692_10061433 | 3300005345 | Bacteria | 1980 |
| 66 | Ga0070668_100004720 | 3300005347 | Bacteria | 10102 |
| 67 | Ga0070668_100052767 | 3300005347 | Bacteria | 3135 |
| 68 | Ga0070669_100000271 | 3300005353 | Bacteria | 41957 |
| 69 | Ga0070669_100087105 | 3300005353 | Bacteria | 2334 |
| 70 | Ga0070675_100001127 | 3300005354 | Bacteria | 19307 |
| 71 | Ga0070671_100000771 | 3300005355 | Bacteria | 23007 |
| 72 | Ga0070674_100000116 | 3300005356 | Bacteria | 37121 |
| 73 | Ga0070673_100004024 | 3300005364 | Bacteria | 9255 |
| 74 | Ga0070673_100031056 | 3300005364 | Bacteria | 4006 |
| 75 | Ga0070688_100029442 | 3300005365 | Bacteria | 3288 |
| 76 | Ga0070659_100003582 | 3300005366 | Bacteria | 11048 |
| 77 | Ga0070667_100001755 | 3300005367 | Bacteria | 19329 |
| 78 | Ga0070703_10008628 | 3300005406 | Bacteria | 2868 |
| 79 | Ga0070709_10003284 | 3300005434 | Bacteria | 8697 |
| 80 | Ga0070709_10173471 | 3300005434 | Bacteria | 1509 |
| 81 | Ga0070709_10195621 | 3300005434 | Bacteria | 1429 |
| 82 | Ga0070714_100026630 | 3300005435 | Bacteria | 4781 |
| 83 | Ga0070714_100228408 | 3300005435 | Bacteria | 1713 |
| 84 | Ga0070713_100001721 | 3300005436 | Bacteria | 14092 |
| 85 | Ga0070713_100137115 | 3300005436 | Bacteria | 2163 |
| 86 | Ga0070710_10009699 | 3300005437 | Bacteria | 4716 |
| 87 | Ga0070710_10018284 | 3300005437 | Bacteria | 3604 |
| 88 | Ga0070701_10022765 | 3300005438 | Bacteria | 3008 |
| 89 | Ga0070711_100020384 | 3300005439 | Bacteria | 4272 |
| 90 | Ga0070711_100022380 | 3300005439 | Bacteria | 4096 |
| 91 | Ga0070711_100028549 | 3300005439 | Bacteria | 3672 |
| 92 | Ga0070705_100001685 | 3300005440 | Bacteria | 11573 |
| 93 | Ga0070700_100001234 | 3300005441 | Bacteria | 12671 |
| 94 | Ga0070700_100055522 | 3300005441 | Bacteria | 2479 |
| 95 | Ga0070694_100023465 | 3300005444 | Bacteria | 3968 |
| 96 | Ga0070708_100033540 | 3300005445 | Bacteria | 4461 |
| 97 | Ga0070708_100180278 | 3300005445 | Bacteria | 1974 |
| 98 | Ga0070663_100003065 | 3300005455 | Bacteria | 9554 |
| 99 | Ga0070663_100078045 | 3300005455 | Bacteria | 2426 |
| 100 | Ga0070678_100001829 | 3300005456 | Bacteria | 11472 |
| 101 | Ga0070662_100000164 | 3300005457 | Bacteria | 38586 |
| 102 | Ga0070662_100046957 | 3300005457 | Bacteria | 3104 |
| 103 | Ga0070681_10000701 | 3300005458 | Bacteria | 27812 |
| 104 | Ga0070681_10009919 | 3300005458 | Bacteria | 9386 |
| 105 | Ga0070681_10011117 | 3300005458 | Bacteria | 8910 |
| 106 | Ga0070681_10059021 | 3300005458 | Bacteria | 3816 |
| 107 | Ga0070681_10091277 | 3300005458 | Bacteria | 2996 |
| 108 | Ga0070681_10172203 | 3300005458 | Bacteria | 2087 |
| 109 | Ga0070681_10206772 | 3300005458 | Bacteria | 1880 |
| 110 | Ga0068867_100000082 | 3300005459 | Bacteria | 59236 |
| 111 | Ga0070685_10001328 | 3300005466 | Bacteria | 12994 |
| 112 | Ga0070707_100193337 | 3300005468 | Bacteria | 1984 |
| 113 | Ga0070699_100133337 | 3300005518 | Bacteria | 2190 |
| 114 | Ga0070679_100006574 | 3300005530 | Bacteria | 10830 |
| 115 | Ga0070679_100142030 | 3300005530 | Bacteria | 2380 |
| 116 | Ga0070679_100226764 | 3300005530 | Bacteria | 1828 |
| 117 | Ga0070684_100001318 | 3300005535 | Bacteria | 17770 |
| 118 | Ga0070684_100016560 | 3300005535 | Bacteria | 6028 |
| 119 | Ga0070684_100017018 | 3300005535 | Bacteria | 5958 |
| 120 | Ga0068853_100130587 | 3300005539 | Bacteria | 2248 |
| 121 | Ga0068853_100288262 | 3300005539 | Bacteria | 1515 |
| 122 | Ga0070672_100000255 | 3300005543 | Bacteria | 30160 |
| 123 | Ga0070686_100001726 | 3300005544 | Bacteria | 12212 |
| 124 | Ga0070686_100414207 | 3300005544 | Unclassified | 1028 |
| 125 | Ga0070695_100001928 | 3300005545 | Bacteria | 11747 |
| 126 | Ga0070695_100029212 | 3300005545 | Bacteria | 3424 |
| 127 | Ga0070696_100006308 | 3300005546 | Bacteria | 7940 |
| 128 | Ga0070696_100032178 | 3300005546 | Unclassified | 3598 |
| 129 | Ga0070696_100066329 | 3300005546 | Bacteria | 2531 |
| 130 | Ga0070693_100000112 | 3300005547 | Bacteria | 36249 |
| 131 | Ga0070693_100180122 | 3300005547 | Bacteria | 1360 |
| 132 | Ga0070704_100001489 | 3300005549 | Bacteria | 12586 |
| 133 | Ga0070704_100009285 | 3300005549 | Bacteria | 5933 |
| 134 | Ga0068855_100008692 | 3300005563 | Bacteria | 12277 |
| 135 | Ga0070664_100000373 | 3300005564 | Bacteria | 33223 |
| 136 | Ga0068857_100000603 | 3300005577 | Bacteria | 26431 |
| 137 | Ga0068857_100599543 | 3300005577 | Bacteria | 1041 |
| 138 | Ga0068854_100000140 | 3300005578 | Bacteria | 50187 |
| 139 | Ga0068856_100002491 | 3300005614 | Bacteria | 18952 |
| 140 | Ga0068856_100095310 | 3300005614 | Bacteria | 2964 |
| 141 | Ga0070702_100000220 | 3300005615 | Bacteria | 19201 |
| 142 | Ga0068859_100008360 | 3300005617 | Bacteria | 10488 |
| 143 | Ga0068864_100000477 | 3300005618 | Bacteria | 34661 |
| 144 | Ga0068866_10000658 | 3300005718 | Bacteria | 15718 |
| 145 | Ga0068861_100051959 | 3300005719 | Bacteria | 3113 |
| 146 | Ga0068861_100060572 | 3300005719 | Bacteria | 2901 |
| 147 | Ga0068870_10001108 | 3300005840 | Bacteria | 10725 |
| 148 | Ga0068863_100002673 | 3300005841 | Bacteria | 17620 |
| 149 | Ga0068858_100007716 | 3300005842 | Bacteria | 10388 |
| 150 | Ga0068858_100124306 | 3300005842 | Bacteria | 2415 |
| 151 | Ga0068860_100006849 | 3300005843 | Bacteria | 11427 |
| 152 | Ga0068860_100105673 | 3300005843 | Bacteria | 2689 |
| 153 | Ga0068862_100007893 | 3300005844 | Bacteria | 8808 |
| 154 | Ga0081455_10008902 | 3300005937 | Bacteria | 10380 |
| 155 | Ga0081455_10039366 | 3300005937 | Bacteria | 4178 |
| 156 | Ga0081540_1033505 | 3300005983 | Bacteria | 2788 |
| 157 | Ga0081540_1053606 | 3300005983 | Bacteria | 1977 |
| 158 | Ga0081540_1081415 | 3300005983 | Bacteria | 1456 |
| 159 | Ga0070717_10004642 | 3300006028 | Bacteria | 9960 |
| 160 | Ga0070717_10278863 | 3300006028 | Bacteria | 1482 |
| 161 | Ga0075432_10013533 | 3300006058 | Bacteria | 2772 |
| 162 | Ga0070715_10128967 | 3300006163 | Bacteria | 1215 |
| 163 | Ga0070716_100046342 | 3300006173 | Bacteria | 2446 |
| 164 | Ga0070716_100360750 | 3300006173 | Bacteria | 1032 |
| 165 | Ga0070712_100020552 | 3300006175 | Bacteria | 4321 |
| 166 | Ga0075367_10002122 | 3300006178 | Bacteria | 8920 |
| 167 | Ga0097621_100000083 | 3300006237 | Bacteria | 50576 |
| 168 | Ga0097621_100027474 | 3300006237 | Bacteria | 4475 |
| 169 | Ga0068871_100000067 | 3300006358 | Bacteria | 57681 |
| 170 | Ga0068871_100139170 | 3300006358 | Bacteria | 2063 |
| 171 | Ga0068871_100274802 | 3300006358 | Bacteria | 1472 |
| 172 | Ga0075433_10000023 | 3300006852 | Bacteria | 59195 |
| 173 | Ga0075433_10018499 | 3300006852 | Bacteria | 5794 |
| 174 | Ga0075434_100000980 | 3300006871 | Bacteria | 23061 |
| 175 | Ga0075434_100073196 | 3300006871 | Bacteria | 3419 |
| 176 | Ga0075434_100520564 | 3300006871 | Bacteria | 1210 |
| 177 | Ga0068865_100000622 | 3300006881 | Bacteria | 19947 |
| 178 | Ga0068865_100063289 | 3300006881 | Unclassified | 2600 |
| 179 | Ga0097620_100008360 | 3300006931 | Bacteria | 10488 |
| 180 | Ga0075435_100003962 | 3300007076 | Bacteria | 10121 |
| 181 | Ga0075435_100188240 | 3300007076 | Unclassified | 1746 |
| 182 | Ga0099794_10165543 | 3300007265 | Bacteria | 1126 |
| 183 | Ga0105240_10061993 | 3300009093 | Bacteria | 4657 |
| 184 | Ga0105240_10244116 | 3300009093 | Bacteria | 2080 |
| 185 | Ga0105240_10498577 | 3300009093 | Bacteria | 1354 |
| 186 | Ga0111539_10003501 | 3300009094 | Bacteria | 20704 |
| 187 | Ga0111539_10004884 | 3300009094 | Bacteria | 17454 |
| 188 | Ga0105245_10001233 | 3300009098 | Bacteria | 23079 |
| 189 | Ga0105245_10100285 | 3300009098 | Unclassified | 2678 |
| 190 | Ga0105245_10116944 | 3300009098 | Bacteria | 2486 |
| 191 | Ga0105247_10001479 | 3300009101 | Bacteria | 16887 |
| 192 | Ga0105247_10021338 | 3300009101 | Bacteria | 3897 |
| 193 | Ga0105243_10002805 | 3300009148 | Bacteria | 14474 |
| 194 | Ga0105241_10001174 | 3300009174 | Bacteria | 19962 |
| 195 | Ga0105241_10105061 | 3300009174 | Bacteria | 2252 |
| 196 | Ga0105242_10000036 | 3300009176 | Bacteria | 91470 |
| 197 | Ga0105248_10004963 | 3300009177 | Bacteria | 14701 |
| 198 | Ga0105248_10313680 | 3300009177 | Bacteria | 1766 |
| 199 | Ga0105237_10005966 | 3300009545 | Bacteria | 13649 |
| 200 | Ga0105237_10023052 | 3300009545 | Bacteria | 6383 |
| 201 | Ga0105237_10184641 | 3300009545 | Bacteria | 2085 |
| 202 | Ga0105237_10313821 | 3300009545 | Bacteria | 1571 |
| 203 | Ga0105238_10007520 | 3300009551 | Bacteria | 10911 |
| 204 | Ga0105238_10069804 | 3300009551 | Bacteria | 3514 |
| 205 | Ga0105238_10200201 | 3300009551 | Bacteria | 1972 |
| 206 | Ga0105238_10328367 | 3300009551 | Bacteria | 1516 |
| 207 | Ga0105249_10001279 | 3300009553 | Bacteria | 22069 |
| 208 | Ga0105249_10005862 | 3300009553 | Bacteria | 10631 |
| 209 | Ga0105239_10003292 | 3300010375 | Bacteria | 19914 |
| 210 | Ga0105239_10076051 | 3300010375 | Bacteria | 3692 |
| 211 | Ga0105239_10248049 | 3300010375 | Bacteria | 2000 |
| 212 | Ga0105239_10480449 | 3300010375 | Bacteria | 1411 |
| 213 | Ga0105246_10001244 | 3300011119 | Bacteria | 14952 |
| 214 | Ga0157371_10149528 | 3300013102 | Bacteria | 1665 |
| 215 | Ga0157371_10288013 | 3300013102 | Bacteria | 1187 |
| 216 | Ga0157370_10156759 | 3300013104 | Bacteria | 2118 |
| 217 | Ga0157370_10424110 | 3300013104 | Bacteria | 1224 |
| 218 | Ga0157369_10009653 | 3300013105 | Bacteria | 11037 |
| 219 | Ga0157369_10060341 | 3300013105 | Unclassified | 4090 |
| 220 | Ga0157369_10065485 | 3300013105 | Bacteria | 3911 |
| 221 | Ga0157369_10548649 | 3300013105 | Bacteria | 1195 |
| 222 | Ga0157374_10001349 | 3300013296 | Bacteria | 20893 |
| 223 | Ga0157374_10019654 | 3300013296 | Bacteria | 5981 |
| 224 | Ga0157374_10221977 | 3300013296 | Bacteria | 1854 |
| 225 | Ga0157378_10096701 | 3300013297 | Unclassified | 2691 |
| 226 | Ga0163162_10001803 | 3300013306 | Bacteria | 20099 |
| 227 | Ga0163162_10652453 | 3300013306 | Bacteria | 1176 |
| 228 | Ga0157372_10047696 | 3300013307 | Bacteria | 4761 |
| 229 | Ga0157372_10433353 | 3300013307 | Bacteria | 1532 |
| 230 | Ga0157372_10533040 | 3300013307 | Bacteria | 1369 |
| 231 | Ga0157375_10003554 | 3300013308 | Bacteria | 13528 |
| 232 | Ga0163163_10007224 | 3300014325 | Bacteria | 9788 |
| 233 | Ga0163163_10031750 | 3300014325 | Bacteria | 5099 |
| 234 | Ga0157380_10000141 | 3300014326 | Bacteria | 40564 |
| 235 | Ga0157377_10000124 | 3300014745 | Bacteria | 49953 |
| 236 | Ga0157379_10003074 | 3300014968 | Bacteria | 14113 |
| 237 | Ga0157379_10013614 | 3300014968 | Bacteria | 7127 |
| 238 | Ga0157379_10090019 | 3300014968 | Bacteria | 2753 |
| 239 | Ga0157376_10000115 | 3300014969 | Bacteria | 57170 |
| 240 | Ga0163161_10002816 | 3300017792 | Bacteria | 12338 |
| 241 | Ga0163161_10368356 | 3300017792 | Bacteria | 1146 |
| 242 | Ga0213876_10039373 | 3300021384 | Bacteria | 2497 |
| 243 | Ga0213876_10054784 | 3300021384 | Bacteria | 2105 |
| 244 | Ga0213876_10138633 | 3300021384 | Bacteria | 1294 |
| 245 | Ga0213875_10000067 | 3300021388 | Bacteria | 127481 |
| 246 | Ga0207425_1000690 | 3300025245 | Bacteria | 18329 |
| 247 | Ga0209565_1000331 | 3300025263 | Bacteria | 42154 |
| 248 | Ga0207666_1000192 | 3300025271 | Bacteria | 9174 |
| 249 | Ga0207673_1000006 | 3300025290 | Bacteria | 16960 |
| 250 | Ga0209675_1001925 | 3300025291 | Bacteria | 11209 |
| 251 | Ga0209025_1037899 | 3300025294 | Bacteria | 2130 |
| 252 | Ga0209758_1027845 | 3300025297 | Bacteria | 2406 |
| 253 | Ga0207697_10000039 | 3300025315 | Bacteria | 49235 |
| 254 | Ga0207697_10054462 | 3300025315 | Bacteria | 1657 |
| 255 | Ga0207653_10003137 | 3300025885 | Bacteria | 5230 |
| 256 | Ga0207682_10000135 | 3300025893 | Bacteria | 33308 |
| 257 | Ga0207642_10000274 | 3300025899 | Bacteria | 15439 |
| 258 | Ga0207710_10006877 | 3300025900 | Bacteria | 4841 |
| 259 | Ga0207688_10003046 | 3300025901 | Bacteria | 9135 |
| 260 | Ga0207688_10051095 | 3300025901 | Bacteria | 2315 |
| 261 | Ga0207680_10023583 | 3300025903 | Bacteria | 3363 |
| 262 | Ga0207647_10001409 | 3300025904 | Bacteria | 18461 |
| 263 | Ga0207647_10094134 | 3300025904 | Bacteria | 1785 |
| 264 | Ga0207699_10019208 | 3300025906 | Bacteria | 3639 |
| 265 | Ga0207699_10043403 | 3300025906 | Bacteria | 2611 |
| 266 | Ga0207699_10078439 | 3300025906 | Bacteria | 2040 |
| 267 | Ga0207699_10109785 | 3300025906 | Bacteria | 1766 |
| 268 | Ga0207645_10000114 | 3300025907 | Bacteria | 60880 |
| 269 | Ga0207643_10000134 | 3300025908 | Bacteria | 50474 |
| 270 | Ga0207654_10000402 | 3300025911 | Bacteria | 25192 |
| 271 | Ga0207654_10084407 | 3300025911 | Bacteria | 1920 |
| 272 | Ga0207654_10129390 | 3300025911 | Bacteria | 1596 |
| 273 | Ga0207707_10003615 | 3300025912 | Bacteria | 13709 |
| 274 | Ga0207707_10042718 | 3300025912 | Bacteria | 3955 |
| 275 | Ga0207707_10060913 | 3300025912 | Unclassified | 3283 |
| 276 | Ga0207707_10091837 | 3300025912 | Bacteria | 2653 |
| 277 | Ga0207707_10128549 | 3300025912 | Bacteria | 2215 |
| 278 | Ga0207707_10337276 | 3300025912 | Bacteria | 1300 |
| 279 | Ga0207695_10106617 | 3300025913 | Bacteria | 2788 |
| 280 | Ga0207695_10201890 | 3300025913 | Bacteria | 1902 |
| 281 | Ga0207695_10617462 | 3300025913 | Bacteria | 965 |
| 282 | Ga0207671_10014739 | 3300025914 | Bacteria | 6164 |
| 283 | Ga0207693_10017830 | 3300025915 | Bacteria | 5660 |
| 284 | Ga0207693_10019862 | 3300025915 | Bacteria | 5343 |
| 285 | Ga0207693_10029107 | 3300025915 | Bacteria | 4365 |
| 286 | Ga0207663_10019094 | 3300025916 | Bacteria | 3853 |
| 287 | Ga0207660_10000034 | 3300025917 | Bacteria | 65783 |
| 288 | Ga0207660_10006133 | 3300025917 | Bacteria | 7800 |
| 289 | Ga0207660_10180918 | 3300025917 | Bacteria | 1637 |
| 290 | Ga0207660_10221176 | 3300025917 | Bacteria | 1486 |
| 291 | Ga0207660_10484450 | 3300025917 | Bacteria | 1003 |
| 292 | Ga0207662_10002535 | 3300025918 | Bacteria | 9196 |
| 293 | Ga0207662_10020419 | 3300025918 | Bacteria | 3780 |
| 294 | Ga0207657_10000425 | 3300025919 | Bacteria | 44792 |
| 295 | Ga0207657_10039018 | 3300025919 | Bacteria | 4223 |
| 296 | Ga0207657_10092861 | 3300025919 | Bacteria | 2514 |
| 297 | Ga0207649_10000142 | 3300025920 | Bacteria | 60023 |
| 298 | Ga0207652_10001667 | 3300025921 | Bacteria | 19439 |
| 299 | Ga0207652_10079746 | 3300025921 | Bacteria | 2860 |
| 300 | Ga0207652_10097875 | 3300025921 | Bacteria | 2587 |
| 301 | Ga0207652_10132287 | 3300025921 | Unclassified | 2226 |
| 302 | Ga0207652_10428228 | 3300025921 | Bacteria | 1193 |
| 303 | Ga0207652_10726189 | 3300025921 | Bacteria | 885 |
| 304 | Ga0207681_10000065 | 3300025923 | Bacteria | 98832 |
| 305 | Ga0207694_10058086 | 3300025924 | Bacteria | 3009 |
| 306 | Ga0207694_10063171 | 3300025924 | Bacteria | 2884 |
| 307 | Ga0207694_10362989 | 3300025924 | Bacteria | 1200 |
| 308 | Ga0207650_10356289 | 3300025925 | Bacteria | 1205 |
| 309 | Ga0207659_10000078 | 3300025926 | Bacteria | 61403 |
| 310 | Ga0207687_10000125 | 3300025927 | Bacteria | 51567 |
| 311 | Ga0207700_10006043 | 3300025928 | Bacteria | 7289 |
| 312 | Ga0207700_10023777 | 3300025928 | Bacteria | 4232 |
| 313 | Ga0207700_10199301 | 3300025928 | Bacteria | 1686 |
| 314 | Ga0207700_10208378 | 3300025928 | Bacteria | 1651 |
| 315 | Ga0207700_10621161 | 3300025928 | Unclassified | 962 |
| 316 | Ga0207664_10032469 | 3300025929 | Bacteria | 4001 |
| 317 | Ga0207664_10132715 | 3300025929 | Bacteria | 2098 |
| 318 | Ga0207644_10003174 | 3300025931 | Bacteria | 10575 |
| 319 | Ga0207690_10000200 | 3300025932 | Bacteria | 46868 |
| 320 | Ga0207706_10000435 | 3300025933 | Bacteria | 44792 |
| 321 | Ga0207706_10032289 | 3300025933 | Bacteria | 4662 |
| 322 | Ga0207706_10123127 | 3300025933 | Bacteria | 2281 |
| 323 | Ga0207686_10000251 | 3300025934 | Bacteria | 40894 |
| 324 | Ga0207686_10003168 | 3300025934 | Bacteria | 8855 |
| 325 | Ga0207709_10000183 | 3300025935 | Bacteria | 83374 |
| 326 | Ga0207670_10001020 | 3300025936 | Bacteria | 14811 |
| 327 | Ga0207669_10000081 | 3300025937 | Bacteria | 48214 |
| 328 | Ga0207704_10000419 | 3300025938 | Bacteria | 19146 |
| 329 | Ga0207704_10044669 | 3300025938 | Bacteria | 2626 |
| 330 | Ga0207665_10025889 | 3300025939 | Bacteria | 3870 |
| 331 | Ga0207665_10067630 | 3300025939 | Bacteria | 2433 |
| 332 | Ga0207665_10321244 | 3300025939 | Bacteria | 1162 |
| 333 | Ga0207691_10002274 | 3300025940 | Bacteria | 18817 |
| 334 | Ga0207691_10188363 | 3300025940 | Bacteria | 1801 |
| 335 | Ga0207711_10000766 | 3300025941 | Bacteria | 31591 |
| 336 | Ga0207711_10496167 | 3300025941 | Bacteria | 1138 |
| 337 | Ga0207689_10000144 | 3300025942 | Bacteria | 61402 |
| 338 | Ga0207661_10000670 | 3300025944 | Bacteria | 22177 |
| 339 | Ga0207661_10002727 | 3300025944 | Bacteria | 12148 |
| 340 | Ga0207661_10017615 | 3300025944 | Bacteria | 5291 |
| 341 | Ga0207661_10341515 | 3300025944 | Bacteria | 1349 |
| 342 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 343 | Ga0207667_10011544 | 3300025949 | Bacteria | 10261 |
| 344 | Ga0207667_10141119 | 3300025949 | Bacteria | 2480 |
| 345 | Ga0207667_10603608 | 3300025949 | Bacteria | 1107 |
| 346 | Ga0207651_10001490 | 3300025960 | Bacteria | 10656 |
| 347 | Ga0207712_10001565 | 3300025961 | Bacteria | 15403 |
| 348 | Ga0207712_10025428 | 3300025961 | Bacteria | 3934 |
| 349 | Ga0207668_10000162 | 3300025972 | Bacteria | 46411 |
| 350 | Ga0207668_10006356 | 3300025972 | Bacteria | 6987 |
| 351 | Ga0207640_10001145 | 3300025981 | Bacteria | 14558 |
| 352 | Ga0207640_10079881 | 3300025981 | Bacteria | 2231 |
| 353 | Ga0207658_10001102 | 3300025986 | Bacteria | 21774 |
| 354 | Ga0207658_10048410 | 3300025986 | Bacteria | 3117 |
| 355 | Ga0207677_10673376 | 3300026023 | Bacteria | 915 |
| 356 | Ga0207703_10006015 | 3300026035 | Bacteria | 9713 |
| 357 | Ga0207703_10331462 | 3300026035 | Bacteria | 1396 |
| 358 | Ga0207639_10002011 | 3300026041 | Bacteria | 13697 |
| 359 | Ga0207639_10047217 | 3300026041 | Bacteria | 3253 |
| 360 | Ga0207639_10074311 | 3300026041 | Bacteria | 2669 |
| 361 | Ga0207639_10387055 | 3300026041 | Bacteria | 1257 |
| 362 | Ga0207678_10000344 | 3300026067 | Bacteria | 42040 |
| 363 | Ga0207678_10043627 | 3300026067 | Bacteria | 3880 |
| 364 | Ga0207678_10426963 | 3300026067 | Bacteria | 1150 |
| 365 | Ga0207708_10004403 | 3300026075 | Bacteria | 10377 |
| 366 | Ga0207708_10176850 | 3300026075 | Bacteria | 1693 |
| 367 | Ga0207708_10181252 | 3300026075 | Bacteria | 1672 |
| 368 | Ga0207702_10003261 | 3300026078 | Bacteria | 14986 |
| 369 | Ga0207702_10093318 | 3300026078 | Bacteria | 2640 |
| 370 | Ga0207702_10373027 | 3300026078 | Unclassified | 1370 |
| 371 | Ga0207641_10000941 | 3300026088 | Bacteria | 30006 |
| 372 | Ga0207648_10009121 | 3300026089 | Bacteria | 9534 |
| 373 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 374 | Ga0207674_10000323 | 3300026116 | Bacteria | 61026 |
| 375 | Ga0207674_10022025 | 3300026116 | Bacteria | 6853 |
| 376 | Ga0207675_100000270 | 3300026118 | Bacteria | 49235 |
| 377 | Ga0207675_100072520 | 3300026118 | Bacteria | 3221 |
| 378 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 379 | Ga0207683_10016464 | 3300026121 | Bacteria | 6293 |
| 380 | Ga0207683_10654965 | 3300026121 | Bacteria | 973 |
| 381 | Ga0209968_1007176 | 3300027526 | Bacteria | 1684 |
| 382 | Ga0210002_1000408 | 3300027617 | Bacteria | 5861 |
| 383 | Ga0209971_1004232 | 3300027682 | Bacteria | 3405 |
| 384 | Ga0209971_1005256 | 3300027682 | Bacteria | 3076 |
| 385 | Ga0209971_1015152 | 3300027682 | Bacteria | 1827 |
| 386 | Ga0209998_10015227 | 3300027717 | Bacteria | 1608 |
| 387 | Ga0209974_10000966 | 3300027876 | Bacteria | 10083 |
| 388 | Ga0209974_10036917 | 3300027876 | Bacteria | 1623 |
| 389 | Ga0207428_10000292 | 3300027907 | Bacteria | 67070 |
| 390 | Ga0207428_10001579 | 3300027907 | Bacteria | 23723 |
| 391 | Ga0207428_10003547 | 3300027907 | Bacteria | 15076 |
| 392 | Ga0268266_10036702 | 3300028379 | Bacteria | 4174 |
| 393 | Ga0268265_10001049 | 3300028380 | Bacteria | 24845 |
| 394 | Ga0268265_10042149 | 3300028380 | Bacteria | 3384 |
| 395 | Ga0268264_10000583 | 3300028381 | Bacteria | 44280 |
| 396 | Ga0268264_10062581 | 3300028381 | Bacteria | 3125 |
| 397 | Ga0265323_10002189 | 3300028653 | Bacteria | 9111 |
| 398 | Ga0265322_10029696 | 3300028654 | Bacteria | 1562 |
| 399 | Ga0265336_10006616 | 3300028666 | Bacteria | 4163 |
| 400 | Ga0265338_10013740 | 3300028800 | Bacteria | 9104 |
| 401 | Ga0265338_10083353 | 3300028800 | Bacteria | 2674 |
| 402 | Ga0265328_10012438 | 3300031239 | Bacteria | 3386 |
| 403 | Ga0265339_10000068 | 3300031249 | Bacteria | 91555 |
| 404 | Ga0265339_10001392 | 3300031249 | Bacteria | 18003 |
| 405 | Ga0265331_10046882 | 3300031250 | Bacteria | 2082 |
| 406 | Ga0265327_10000233 | 3300031251 | Bacteria | 112052 |
| 407 | Ga0265327_10001600 | 3300031251 | Bacteria | 27530 |
| 408 | Ga0265316_10000190 | 3300031344 | Bacteria | 71043 |
| 409 | Ga0265316_10146049 | 3300031344 | Bacteria | 1774 |
| 410 | Ga0265313_10000088 | 3300031595 | Bacteria | 90711 |
| 411 | Ga0265314_10004951 | 3300031711 | Bacteria | 12152 |
| 412 | Ga0315911_1000015 | 3300033442 | Bacteria | 185247 |
| 413 | Ga0373930_0000021 | 3300034816 | Bacteria | 15168 |
| 414 | Ga0373948_0010220 | 3300034817 | Bacteria | 1634 |
| 415 | Ga0373950_0000378 | 3300034818 | Bacteria | 5510 |
| 416 | Ga0373958_0001112 | 3300034819 | Bacteria | 3556 |
| 417 | Ga0373958_0002233 | 3300034819 | Bacteria | 2693 |
| 418 | Ga0373959_0000359 | 3300034820 | Bacteria | 9138 |
| 419 | Ga0373938_0000071 | 3300034957 | Bacteria | 13485 |
| 420 | Ga0373938_0008054 | 3300034957 | Bacteria | 1873 |
| 421 | Ga0373928_0000327 | 3300035084 | Bacteria | 9510 |
| 422 | Ga0373929_0000383 | 3300035085 | Bacteria | 8309 |
| 423 | Ga0373929_0012950 | 3300035085 | Bacteria | 1591 |
| 424 | Ga0373929_0014921 | 3300035085 | Bacteria | 1506 |
| 425 | Ga0373934_0003749 | 3300035086 | Bacteria | 5592 |
| 426 | Ga0373944_0031713 | 3300035089 | Bacteria | 1592 |
| 427 | Ga0373949_0001992 | 3300035090 | Bacteria | 5459 |
| 428 | Ga0373949_0005070 | 3300035090 | Bacteria | 2964 |
| 429 | Ga0373951_0000680 | 3300035091 | Bacteria | 9359 |
| 430 | Ga0373951_0016149 | 3300035091 | Bacteria | 1683 |
| 431 | Ga0373952_0000018 | 3300035092 | Bacteria | 20077 |
| 432 | Ga0373952_0001492 | 3300035092 | Bacteria | 4254 |
| 433 | Ga0373923_0004717 | 3300035111 | Bacteria | 4551 |
| 434 | Ga0373923_0012189 | 3300035111 | Bacteria | 3171 |
| 435 | Ga0373923_0015440 | 3300035111 | Bacteria | 2884 |
| 436 | Ga0373932_0001209 | 3300035112 | Bacteria | 7344 |
| 437 | Ga0373932_0007755 | 3300035112 | Bacteria | 2561 |
| 438 | Ga0373936_0010672 | 3300035113 | Bacteria | 3467 |
| 439 | Ga0373939_0000588 | 3300035114 | Bacteria | 9059 |
| 440 | Ga0373939_0037201 | 3300035114 | Bacteria | 1444 |
| 441 | Ga0373939_0049723 | 3300035114 | Bacteria | 1297 |
| 442 | Ga0373941_0010419 | 3300035115 | Bacteria | 2374 |
| 443 | Ga0373953_0243817 | 3300035117 | Bacteria | 780 |
| 444 | Ga0373954_0001346 | 3300035118 | Bacteria | 9907 |
| 445 | Ga0373954_0002846 | 3300035118 | Bacteria | 7291 |
| 446 | Ga0373954_0034334 | 3300035118 | Bacteria | 2349 |
| 447 | Ga0373956_0024985 | 3300035119 | Bacteria | 2579 |
| 448 | Ga0373957_0015792 | 3300035120 | Bacteria | 2604 |
| 449 | Ga0373957_0020186 | 3300035120 | Bacteria | 2352 |
| 450 | Ga0373960_0003427 | 3300035121 | Bacteria | 3589 |
| 451 | Ga0373960_0008483 | 3300035121 | Bacteria | 2463 |
| 452 | Ga0373943_0003447 | 3300035170 | Bacteria | 7195 |
| 453 | Ga0373946_0003623 | 3300035171 | Bacteria | 5472 |
| 454 | Ga0373946_0209724 | 3300035171 | Bacteria | 936 |
| 455 | Ga0373955_0001882 | 3300035172 | Bacteria | 9051 |
| 456 | Ga0373955_0018510 | 3300035172 | Bacteria | 3465 |
| 457 | Ga0373942_0005273 | 3300035207 | Bacteria | 2995 |
| 458 | Ga0373942_0008670 | 3300035207 | Bacteria | 2373 |
| 459 | Ga0373961_0002538 | 3300035241 | Bacteria | 4707 |
| 460 | Ga0373961_0003990 | 3300035241 | Bacteria | 3596 |
| 461 | Ga0373962_0000206 | 3300035242 | Bacteria | 12480 |
| 462 | Ga0373924_0023344 | 3300035410 | Bacteria | 2425 |
| 463 | Ga0373931_0000393 | 3300035691 | Bacteria | 17943 |
| 464 | Ga0373931_0000727 | 3300035691 | Bacteria | 13705 |
| 465 | Ga0373935_0044689 | 3300035692 | Bacteria | 2793 |
| 466 | Ga0373933_0000405 | 3300035724 | Bacteria | 27323 |
| 467 | Ga0373933_0002769 | 3300035724 | Bacteria | 9781 |
| 468 | Ga0373933_0011966 | 3300035724 | Bacteria | 4791 |
| 469 | Ga0373933_0029430 | 3300035724 | Bacteria | 3176 |
| 470 | Ga0373947_0195164 | 3300035725 | Bacteria | 1322 |
| 471 | Ga0373937_0006739 | 3300036401 | Bacteria | 9910 |
| 472 | Ga0373937_0011730 | 3300036401 | Bacteria | 7686 |
| 473 | Ga0373937_0576359 | 3300036401 | Bacteria | 1069 |
| 474 | Ga0373925_0013964 | 3300037068 | Bacteria | 5813 |
| 475 | Ga0373925_0134612 | 3300037068 | Bacteria | 1930 |
| 476 | Ga0373925_0330099 | 3300037068 | Unclassified | 1235 |
| 477 | Ga0373925_0492587 | 3300037068 | Bacteria | 1006 |
| 478 | Ga0395898_0029983 | 3300037466 | Bacteria | 5446 |
| 479 | Ga0395898_0034323 | 3300037466 | Bacteria | 5057 |
| 480 | Ga0395898_0092017 | 3300037466 | Bacteria | 2917 |
| 481 | Ga0436364_0231307 | 3300037853 | Bacteria | 2228 |
| 482 | Ga0436364_0367201 | 3300037853 | Bacteria | 32911 |
| 483 | Ga0395901_0114157 | 3300038443 | Bacteria | 2837 |
| 484 | Ga0395901_0453083 | 3300038443 | Bacteria | 1312 |
| 485 | Ga0400486_17854 | 3300038742 | Unclassified | 2380 |
| 486 | Ga0242420_002702 | 3300038996 | Bacteria | 2560 |
| 487 | Ga0436365_0096100 | 3300039437 | Bacteria | 2993 |
| 488 | Ga0436365_0310774 | 3300039437 | Bacteria | 2596 |
| 489 | Ga0436365_1135249 | 3300039437 | Bacteria | 2983 |
| 490 | Ga0436365_1717019 | 3300039437 | Bacteria | 1975 |
| 491 | Ga0439463_026509 | 3300042016 | Bacteria | 1456 |
| 492 | Ga0439464_0008938 | 3300042439 | Bacteria | 2628 |
| 493 | Ga0451577_0150468 | 3300042876 | Bacteria | 2094 |
| 494 | Ga0466961_0135066 | 3300044693 | Bacteria | 1545 |
| 495 | Ga0466963_0074625 | 3300044694 | Bacteria | 2288 |
| 496 | Ga0466963_0146379 | 3300044694 | Bacteria | 1639 |
| 497 | Ga0466964_0020698 | 3300044706 | Bacteria | 2536 |
| 498 | Ga0453684_0297295 | 3300044712 | Bacteria | 1836 |
| 499 | Ga0466968_0120191 | 3300044735 | Bacteria | 1188 |
| 500 | Ga0466957_0254349 | 3300044842 | Bacteria | 1169 |
| 501 | Ga0466959_0068328 | 3300045049 | Bacteria | 2575 |
| 502 | Ga0466959_0285310 | 3300045049 | Bacteria | 1132 |
| 503 | Ga0466959_0311031 | 3300045049 | Bacteria | 1078 |
| 504 | Ga0466958_0000026 | 3300045836 | Bacteria | 42258 |
| 505 | Ga0466958_0107111 | 3300045836 | Bacteria | 1743 |
| 506 | Ga0466967_0253595 | 3300045976 | Bacteria | 1681 |
| 507 | Ga0495592_0018264 | 3300046454 | Bacteria | 5330 |
| 508 | Ga0495592_0024446 | 3300046454 | Bacteria | 4593 |
| 509 | Ga0495592_0037236 | 3300046454 | Bacteria | 3663 |
| 510 | Ga0495603_0030221 | 3300046455 | Bacteria | 3264 |
| 511 | Ga0495603_0119075 | 3300046455 | Bacteria | 1539 |
| 512 | Ga0495629_0028631 | 3300046459 | Bacteria | 3954 |
| 513 | Ga0495638_0024123 | 3300046460 | Bacteria | 3970 |
| 514 | Ga0495641_0040792 | 3300046461 | Bacteria | 2158 |
| 515 | Ga0495641_0165525 | 3300046461 | Bacteria | 989 |
| 516 | Ga0495651_0010810 | 3300046462 | Bacteria | 7017 |
| 517 | Ga0495651_0141818 | 3300046462 | Bacteria | 1742 |
| 518 | Ga0495653_0012969 | 3300046463 | Bacteria | 6800 |
| 519 | Ga0495580_0059778 | 3300046472 | Bacteria | 2678 |
| 520 | Ga0495582_0273918 | 3300046473 | Unclassified | 969 |
| 521 | Ga0495639_0177395 | 3300046475 | Bacteria | 1036 |
| 522 | Ga0495662_0021827 | 3300046476 | Bacteria | 3094 |
| 523 | Ga0495662_0040419 | 3300046476 | Bacteria | 2252 |
| 524 | Ga0495662_0075736 | 3300046476 | Bacteria | 1633 |
| 525 | Ga0495664_0003198 | 3300046477 | Bacteria | 8892 |
| 526 | Ga0495664_0006628 | 3300046477 | Bacteria | 6403 |
| 527 | Ga0495664_0028886 | 3300046477 | Bacteria | 3240 |
| 528 | Ga0495664_0032449 | 3300046477 | Bacteria | 3064 |
| 529 | Ga0495584_0044146 | 3300046491 | Bacteria | 2250 |
| 530 | Ga0495594_0025442 | 3300046499 | Bacteria | 3182 |
| 531 | Ga0495608_0028120 | 3300046511 | Bacteria | 3822 |
| 532 | Ga0495608_0069865 | 3300046511 | Bacteria | 2293 |
| 533 | Ga0495618_0002331 | 3300046514 | Bacteria | 12273 |
| 534 | Ga0495618_0023163 | 3300046514 | Bacteria | 3838 |
| 535 | Ga0495628_0007123 | 3300046516 | Bacteria | 9685 |
| 536 | Ga0495628_0064633 | 3300046516 | Unclassified | 2864 |
| 537 | Ga0495628_0221425 | 3300046516 | Bacteria | 1421 |
| 538 | Ga0495628_0335647 | 3300046516 | Unclassified | 1113 |
| 539 | Ga0495628_0346195 | 3300046516 | Bacteria | 1093 |
| 540 | Ga0495630_0045284 | 3300046517 | Bacteria | 3287 |
| 541 | Ga0495630_0512095 | 3300046517 | Bacteria | 920 |
| 542 | Ga0495666_0087148 | 3300046526 | Unclassified | 1475 |
| 543 | Ga0495652_0048649 | 3300046529 | Bacteria | 3631 |
| 544 | Ga0495652_0205849 | 3300046529 | Bacteria | 1490 |
| 545 | Ga0495640_0008129 | 3300046533 | Bacteria | 8236 |
| 546 | Ga0495640_0030630 | 3300046533 | Bacteria | 3850 |
| 547 | Ga0495586_0037195 | 3300046535 | Bacteria | 2612 |
| 548 | Ga0495587_0001044 | 3300046536 | Bacteria | 18250 |
| 549 | Ga0495587_0104944 | 3300046536 | Bacteria | 1626 |
| 550 | Ga0495587_0197184 | 3300046536 | Bacteria | 1139 |
| 551 | Ga0495645_0001990 | 3300046543 | Bacteria | 13887 |
| 552 | Ga0495645_0052865 | 3300046543 | Bacteria | 2954 |
| 553 | Ga0495645_0097372 | 3300046543 | Bacteria | 2095 |
| 554 | Ga0495667_0004872 | 3300046559 | Bacteria | 9072 |
| 555 | Ga0495634_0008812 | 3300046642 | Bacteria | 7481 |
| 556 | Ga0495634_0015598 | 3300046642 | Bacteria | 5453 |
| 557 | Ga0495635_0009828 | 3300046663 | Bacteria | 6689 |
| 558 | Ga0495635_0040935 | 3300046663 | Bacteria | 3201 |
| 559 | Ga0495635_0135102 | 3300046663 | Bacteria | 1681 |
| 560 | Ga0495657_0002213 | 3300046675 | Bacteria | 16467 |
| 561 | Ga0495657_0242929 | 3300046675 | Bacteria | 1086 |
| 562 | Ga0495599_0001186 | 3300046678 | Bacteria | 14781 |
| 563 | Ga0495599_0007597 | 3300046678 | Bacteria | 6583 |
| 564 | Ga0495599_0298579 | 3300046678 | Bacteria | 973 |
| 565 | Ga0495623_0003875 | 3300046679 | Bacteria | 9863 |
| 566 | Ga0495623_0283695 | 3300046679 | Bacteria | 920 |
| 567 | Ga0495646_0003107 | 3300046680 | Bacteria | 10308 |
| 568 | Ga0495647_0016764 | 3300046681 | Bacteria | 2585 |
| 569 | Ga0495647_0104926 | 3300046681 | Bacteria | 1173 |
| 570 | Ga0495658_0008269 | 3300046683 | Bacteria | 5153 |
| 571 | Ga0495658_0032919 | 3300046683 | Bacteria | 2834 |
| 572 | Ga0495669_0065482 | 3300046684 | Bacteria | 1650 |
| 573 | Ga0495613_0068219 | 3300046689 | Bacteria | 2594 |
| 574 | Ga0495624_0028545 | 3300046690 | Bacteria | 3645 |
| 575 | Ga0495624_0116432 | 3300046690 | Bacteria | 1642 |
| 576 | Ga0495671_0050157 | 3300046692 | Bacteria | 2079 |
| 577 | Ga0495600_0002653 | 3300046809 | Bacteria | 10334 |
| 578 | Ga0495581_0006737 | 3300047315 | Bacteria | 6661 |
| 579 | Ga0495581_0103529 | 3300047315 | Bacteria | 1654 |
| 580 | Ga0495604_0001816 | 3300047317 | Bacteria | 17374 |
| 581 | Ga0495604_0155295 | 3300047317 | Bacteria | 1622 |
| 582 | Ga0495674_0010890 | 3300047319 | Bacteria | 8597 |
| 583 | Ga0495674_0023062 | 3300047319 | Bacteria | 5735 |
| 584 | Ga0495674_0033682 | 3300047319 | Bacteria | 4638 |
| 585 | Ga0495674_0504966 | 3300047319 | Bacteria | 967 |
| 586 | Ga0495676_0179382 | 3300047321 | Bacteria | 1485 |
| 587 | Ga0495680_0003209 | 3300047322 | Bacteria | 16267 |
| 588 | Ga0495680_0034028 | 3300047322 | Bacteria | 4122 |
| 589 | Ga0495680_0385501 | 3300047322 | Bacteria | 970 |
| 590 | Ga0495675_0024808 | 3300047444 | Bacteria | 3824 |
| 591 | Ga0495675_0039625 | 3300047444 | Bacteria | 3001 |
| 592 | Ga0495684_0009235 | 3300047471 | Bacteria | 7614 |
| 593 | Ga0495684_0009698 | 3300047471 | Bacteria | 7428 |
| 594 | Ga0495593_0042607 | 3300047673 | Bacteria | 2436 |
| 595 | Ga0495593_0070075 | 3300047673 | Bacteria | 1822 |
| 596 | Ga0495593_0141805 | 3300047673 | Bacteria | 1217 |
| 597 | Ga0495602_0004062 | 3300048088 | Bacteria | 15240 |
| 598 | Ga0495602_0184909 | 3300048088 | Bacteria | 1603 |
| 599 | Ga0495602_0505145 | 3300048088 | Bacteria | 844 |
| 600 | Ga0496100_0000172 | 3300048903 | Bacteria | 35873 |
| 601 | Ga0496101_0000406 | 3300048904 | Bacteria | 27974 |
| 602 | Ga0496101_0077212 | 3300048904 | Bacteria | 2454 |
| 603 | Ga0496102_0006743 | 3300048905 | Bacteria | 9804 |
| 604 | Ga0496102_0157367 | 3300048905 | Bacteria | 2136 |
| 605 | Ga0496103_0002977 | 3300048906 | Bacteria | 10492 |
| 606 | Ga0496104_0115052 | 3300048907 | Bacteria | 2581 |
| 607 | Ga0496105_0260008 | 3300048908 | Unclassified | 1404 |
| 608 | Ga0496106_0005006 | 3300048909 | Bacteria | 9804 |
| 609 | Ga0496106_0015033 | 3300048909 | Bacteria | 5729 |
| 610 | Ga0496106_0213804 | 3300048909 | Bacteria | 1536 |
| 611 | Ga0496107_0000560 | 3300048910 | Bacteria | 20809 |
| 612 | Ga0496107_0013936 | 3300048910 | Bacteria | 5623 |
| 613 | Ga0496107_0125420 | 3300048910 | Unclassified | 1893 |
| 614 | Ga0496107_0165894 | 3300048910 | Bacteria | 1637 |
| 615 | Ga0496108_0006778 | 3300048911 | Bacteria | 9276 |
| 616 | Ga0496108_0045231 | 3300048911 | Bacteria | 3677 |
| 617 | Ga0496108_0125315 | 3300048911 | Bacteria | 2205 |
| 618 | Ga0496108_0443305 | 3300048911 | Bacteria | 1134 |
| 619 | Ga0496109_0000260 | 3300048912 | Bacteria | 50877 |
| 620 | Ga0496109_0001609 | 3300048912 | Bacteria | 18843 |
| 621 | Ga0496110_0000110 | 3300048913 | Bacteria | 44789 |
| 622 | Ga0496110_0141302 | 3300048913 | Bacteria | 2177 |
| 623 | Ga0496110_0190051 | 3300048913 | Unclassified | 1865 |
| 624 | Ga0496110_0338644 | 3300048913 | Bacteria | 1370 |
| 625 | Ga0496111_0091813 | 3300048914 | Bacteria | 2225 |
| 626 | Ga0496111_0142400 | 3300048914 | Bacteria | 1777 |
| 627 | Ga0496111_0193692 | 3300048914 | Bacteria | 1511 |
| 628 | Ga0496112_0063965 | 3300048915 | Bacteria | 3629 |
| 629 | Ga0496112_0181405 | 3300048915 | Bacteria | 2069 |
| 630 | Ga0496113_0000719 | 3300048916 | Bacteria | 16932 |
| 631 | Ga0496113_0207870 | 3300048916 | Bacteria | 1557 |
| 632 | Ga0496114_0000689 | 3300048917 | Bacteria | 25131 |
| 633 | Ga0496115_0010342 | 3300048918 | Bacteria | 6967 |
| 634 | Ga0496121_0156870 | 3300048924 | Bacteria | 1669 |
| 635 | Ga0496121_0165595 | 3300048924 | Bacteria | 1611 |
| 636 | Ga0496123_0206022 | 3300048926 | Bacteria | 1004 |
| 637 | Ga0496124_0182868 | 3300048927 | Bacteria | 1611 |
| 638 | Ga0496125_0081337 | 3300048928 | Bacteria | 2475 |
| 639 | Ga0496126_0051799 | 3300048929 | Bacteria | 3735 |
| 640 | Ga0496126_0063401 | 3300048929 | Bacteria | 3313 |
| 641 | Ga0496126_0084150 | 3300048929 | Bacteria | 2806 |
| 642 | Ga0501031_0143906 | 3300049568 | Bacteria | 1558 |
| 643 | Ga0501036_0065004 | 3300049572 | Bacteria | 3087 |
| 644 | Ga0501037_0039333 | 3300049573 | Bacteria | 3482 |
| 645 | Ga0501038_0156023 | 3300049574 | Bacteria | 1858 |
| 646 | Ga0501047_0037116 | 3300049581 | Bacteria | 4711 |
| 647 | Ga0501067_0013283 | 3300049583 | Bacteria | 4561 |
| 648 | Ga0501070_0011879 | 3300049586 | Bacteria | 7354 |
| 649 | Ga0501070_0114544 | 3300049586 | Bacteria | 2227 |
| 650 | Ga0501073_0021312 | 3300049589 | Bacteria | 4672 |
| 651 | Ga0501073_0124055 | 3300049589 | Bacteria | 1790 |
| 652 | Ga0501080_0154403 | 3300049742 | Bacteria | 2120 |
| 653 | Ga0501035_0217641 | 3300049822 | Bacteria | 1632 |
| 654 | Ga0501044_0058173 | 3300049823 | Bacteria | 3965 |
| 655 | Ga0501044_0447162 | 3300049823 | Bacteria | 1199 |
| 656 | nmdc:mga04h51_15605_c1 | 3300050495 | Bacteria | 2190 |
| 657 | nmdc:mga07m45_76269_c1 | 3300050496 | Bacteria | 1911 |
| 658 | nmdc:mga09592_305_c1 | 3300050508 | Bacteria | 35821 |
| 659 | nmdc:mga0qj67_690_c1 | 3300050509 | Bacteria | 22997 |
| 660 | nmdc:mga08y16_108532_c1 | 3300050511 | Bacteria | 2890 |
| 661 | nmdc:mga08y16_2782_c1 | 3300050511 | Bacteria | 17931 |
| 662 | nmdc:mga08y16_70534_c1 | 3300050511 | Bacteria | 3643 |
| 663 | nmdc:mga0n895_495822_c1 | 3300050512 | Bacteria | 1231 |
| 664 | nmdc:mga0n895_512_c1 | 3300050512 | Bacteria | 26362 |
| 665 | nmdc:mga0n895_636_c1 | 3300050512 | Bacteria | 24376 |
| 666 | nmdc:mga0rr50_16801_c1 | 3300050513 | Bacteria | 4870 |
| 667 | nmdc:mga0rr50_258687_c1 | 3300050513 | Unclassified | 1448 |
| 668 | nmdc:mga0a205_9418_c1 | 3300050515 | Bacteria | 8929 |
| 669 | Ga0495601_0001947 | 3300053077 | Bacteria | 11553 |
| 670 | Ga0495601_0039735 | 3300053077 | Bacteria | 2947 |
| 671 | Ga0495601_0056066 | 3300053077 | Bacteria | 2495 |
| 672 | Ga0495612_0014271 | 3300053078 | Bacteria | 3196 |
| 673 | Ga0495612_0035362 | 3300053078 | Bacteria | 2025 |
| 674 | Ga0495612_0046223 | 3300053078 | Bacteria | 1782 |
| 675 | Ga0500635_0009086 | 3300053080 | Bacteria | 2747 |
| 676 | Ga0495595_0000210 | 3300053084 | Bacteria | 23560 |
| 677 | Ga0495619_0021558 | 3300053085 | Bacteria | 4114 |
| 678 | Ga0495619_0043947 | 3300053085 | Bacteria | 2931 |
| 679 | Ga0500647_0013413 | 3300053091 | Bacteria | 3707 |
| 680 | Ga0500647_0014706 | 3300053091 | Bacteria | 3564 |
| 681 | Ga0500651_0279020 | 3300053093 | Bacteria | 964 |
| 682 | Ga0500566_0000601 | 3300053094 | Bacteria | 20208 |
| 683 | Ga0500640_002416 | 3300053095 | Bacteria | 6166 |
| 684 | Ga0500572_000764 | 3300053111 | Bacteria | 10327 |
| 685 | Ga0500572_002445 | 3300053111 | Bacteria | 4470 |
| 686 | Ga0500608_009711 | 3300053122 | Bacteria | 4097 |
| 687 | Ga0500614_012119 | 3300053123 | Bacteria | 1876 |
| 688 | Ga0500559_0001730 | 3300053136 | Bacteria | 11975 |
| 689 | Ga0500603_000048 | 3300053150 | Bacteria | 29163 |
| 690 | Ga0500603_000817 | 3300053150 | Bacteria | 7433 |
| 691 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 692 | Ga0500630_001904 | 3300053159 | Bacteria | 10017 |
| 693 | Ga0500638_014810 | 3300053162 | Bacteria | 3564 |
| 694 | Ga0500639_000166 | 3300053163 | Bacteria | 32001 |
| 695 | Ga0500639_103660 | 3300053163 | Bacteria | 1395 |
| 696 | Ga0500637_0000100 | 3300053178 | Bacteria | 31119 |
| 697 | Ga0500637_0030934 | 3300053178 | Bacteria | 2981 |
| 698 | Ga0500596_000099 | 3300053735 | Bacteria | 11805 |
| 699 | Ga0500601_003394 | 3300053737 | Bacteria | 1726 |
| 700 | Ga0466962_0105239 | 3300061719 | Bacteria | 1356 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_0512095 | Ga0495630_0512095_19_690 | 200 |
| 2 | 3300046516 | Ga0495628_0335647 | Ga0495628_0335647_327_1058 | 206 |
| 3 | 3300048088 | Ga0495602_0505145 | Ga0495602_0505145_83_733 | 208 |
| 4 | 3300049589 | Ga0501073_0124055 | Ga0501073_0124055_1060_1761 | 208 |
| 5 | 3300035692 | Ga0373935_0044689 | Ga0373935_0044689_1084_1800 | 214 |
| 6 | 3300037068 | Ga0373925_0492587 | Ga0373925_0492587_224_940 | 214 |
| 7 | 3300048927 | Ga0496124_0182868 | Ga0496124_0182868_10_726 | 215 |
| 8 | 3300035117 | Ga0373953_0243817 | Ga0373953_0243817_33_767 | 218 |
| 9 | 3300026121 | Ga0207683_10654965 | Ga0207683_106549652 | 220 |
| 10 | 3300007265 | Ga0099794_10165543 | Ga0099794_101655431 | 226 |
| 11 | 3300028800 | Ga0265338_10083353 | Ga0265338_100833533 | 227 |
| 12 | 3300031249 | Ga0265339_10000068 | Ga0265339_1000006827 | 227 |
| 13 | 3300031595 | Ga0265313_10000088 | Ga0265313_1000008858 | 227 |
| 14 | 3300035171 | Ga0373946_0209724 | Ga0373946_0209724_23_787 | 231 |
| 15 | 3300025245 | Ga0207425_1000690 | Ga0207425_10006903 | 232 |
| 16 | 3300035118 | Ga0373954_0002846 | Ga0373954_0002846_2505_3320 | 234 |
| 17 | 3300046454 | Ga0495592_0037236 | Ga0495592_0037236_423_1238 | 234 |
| 18 | 3300046678 | Ga0495599_0007597 | Ga0495599_0007597_1084_1899 | 234 |
| 19 | 3300005329 | Ga0070683_100264664 | Ga0070683_1002646642 | 235 |
| 20 | 3300005344 | Ga0070661_100383775 | Ga0070661_1003837751 | 235 |
| 21 | 3300005539 | Ga0068853_100288262 | Ga0068853_1002882622 | 235 |
| 22 | 3300005577 | Ga0068857_100599543 | Ga0068857_1005995432 | 235 |
| 23 | 3300005614 | Ga0068856_100095310 | Ga0068856_1000953102 | 235 |
| 24 | 3300009093 | Ga0105240_10061993 | Ga0105240_100619933 | 235 |
| 25 | 3300013104 | Ga0157370_10156759 | Ga0157370_101567591 | 235 |
| 26 | 3300013104 | Ga0157370_10424110 | Ga0157370_104241102 | 235 |
| 27 | 3300013105 | Ga0157369_10009653 | Ga0157369_100096536 | 235 |
| 28 | 3300013105 | Ga0157369_10065485 | Ga0157369_100654853 | 235 |
| 29 | 3300013307 | Ga0157372_10047696 | Ga0157372_100476962 | 235 |
| 30 | 3300021384 | Ga0213876_10138633 | Ga0213876_101386332 | 235 |
| 31 | 3300025913 | Ga0207695_10201890 | Ga0207695_102018902 | 235 |
| 32 | 3300025944 | Ga0207661_10341515 | Ga0207661_103415151 | 235 |
| 33 | 3300026041 | Ga0207639_10047217 | Ga0207639_100472173 | 235 |
| 34 | 3300026041 | Ga0207639_10387055 | Ga0207639_103870551 | 235 |
| 35 | 3300037466 | Ga0395898_0034323 | Ga0395898_0034323_1808_2626 | 235 |
| 36 | 3300038443 | Ga0395901_0114157 | Ga0395901_0114157_149_967 | 235 |
| 37 | 3300039437 | Ga0436365_1717019 | Ga0436365_1717019_834_1655 | 235 |
| 38 | 3300047319 | Ga0495674_0504966 | Ga0495674_0504966_139_918 | 235 |
| 39 | iso_pu_bacteria | 2808606384 | 2808973493 | 235 |
| 40 | iso_pu_bacteria | 2808606390 | 2809008342 | 235 |
| 41 | iso_pu_bacteria | 2808606391 | 2809015320 | 235 |
| 42 | 3300036401 | Ga0373937_0576359 | Ga0373937_0576359_73_852 | 236 |
| 43 | 3300046536 | Ga0495587_0197184 | Ga0495587_0197184_281_1060 | 236 |
| 44 | 3300046675 | Ga0495657_0242929 | Ga0495657_0242929_45_824 | 236 |
| 45 | 3300046678 | Ga0495599_0298579 | Ga0495599_0298579_87_866 | 236 |
| 46 | 3300047317 | Ga0495604_0155295 | Ga0495604_0155295_805_1584 | 236 |
| 47 | 3300047322 | Ga0495680_0385501 | Ga0495680_0385501_106_885 | 236 |
| 48 | 3300053163 | Ga0500639_103660 | Ga0500639_103660_210_1007 | 236 |
| 49 | 3300006358 | Ga0068871_100274802 | Ga0068871_1002748021 | 237 |
| 50 | 3300026067 | Ga0207678_10426963 | Ga0207678_104269631 | 237 |
| 51 | 3300003320 | rootH2_10012201 | rootH2_100122015 | 238 |
| 52 | 3300021388 | Ga0213875_10000067 | Ga0213875_10000067104 | 238 |
| 53 | 3300031711 | Ga0265314_10004951 | Ga0265314_100049512 | 238 |
| 54 | 3300035114 | Ga0373939_0049723 | Ga0373939_0049723_428_1225 | 238 |
| 55 | 3300037068 | Ga0373925_0134612 | Ga0373925_0134612_517_1320 | 238 |
| 56 | 3300037853 | Ga0436364_0367201 | Ga0436364_0367201_15673_16503 | 238 |
| 57 | 3300045836 | Ga0466958_0000026 | Ga0466958_0000026_20650_21441 | 238 |
| 58 | 3300046455 | Ga0495603_0119075 | Ga0495603_0119075_237_1040 | 238 |
| 59 | 3300037466 | Ga0395898_0092017 | Ga0395898_0092017_1417_2235 | 239 |
| 60 | 3300037853 | Ga0436364_0231307 | Ga0436364_0231307_824_1648 | 239 |
| 61 | 3300038443 | Ga0395901_0453083 | Ga0395901_0453083_143_961 | 239 |
| 62 | 3300038742 | Ga0400486_17854 | Ga0400486_17854_1187_1981 | 239 |
| 63 | 3300005336 | Ga0070680_100519650 | Ga0070680_1005196501 | 240 |
| 64 | 3300009551 | Ga0105238_10007520 | Ga0105238_100075202 | 240 |
| 65 | 3300025917 | Ga0207660_10484450 | Ga0207660_104844502 | 240 |
| 66 | 3300031251 | Ga0265327_10001600 | Ga0265327_100016005 | 240 |
| 67 | 3300035691 | Ga0373931_0000393 | Ga0373931_0000393_9342_10139 | 240 |
| 68 | 3300039437 | Ga0436365_0310774 | Ga0436365_0310774_238_1032 | 240 |
| 69 | 3300046516 | Ga0495628_0064633 | Ga0495628_0064633_1117_1908 | 240 |
| 70 | 3300048913 | Ga0496110_0000110 | Ga0496110_0000110_25885_26685 | 240 |
| 71 | 3300048914 | Ga0496111_0142400 | Ga0496111_0142400_178_978 | 240 |
| 72 | 3300053150 | Ga0500603_000048 | Ga0500603_000048_13751_14545 | 240 |
| 73 | 3300053178 | Ga0500637_0000100 | Ga0500637_0000100_8055_8849 | 240 |
| 74 | iso_pu_bacteria | 2513237137 | 2513862716 | 240 |
| 75 | 3300003215 | JGI25153J46596_10022247 | JGI25153J46596_100222472 | 241 |
| 76 | 3300005434 | Ga0070709_10173471 | Ga0070709_101734711 | 241 |
| 77 | 3300005436 | Ga0070713_100137115 | Ga0070713_1001371152 | 241 |
| 78 | 3300005437 | Ga0070710_10018284 | Ga0070710_100182842 | 241 |
| 79 | 3300005439 | Ga0070711_100022380 | Ga0070711_1000223802 | 241 |
| 80 | 3300006028 | Ga0070717_10278863 | Ga0070717_102788632 | 241 |
| 81 | 3300006163 | Ga0070715_10128967 | Ga0070715_101289672 | 241 |
| 82 | 3300006175 | Ga0070712_100020552 | Ga0070712_1000205523 | 241 |
| 83 | 3300025297 | Ga0209758_1027845 | Ga0209758_10278452 | 241 |
| 84 | 3300025906 | Ga0207699_10043403 | Ga0207699_100434032 | 241 |
| 85 | 3300025915 | Ga0207693_10029107 | Ga0207693_100291072 | 241 |
| 86 | 3300025928 | Ga0207700_10208378 | Ga0207700_102083781 | 241 |
| 87 | 3300025928 | Ga0207700_10621161 | Ga0207700_106211611 | 241 |
| 88 | 3300025929 | Ga0207664_10132715 | Ga0207664_101327152 | 241 |
| 89 | 3300031239 | Ga0265328_10012438 | Ga0265328_100124382 | 241 |
| 90 | 3300031250 | Ga0265331_10046882 | Ga0265331_100468822 | 241 |
| 91 | 3300031251 | Ga0265327_10000233 | Ga0265327_100002338 | 241 |
| 92 | 3300031344 | Ga0265316_10000190 | Ga0265316_1000019054 | 241 |
| 93 | 3300044694 | Ga0466963_0146379 | Ga0466963_0146379_117_911 | 241 |
| 94 | 3300044842 | Ga0466957_0254349 | Ga0466957_0254349_48_842 | 241 |
| 95 | 3300045049 | Ga0466959_0068328 | Ga0466959_0068328_1417_2211 | 241 |
| 96 | 3300045836 | Ga0466958_0107111 | Ga0466958_0107111_101_895 | 241 |
| 97 | 3300046692 | Ga0495671_0050157 | Ga0495671_0050157_660_1460 | 241 |
| 98 | 3300048929 | Ga0496126_0063401 | Ga0496126_0063401_1855_2661 | 241 |
| 99 | 3300005458 | Ga0070681_10059021 | Ga0070681_100590212 | 242 |
| 100 | 3300013105 | Ga0157369_10060341 | Ga0157369_100603412 | 242 |
| 101 | 3300046462 | Ga0495651_0141818 | Ga0495651_0141818_197_994 | 242 |
| 102 | 3300047444 | Ga0495675_0039625 | Ga0495675_0039625_1083_1880 | 242 |
| 103 | 3300049568 | Ga0501031_0143906 | Ga0501031_0143906_253_1056 | 242 |
| 104 | 3300049572 | Ga0501036_0065004 | Ga0501036_0065004_1865_2668 | 242 |
| 105 | 3300049573 | Ga0501037_0039333 | Ga0501037_0039333_2550_3353 | 242 |
| 106 | 3300049574 | Ga0501038_0156023 | Ga0501038_0156023_621_1424 | 242 |
| 107 | 3300049586 | Ga0501070_0114544 | Ga0501070_0114544_1321_2124 | 242 |
| 108 | 3300049742 | Ga0501080_0154403 | Ga0501080_0154403_154_957 | 242 |
| 109 | 3300049822 | Ga0501035_0217641 | Ga0501035_0217641_110_913 | 242 |
| 110 | 3300049823 | Ga0501044_0447162 | Ga0501044_0447162_256_1059 | 242 |
| 111 | 3300005842 | Ga0068858_100124306 | Ga0068858_1001243062 | 243 |
| 112 | 3300005937 | Ga0081455_10039366 | Ga0081455_100393662 | 243 |
| 113 | 3300005983 | Ga0081540_1033505 | Ga0081540_10335053 | 243 |
| 114 | 3300006871 | Ga0075434_100073196 | Ga0075434_1000731964 | 243 |
| 115 | 3300009545 | Ga0105237_10023052 | Ga0105237_100230524 | 243 |
| 116 | 3300009551 | Ga0105238_10069804 | Ga0105238_100698043 | 243 |
| 117 | 3300010375 | Ga0105239_10480449 | Ga0105239_104804492 | 243 |
| 118 | 3300013296 | Ga0157374_10019654 | Ga0157374_100196543 | 243 |
| 119 | 3300013306 | Ga0163162_10652453 | Ga0163162_106524532 | 243 |
| 120 | 3300025924 | Ga0207694_10058086 | Ga0207694_100580862 | 243 |
| 121 | 3300025924 | Ga0207694_10362989 | Ga0207694_103629891 | 243 |
| 122 | 3300025949 | Ga0207667_10141119 | Ga0207667_101411192 | 243 |
| 123 | 3300026035 | Ga0207703_10331462 | Ga0207703_103314621 | 243 |
| 124 | 3300028653 | Ga0265323_10002189 | Ga0265323_100021896 | 243 |
| 125 | 3300028654 | Ga0265322_10029696 | Ga0265322_100296961 | 243 |
| 126 | 3300028666 | Ga0265336_10006616 | Ga0265336_100066163 | 243 |
| 127 | 3300028800 | Ga0265338_10013740 | Ga0265338_100137406 | 243 |
| 128 | 3300039437 | Ga0436365_0096100 | Ga0436365_0096100_899_1708 | 243 |
| 129 | 3300048926 | Ga0496123_0206022 | Ga0496123_0206022_178_978 | 243 |
| 130 | 3300048928 | Ga0496125_0081337 | Ga0496125_0081337_811_1611 | 243 |
| 131 | 3300005983 | Ga0081540_1081415 | Ga0081540_10814151 | 244 |
| 132 | 3300033442 | Ga0315911_1000015 | Ga0315911_1000015145 | 244 |
| 133 | 3300049583 | Ga0501067_0013283 | Ga0501067_0013283_386_1192 | 244 |
| 134 | 3300035724 | Ga0373933_0011966 | Ga0373933_0011966_3307_4113 | 245 |
| 135 | 3300036401 | Ga0373937_0011730 | Ga0373937_0011730_3743_4549 | 245 |
| 136 | 3300037068 | Ga0373925_0013964 | Ga0373925_0013964_1637_2443 | 245 |
| 137 | 3300046476 | Ga0495662_0075736 | Ga0495662_0075736_516_1322 | 245 |
| 138 | 3300046529 | Ga0495652_0205849 | Ga0495652_0205849_215_1021 | 245 |
| 139 | 3300049581 | Ga0501047_0037116 | Ga0501047_0037116_3671_4477 | 245 |
| 140 | 3300049586 | Ga0501070_0011879 | Ga0501070_0011879_2877_3683 | 245 |
| 141 | 3300049589 | Ga0501073_0021312 | Ga0501073_0021312_2050_2856 | 245 |
| 142 | 3300049823 | Ga0501044_0058173 | Ga0501044_0058173_323_1129 | 245 |
| 143 | 3300053080 | Ga0500635_0009086 | Ga0500635_0009086_792_1604 | 245 |
| 144 | 3300053178 | Ga0500637_0030934 | Ga0500637_0030934_208_1020 | 245 |
| 145 | 3300005329 | Ga0070683_100026074 | Ga0070683_1000260746 | 246 |
| 146 | 3300005329 | Ga0070683_100073252 | Ga0070683_1000732522 | 246 |
| 147 | 3300005336 | Ga0070680_100118497 | Ga0070680_1001184972 | 246 |
| 148 | 3300005434 | Ga0070709_10003284 | Ga0070709_100032842 | 246 |
| 149 | 3300005434 | Ga0070709_10195621 | Ga0070709_101956212 | 246 |
| 150 | 3300005435 | Ga0070714_100026630 | Ga0070714_1000266302 | 246 |
| 151 | 3300005436 | Ga0070713_100001721 | Ga0070713_1000017219 | 246 |
| 152 | 3300005437 | Ga0070710_10009699 | Ga0070710_100096992 | 246 |
| 153 | 3300005439 | Ga0070711_100028549 | Ga0070711_1000285493 | 246 |
| 154 | 3300005458 | Ga0070681_10011117 | Ga0070681_100111172 | 246 |
| 155 | 3300005458 | Ga0070681_10091277 | Ga0070681_100912773 | 246 |
| 156 | 3300005458 | Ga0070681_10172203 | Ga0070681_101722032 | 246 |
| 157 | 3300005458 | Ga0070681_10206772 | Ga0070681_102067722 | 246 |
| 158 | 3300005530 | Ga0070679_100142030 | Ga0070679_1001420302 | 246 |
| 159 | 3300005530 | Ga0070679_100226764 | Ga0070679_1002267642 | 246 |
| 160 | 3300005535 | Ga0070684_100016560 | Ga0070684_1000165603 | 246 |
| 161 | 3300005535 | Ga0070684_100017018 | Ga0070684_1000170187 | 246 |
| 162 | 3300005547 | Ga0070693_100180122 | Ga0070693_1001801222 | 246 |
| 163 | 3300006028 | Ga0070717_10004642 | Ga0070717_100046425 | 246 |
| 164 | 3300006173 | Ga0070716_100046342 | Ga0070716_1000463422 | 246 |
| 165 | 3300006173 | Ga0070716_100360750 | Ga0070716_1003607501 | 246 |
| 166 | 3300006358 | Ga0068871_100139170 | Ga0068871_1001391703 | 246 |
| 167 | 3300009174 | Ga0105241_10105061 | Ga0105241_101050612 | 246 |
| 168 | 3300009545 | Ga0105237_10184641 | Ga0105237_101846412 | 246 |
| 169 | 3300009551 | Ga0105238_10328367 | Ga0105238_103283672 | 246 |
| 170 | 3300010375 | Ga0105239_10076051 | Ga0105239_100760514 | 246 |
| 171 | 3300013105 | Ga0157369_10548649 | Ga0157369_105486492 | 246 |
| 172 | 3300021384 | Ga0213876_10039373 | Ga0213876_100393732 | 246 |
| 173 | 3300021384 | Ga0213876_10054784 | Ga0213876_100547841 | 246 |
| 174 | 3300025906 | Ga0207699_10019208 | Ga0207699_100192082 | 246 |
| 175 | 3300025906 | Ga0207699_10078439 | Ga0207699_100784392 | 246 |
| 176 | 3300025911 | Ga0207654_10129390 | Ga0207654_101293902 | 246 |
| 177 | 3300025912 | Ga0207707_10091837 | Ga0207707_100918373 | 246 |
| 178 | 3300025912 | Ga0207707_10128549 | Ga0207707_101285492 | 246 |
| 179 | 3300025912 | Ga0207707_10337276 | Ga0207707_103372762 | 246 |
| 180 | 3300025913 | Ga0207695_10106617 | Ga0207695_101066172 | 246 |
| 181 | 3300025913 | Ga0207695_10617462 | Ga0207695_106174621 | 246 |
| 182 | 3300025915 | Ga0207693_10017830 | Ga0207693_100178302 | 246 |
| 183 | 3300025916 | Ga0207663_10019094 | Ga0207663_100190943 | 246 |
| 184 | 3300025917 | Ga0207660_10006133 | Ga0207660_100061334 | 246 |
| 185 | 3300025917 | Ga0207660_10221176 | Ga0207660_102211761 | 246 |
| 186 | 3300025921 | Ga0207652_10097875 | Ga0207652_100978752 | 246 |
| 187 | 3300025921 | Ga0207652_10428228 | Ga0207652_104282282 | 246 |
| 188 | 3300025921 | Ga0207652_10726189 | Ga0207652_107261891 | 246 |
| 189 | 3300025928 | Ga0207700_10006043 | Ga0207700_100060432 | 246 |
| 190 | 3300025928 | Ga0207700_10023777 | Ga0207700_100237772 | 246 |
| 191 | 3300025929 | Ga0207664_10032469 | Ga0207664_100324692 | 246 |
| 192 | 3300025939 | Ga0207665_10067630 | Ga0207665_100676302 | 246 |
| 193 | 3300025939 | Ga0207665_10321244 | Ga0207665_103212441 | 246 |
| 194 | 3300025944 | Ga0207661_10002727 | Ga0207661_100027273 | 246 |
| 195 | 3300025944 | Ga0207661_10017615 | Ga0207661_100176152 | 246 |
| 196 | 3300025949 | Ga0207667_10603608 | Ga0207667_106036081 | 246 |
| 197 | 3300025981 | Ga0207640_10079881 | Ga0207640_100798811 | 246 |
| 198 | 3300026116 | Ga0207674_10022025 | Ga0207674_100220254 | 246 |
| 199 | 3300031249 | Ga0265339_10001392 | Ga0265339_100013928 | 246 |
| 200 | 3300035111 | Ga0373923_0004717 | Ga0373923_0004717_1964_2782 | 246 |
| 201 | 3300035113 | Ga0373936_0010672 | Ga0373936_0010672_2509_3327 | 246 |
| 202 | 3300035118 | Ga0373954_0034334 | Ga0373954_0034334_887_1705 | 246 |
| 203 | 3300035120 | Ga0373957_0020186 | Ga0373957_0020186_140_958 | 246 |
| 204 | 3300035170 | Ga0373943_0003447 | Ga0373943_0003447_1913_2731 | 246 |
| 205 | 3300035171 | Ga0373946_0003623 | Ga0373946_0003623_3911_4729 | 246 |
| 206 | 3300035172 | Ga0373955_0018510 | Ga0373955_0018510_1773_2591 | 246 |
| 207 | 3300035410 | Ga0373924_0023344 | Ga0373924_0023344_666_1484 | 246 |
| 208 | 3300035724 | Ga0373933_0000405 | Ga0373933_0000405_1893_2702 | 246 |
| 209 | 3300035724 | Ga0373933_0029430 | Ga0373933_0029430_2019_2837 | 246 |
| 210 | 3300035725 | Ga0373947_0195164 | Ga0373947_0195164_150_968 | 246 |
| 211 | 3300039437 | Ga0436365_1135249 | Ga0436365_1135249_1229_2065 | 246 |
| 212 | 3300044693 | Ga0466961_0135066 | Ga0466961_0135066_573_1451 | 246 |
| 213 | 3300044694 | Ga0466963_0074625 | Ga0466963_0074625_629_1456 | 246 |
| 214 | 3300044706 | Ga0466964_0020698 | Ga0466964_0020698_1257_2135 | 246 |
| 215 | 3300045049 | Ga0466959_0285310 | Ga0466959_0285310_22_900 | 246 |
| 216 | 3300045976 | Ga0466967_0253595 | Ga0466967_0253595_395_1213 | 246 |
| 217 | 3300046455 | Ga0495603_0030221 | Ga0495603_0030221_1920_2738 | 246 |
| 218 | 3300046459 | Ga0495629_0028631 | Ga0495629_0028631_2934_3752 | 246 |
| 219 | 3300046461 | Ga0495641_0040792 | Ga0495641_0040792_168_986 | 246 |
| 220 | 3300046472 | Ga0495580_0059778 | Ga0495580_0059778_1741_2559 | 246 |
| 221 | 3300046475 | Ga0495639_0177395 | Ga0495639_0177395_92_910 | 246 |
| 222 | 3300046476 | Ga0495662_0021827 | Ga0495662_0021827_1287_2105 | 246 |
| 223 | 3300046477 | Ga0495664_0006628 | Ga0495664_0006628_5185_6003 | 246 |
| 224 | 3300046477 | Ga0495664_0032449 | Ga0495664_0032449_1069_1887 | 246 |
| 225 | 3300046511 | Ga0495608_0069865 | Ga0495608_0069865_1061_1879 | 246 |
| 226 | 3300046514 | Ga0495618_0023163 | Ga0495618_0023163_2353_3171 | 246 |
| 227 | 3300046516 | Ga0495628_0346195 | Ga0495628_0346195_54_872 | 246 |
| 228 | 3300046533 | Ga0495640_0030630 | Ga0495640_0030630_2854_3672 | 246 |
| 229 | 3300046536 | Ga0495587_0104944 | Ga0495587_0104944_180_998 | 246 |
| 230 | 3300046543 | Ga0495645_0097372 | Ga0495645_0097372_880_1698 | 246 |
| 231 | 3300046642 | Ga0495634_0008812 | Ga0495634_0008812_1186_2004 | 246 |
| 232 | 3300046663 | Ga0495635_0135102 | Ga0495635_0135102_49_867 | 246 |
| 233 | 3300046679 | Ga0495623_0283695 | Ga0495623_0283695_73_891 | 246 |
| 234 | 3300046681 | Ga0495647_0016764 | Ga0495647_0016764_1245_2063 | 246 |
| 235 | 3300046683 | Ga0495658_0008269 | Ga0495658_0008269_2725_3543 | 246 |
| 236 | 3300046690 | Ga0495624_0116432 | Ga0495624_0116432_217_1035 | 246 |
| 237 | 3300047315 | Ga0495581_0006737 | Ga0495581_0006737_344_1162 | 246 |
| 238 | 3300047319 | Ga0495674_0033682 | Ga0495674_0033682_2058_2876 | 246 |
| 239 | 3300047471 | Ga0495684_0009235 | Ga0495684_0009235_5510_6328 | 246 |
| 240 | 3300047673 | Ga0495593_0070075 | Ga0495593_0070075_786_1604 | 246 |
| 241 | 3300048924 | Ga0496121_0156870 | Ga0496121_0156870_396_1214 | 246 |
| 242 | 3300048929 | Ga0496126_0051799 | Ga0496126_0051799_1798_2616 | 246 |
| 243 | 3300048929 | Ga0496126_0084150 | Ga0496126_0084150_291_1103 | 246 |
| 244 | 3300053077 | Ga0495601_0039735 | Ga0495601_0039735_1878_2696 | 246 |
| 245 | 3300053078 | Ga0495612_0035362 | Ga0495612_0035362_746_1564 | 246 |
| 246 | 3300053085 | Ga0495619_0043947 | Ga0495619_0043947_2085_2903 | 246 |
| 247 | 3300061719 | Ga0466962_0105239 | Ga0466962_0105239_17_895 | 246 |
| 248 | 3300014969 | Ga0157376_10000115 | Ga0157376_1000011512 | 247 |
| 249 | 3300035092 | Ga0373952_0001492 | Ga0373952_0001492_3417_4241 | 247 |
| 250 | 3300037466 | Ga0395898_0029983 | Ga0395898_0029983_3755_4576 | 247 |
| 251 | 3300044735 | Ga0466968_0120191 | Ga0466968_0120191_61_873 | 247 |
| 252 | 3300045049 | Ga0466959_0311031 | Ga0466959_0311031_55_867 | 247 |
| 253 | 3300046454 | Ga0495592_0024446 | Ga0495592_0024446_348_1160 | 247 |
| 254 | 3300046516 | Ga0495628_0221425 | Ga0495628_0221425_576_1388 | 247 |
| 255 | 3300048088 | Ga0495602_0184909 | Ga0495602_0184909_542_1354 | 247 |
| 256 | 3300053091 | Ga0500647_0013413 | Ga0500647_0013413_2595_3407 | 247 |
| 257 | 3300053111 | Ga0500572_002445 | Ga0500572_002445_942_1754 | 247 |
| 258 | 3300005983 | Ga0081540_1053606 | Ga0081540_10536062 | 248 |
| 259 | 3300031344 | Ga0265316_10146049 | Ga0265316_101460492 | 248 |
| 260 | 3300048924 | Ga0496121_0165595 | Ga0496121_0165595_528_1346 | 248 |
| 261 | 3300053091 | Ga0500647_0014706 | Ga0500647_0014706_123_947 | 248 |
| 262 | 3300053094 | Ga0500566_0000601 | Ga0500566_0000601_7586_8410 | 248 |
| 263 | 3300053095 | Ga0500640_002416 | Ga0500640_002416_1764_2588 | 248 |
| 264 | 3300053111 | Ga0500572_000764 | Ga0500572_000764_610_1434 | 248 |
| 265 | 3300053122 | Ga0500608_009711 | Ga0500608_009711_1344_2168 | 248 |
| 266 | 3300053123 | Ga0500614_012119 | Ga0500614_012119_700_1524 | 248 |
| 267 | 3300053136 | Ga0500559_0001730 | Ga0500559_0001730_2823_3647 | 248 |
| 268 | 3300053150 | Ga0500603_000817 | Ga0500603_000817_5413_6237 | 248 |
| 269 | 3300053159 | Ga0500630_001904 | Ga0500630_001904_7439_8263 | 248 |
| 270 | 3300053162 | Ga0500638_014810 | Ga0500638_014810_1586_2410 | 248 |
| 271 | 3300053163 | Ga0500639_000166 | Ga0500639_000166_19248_20072 | 248 |
| 272 | 3300053735 | Ga0500596_000099 | Ga0500596_000099_6637_7461 | 248 |
| 273 | 3300053737 | Ga0500601_003394 | Ga0500601_003394_438_1262 | 248 |
| 274 | 3300005336 | Ga0070680_100191574 | Ga0070680_1001915742 | 250 |
| 275 | 3300005337 | Ga0070682_100050171 | Ga0070682_1000501712 | 250 |
| 276 | 3300005344 | Ga0070661_100149064 | Ga0070661_1001490642 | 250 |
| 277 | 3300005364 | Ga0070673_100031056 | Ga0070673_1000310562 | 250 |
| 278 | 3300005435 | Ga0070714_100228408 | Ga0070714_1002284082 | 250 |
| 279 | 3300005439 | Ga0070711_100020384 | Ga0070711_1000203842 | 250 |
| 280 | 3300005445 | Ga0070708_100180278 | Ga0070708_1001802782 | 250 |
| 281 | 3300005455 | Ga0070663_100078045 | Ga0070663_1000780452 | 250 |
| 282 | 3300005458 | Ga0070681_10009919 | Ga0070681_100099193 | 250 |
| 283 | 3300005468 | Ga0070707_100193337 | Ga0070707_1001933372 | 250 |
| 284 | 3300005546 | Ga0070696_100032178 | Ga0070696_1000321782 | 250 |
| 285 | 3300006237 | Ga0097621_100027474 | Ga0097621_1000274742 | 250 |
| 286 | 3300006881 | Ga0068865_100063289 | Ga0068865_1000632892 | 250 |
| 287 | 3300007076 | Ga0075435_100188240 | Ga0075435_1001882402 | 250 |
| 288 | 3300009093 | Ga0105240_10498577 | Ga0105240_104985772 | 250 |
| 289 | 3300009098 | Ga0105245_10100285 | Ga0105245_101002852 | 250 |
| 290 | 3300009177 | Ga0105248_10313680 | Ga0105248_103136802 | 250 |
| 291 | 3300010375 | Ga0105239_10248049 | Ga0105239_102480491 | 250 |
| 292 | 3300013102 | Ga0157371_10149528 | Ga0157371_101495282 | 250 |
| 293 | 3300013296 | Ga0157374_10221977 | Ga0157374_102219772 | 250 |
| 294 | 3300013297 | Ga0157378_10096701 | Ga0157378_100967012 | 250 |
| 295 | 3300013307 | Ga0157372_10433353 | Ga0157372_104333532 | 250 |
| 296 | 3300014968 | Ga0157379_10090019 | Ga0157379_100900192 | 250 |
| 297 | 3300017792 | Ga0163161_10368356 | Ga0163161_103683561 | 250 |
| 298 | 3300025906 | Ga0207699_10109785 | Ga0207699_101097852 | 250 |
| 299 | 3300025911 | Ga0207654_10084407 | Ga0207654_100844072 | 250 |
| 300 | 3300025912 | Ga0207707_10060913 | Ga0207707_100609132 | 250 |
| 301 | 3300025915 | Ga0207693_10019862 | Ga0207693_100198623 | 250 |
| 302 | 3300025919 | Ga0207657_10092861 | Ga0207657_100928612 | 250 |
| 303 | 3300025921 | Ga0207652_10132287 | Ga0207652_101322871 | 250 |
| 304 | 3300025924 | Ga0207694_10063171 | Ga0207694_100631712 | 250 |
| 305 | 3300025928 | Ga0207700_10199301 | Ga0207700_101993012 | 250 |
| 306 | 3300025933 | Ga0207706_10123127 | Ga0207706_101231272 | 250 |
| 307 | 3300025934 | Ga0207686_10003168 | Ga0207686_100031686 | 250 |
| 308 | 3300025938 | Ga0207704_10044669 | Ga0207704_100446692 | 250 |
| 309 | 3300025939 | Ga0207665_10025889 | Ga0207665_100258892 | 250 |
| 310 | 3300025941 | Ga0207711_10496167 | Ga0207711_104961672 | 250 |
| 311 | 3300025986 | Ga0207658_10048410 | Ga0207658_100484103 | 250 |
| 312 | 3300026023 | Ga0207677_10673376 | Ga0207677_106733761 | 250 |
| 313 | 3300026067 | Ga0207678_10043627 | Ga0207678_100436273 | 250 |
| 314 | 3300026075 | Ga0207708_10181252 | Ga0207708_101812522 | 250 |
| 315 | 3300026078 | Ga0207702_10093318 | Ga0207702_100933182 | 250 |
| 316 | 3300026121 | Ga0207683_10016464 | Ga0207683_100164642 | 250 |
| 317 | 3300035085 | Ga0373929_0014921 | Ga0373929_0014921_562_1383 | 250 |
| 318 | 3300035086 | Ga0373934_0003749 | Ga0373934_0003749_2618_3439 | 250 |
| 319 | 3300035089 | Ga0373944_0031713 | Ga0373944_0031713_202_1023 | 250 |
| 320 | 3300035111 | Ga0373923_0012189 | Ga0373923_0012189_1899_2720 | 250 |
| 321 | 3300035111 | Ga0373923_0015440 | Ga0373923_0015440_1327_2148 | 250 |
| 322 | 3300035118 | Ga0373954_0001346 | Ga0373954_0001346_6685_7506 | 250 |
| 323 | 3300035119 | Ga0373956_0024985 | Ga0373956_0024985_1542_2363 | 250 |
| 324 | 3300035120 | Ga0373957_0015792 | Ga0373957_0015792_562_1383 | 250 |
| 325 | 3300035172 | Ga0373955_0001882 | Ga0373955_0001882_3129_3950 | 250 |
| 326 | 3300035724 | Ga0373933_0002769 | Ga0373933_0002769_5844_6665 | 250 |
| 327 | 3300036401 | Ga0373937_0006739 | Ga0373937_0006739_7265_8086 | 250 |
| 328 | 3300037068 | Ga0373925_0330099 | Ga0373925_0330099_268_1089 | 250 |
| 329 | 3300046454 | Ga0495592_0018264 | Ga0495592_0018264_171_992 | 250 |
| 330 | 3300046461 | Ga0495641_0165525 | Ga0495641_0165525_66_887 | 250 |
| 331 | 3300046462 | Ga0495651_0010810 | Ga0495651_0010810_2101_2922 | 250 |
| 332 | 3300046463 | Ga0495653_0012969 | Ga0495653_0012969_5147_5968 | 250 |
| 333 | 3300046473 | Ga0495582_0273918 | Ga0495582_0273918_19_840 | 250 |
| 334 | 3300046476 | Ga0495662_0040419 | Ga0495662_0040419_1366_2187 | 250 |
| 335 | 3300046477 | Ga0495664_0003198 | Ga0495664_0003198_4977_5798 | 250 |
| 336 | 3300046477 | Ga0495664_0028886 | Ga0495664_0028886_1792_2613 | 250 |
| 337 | 3300046499 | Ga0495594_0025442 | Ga0495594_0025442_1000_1821 | 250 |
| 338 | 3300046511 | Ga0495608_0028120 | Ga0495608_0028120_2035_2856 | 250 |
| 339 | 3300046514 | Ga0495618_0002331 | Ga0495618_0002331_10577_11398 | 250 |
| 340 | 3300046516 | Ga0495628_0007123 | Ga0495628_0007123_4654_5475 | 250 |
| 341 | 3300046517 | Ga0495630_0045284 | Ga0495630_0045284_2417_3238 | 250 |
| 342 | 3300046526 | Ga0495666_0087148 | Ga0495666_0087148_505_1326 | 250 |
| 343 | 3300046529 | Ga0495652_0048649 | Ga0495652_0048649_2163_2984 | 250 |
| 344 | 3300046533 | Ga0495640_0008129 | Ga0495640_0008129_914_1735 | 250 |
| 345 | 3300046535 | Ga0495586_0037195 | Ga0495586_0037195_63_884 | 250 |
| 346 | 3300046536 | Ga0495587_0001044 | Ga0495587_0001044_14177_14998 | 250 |
| 347 | 3300046543 | Ga0495645_0001990 | Ga0495645_0001990_2513_3334 | 250 |
| 348 | 3300046543 | Ga0495645_0052865 | Ga0495645_0052865_463_1284 | 250 |
| 349 | 3300046559 | Ga0495667_0004872 | Ga0495667_0004872_820_1641 | 250 |
| 350 | 3300046642 | Ga0495634_0015598 | Ga0495634_0015598_1961_2782 | 250 |
| 351 | 3300046663 | Ga0495635_0009828 | Ga0495635_0009828_2594_3415 | 250 |
| 352 | 3300046663 | Ga0495635_0040935 | Ga0495635_0040935_1776_2597 | 250 |
| 353 | 3300046675 | Ga0495657_0002213 | Ga0495657_0002213_14372_15193 | 250 |
| 354 | 3300046678 | Ga0495599_0001186 | Ga0495599_0001186_7137_7958 | 250 |
| 355 | 3300046679 | Ga0495623_0003875 | Ga0495623_0003875_6880_7701 | 250 |
| 356 | 3300046680 | Ga0495646_0003107 | Ga0495646_0003107_8369_9190 | 250 |
| 357 | 3300046681 | Ga0495647_0104926 | Ga0495647_0104926_208_1029 | 250 |
| 358 | 3300046683 | Ga0495658_0032919 | Ga0495658_0032919_1526_2347 | 250 |
| 359 | 3300046689 | Ga0495613_0068219 | Ga0495613_0068219_1189_2010 | 250 |
| 360 | 3300046690 | Ga0495624_0028545 | Ga0495624_0028545_199_1020 | 250 |
| 361 | 3300046809 | Ga0495600_0002653 | Ga0495600_0002653_6104_6925 | 250 |
| 362 | 3300047315 | Ga0495581_0103529 | Ga0495581_0103529_425_1246 | 250 |
| 363 | 3300047317 | Ga0495604_0001816 | Ga0495604_0001816_14169_14990 | 250 |
| 364 | 3300047319 | Ga0495674_0010890 | Ga0495674_0010890_2845_3666 | 250 |
| 365 | 3300047319 | Ga0495674_0023062 | Ga0495674_0023062_2845_3666 | 250 |
| 366 | 3300047321 | Ga0495676_0179382 | Ga0495676_0179382_528_1349 | 250 |
| 367 | 3300047322 | Ga0495680_0003209 | Ga0495680_0003209_12336_13157 | 250 |
| 368 | 3300047322 | Ga0495680_0034028 | Ga0495680_0034028_805_1626 | 250 |
| 369 | 3300047444 | Ga0495675_0024808 | Ga0495675_0024808_1885_2706 | 250 |
| 370 | 3300047471 | Ga0495684_0009698 | Ga0495684_0009698_5516_6337 | 250 |
| 371 | 3300047673 | Ga0495593_0042607 | Ga0495593_0042607_483_1304 | 250 |
| 372 | 3300047673 | Ga0495593_0141805 | Ga0495593_0141805_322_1143 | 250 |
| 373 | 3300048088 | Ga0495602_0004062 | Ga0495602_0004062_8420_9241 | 250 |
| 374 | 3300048904 | Ga0496101_0077212 | Ga0496101_0077212_1254_2075 | 250 |
| 375 | 3300048909 | Ga0496106_0213804 | Ga0496106_0213804_389_1210 | 250 |
| 376 | 3300048910 | Ga0496107_0013936 | Ga0496107_0013936_4454_5275 | 250 |
| 377 | 3300048910 | Ga0496107_0125420 | Ga0496107_0125420_126_947 | 250 |
| 378 | 3300048911 | Ga0496108_0125315 | Ga0496108_0125315_828_1649 | 250 |
| 379 | 3300048913 | Ga0496110_0141302 | Ga0496110_0141302_152_973 | 250 |
| 380 | 3300048914 | Ga0496111_0193692 | Ga0496111_0193692_101_922 | 250 |
| 381 | 3300048915 | Ga0496112_0181405 | Ga0496112_0181405_775_1596 | 250 |
| 382 | 3300050513 | nmdc:mga0rr50_258687_c1 | nmdc:mga0rr50_258687_c1_577_1398 | 250 |
| 383 | 3300053077 | Ga0495601_0001947 | Ga0495601_0001947_10037_10858 | 250 |
| 384 | 3300053077 | Ga0495601_0056066 | Ga0495601_0056066_876_1697 | 250 |
| 385 | 3300053078 | Ga0495612_0014271 | Ga0495612_0014271_1593_2414 | 250 |
| 386 | 3300053078 | Ga0495612_0046223 | Ga0495612_0046223_876_1697 | 250 |
| 387 | 3300053084 | Ga0495595_0000210 | Ga0495595_0000210_14576_15397 | 250 |
| 388 | 3300053085 | Ga0495619_0021558 | Ga0495619_0021558_876_1697 | 250 |
| 389 | 3300053093 | Ga0500651_0279020 | Ga0500651_0279020_52_876 | 250 |
| 390 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_359540_360364 | 250 |
| 391 | 2162886007 | SwRhRL2b_contig_33951 | SwRhRL2b_0963.00004510 | 251 |
| 392 | 2209111006 | 2214828538 | 2213866829 | 251 |
| 393 | 3300000041 | ARcpr5oldR_c000313 | ARcpr5oldR_0003132 | 251 |
| 394 | 3300000042 | ARSoilYngRDRAFT_c00053 | ARSoilYngRDRAFT_0005314 | 251 |
| 395 | 3300000043 | ARcpr5yngRDRAFT_c000301 | ARcpr5yngRDRAFT_0003015 | 251 |
| 396 | 3300000044 | ARSoilOldRDRAFT_c000153 | ARSoilOldRDRAFT_0001532 | 251 |
| 397 | 3300000045 | ARCol0oldRDRAFT_c00420 | ARCol0oldRDRAFT_004202 | 251 |
| 398 | 3300000652 | ARCol0yngRDRAFT_1000331 | ARCol0yngRDRAFT_10003312 | 251 |
| 399 | 3300001430 | JGI24032J14994_100120 | JGI24032J14994_1001202 | 251 |
| 400 | 3300001915 | JGI24741J21665_1003546 | JGI24741J21665_10035462 | 251 |
| 401 | 3300001976 | JGI24752J21851_1002539 | JGI24752J21851_10025391 | 251 |
| 402 | 3300001977 | JGI24746J21847_1000814 | JGI24746J21847_10008142 | 251 |
| 403 | 3300001978 | JGI24747J21853_1009258 | JGI24747J21853_10092581 | 251 |
| 404 | 3300001989 | JGI24739J22299_10003550 | JGI24739J22299_100035504 | 251 |
| 405 | 3300001990 | JGI24737J22298_10000601 | JGI24737J22298_100006012 | 251 |
| 406 | 3300001990 | JGI24737J22298_10004158 | JGI24737J22298_100041585 | 251 |
| 407 | 3300002070 | JGI24750J21931_1000123 | JGI24750J21931_10001238 | 251 |
| 408 | 3300002073 | JGI24745J21846_1000297 | JGI24745J21846_10002972 | 251 |
| 409 | 3300002074 | JGI24748J21848_1000892 | JGI24748J21848_10008922 | 251 |
| 410 | 3300002075 | JGI24738J21930_10000038 | JGI24738J21930_1000003811 | 251 |
| 411 | 3300002076 | JGI24749J21850_1001514 | JGI24749J21850_10015142 | 251 |
| 412 | 3300002076 | JGI24749J21850_1007311 | JGI24749J21850_10073112 | 251 |
| 413 | 3300002126 | JGI24035J26624_1000111 | JGI24035J26624_10001116 | 251 |
| 414 | 3300002126 | JGI24035J26624_1000136 | JGI24035J26624_10001364 | 251 |
| 415 | 3300002126 | JGI24035J26624_1000723 | JGI24035J26624_10007232 | 251 |
| 416 | 3300002239 | JGI24034J26672_10000166 | JGI24034J26672_100001662 | 251 |
| 417 | 3300002459 | JGI24751J29686_10021534 | JGI24751J29686_100215341 | 251 |
| 418 | 3300003911 | JGI25405J52794_10009992 | JGI25405J52794_100099921 | 251 |
| 419 | 3300005277 | Ga0065716_1001869 | Ga0065716_10018692 | 251 |
| 420 | 3300005289 | Ga0065704_10004708 | Ga0065704_100047082 | 251 |
| 421 | 3300005290 | Ga0065712_10007259 | Ga0065712_100072592 | 251 |
| 422 | 3300005290 | Ga0065712_10069569 | Ga0065712_100695695 | 251 |
| 423 | 3300005290 | Ga0065712_10074939 | Ga0065712_100749393 | 251 |
| 424 | 3300005293 | Ga0065715_10091436 | Ga0065715_100914365 | 251 |
| 425 | 3300005295 | Ga0065707_10090977 | Ga0065707_100909772 | 251 |
| 426 | 3300005328 | Ga0070676_10000799 | Ga0070676_100007996 | 251 |
| 427 | 3300005329 | Ga0070683_100000121 | Ga0070683_10000012113 | 251 |
| 428 | 3300005330 | Ga0070690_100003148 | Ga0070690_1000031485 | 251 |
| 429 | 3300005330 | Ga0070690_100010712 | Ga0070690_1000107123 | 251 |
| 430 | 3300005331 | Ga0070670_100347819 | Ga0070670_1003478192 | 251 |
| 431 | 3300005333 | Ga0070677_10000173 | Ga0070677_1000017320 | 251 |
| 432 | 3300005334 | Ga0068869_100035313 | Ga0068869_1000353132 | 251 |
| 433 | 3300005335 | Ga0070666_10025730 | Ga0070666_100257302 | 251 |
| 434 | 3300005336 | Ga0070680_100009394 | Ga0070680_1000093942 | 251 |
| 435 | 3300005336 | Ga0070680_100242891 | Ga0070680_1002428912 | 251 |
| 436 | 3300005337 | Ga0070682_100000657 | Ga0070682_10000065710 | 251 |
| 437 | 3300005338 | Ga0068868_100003270 | Ga0068868_1000032707 | 251 |
| 438 | 3300005339 | Ga0070660_100005245 | Ga0070660_1000052456 | 251 |
| 439 | 3300005339 | Ga0070660_100032617 | Ga0070660_1000326172 | 251 |
| 440 | 3300005340 | Ga0070689_100002414 | Ga0070689_1000024148 | 251 |
| 441 | 3300005341 | Ga0070691_10000646 | Ga0070691_100006466 | 251 |
| 442 | 3300005344 | Ga0070661_100000532 | Ga0070661_10000053218 | 251 |
| 443 | 3300005345 | Ga0070692_10001016 | Ga0070692_100010168 | 251 |
| 444 | 3300005345 | Ga0070692_10061433 | Ga0070692_100614332 | 251 |
| 445 | 3300005347 | Ga0070668_100004720 | Ga0070668_1000047207 | 251 |
| 446 | 3300005347 | Ga0070668_100052767 | Ga0070668_1000527672 | 251 |
| 447 | 3300005353 | Ga0070669_100000271 | Ga0070669_10000027112 | 251 |
| 448 | 3300005353 | Ga0070669_100087105 | Ga0070669_1000871052 | 251 |
| 449 | 3300005354 | Ga0070675_100001127 | Ga0070675_1000011278 | 251 |
| 450 | 3300005355 | Ga0070671_100000771 | Ga0070671_10000077114 | 251 |
| 451 | 3300005356 | Ga0070674_100000116 | Ga0070674_10000011628 | 251 |
| 452 | 3300005364 | Ga0070673_100004024 | Ga0070673_1000040243 | 251 |
| 453 | 3300005365 | Ga0070688_100029442 | Ga0070688_1000294422 | 251 |
| 454 | 3300005366 | Ga0070659_100003582 | Ga0070659_1000035821 | 251 |
| 455 | 3300005367 | Ga0070667_100001755 | Ga0070667_10000175510 | 251 |
| 456 | 3300005406 | Ga0070703_10008628 | Ga0070703_100086282 | 251 |
| 457 | 3300005438 | Ga0070701_10022765 | Ga0070701_100227652 | 251 |
| 458 | 3300005440 | Ga0070705_100001685 | Ga0070705_1000016852 | 251 |
| 459 | 3300005441 | Ga0070700_100001234 | Ga0070700_1000012349 | 251 |
| 460 | 3300005441 | Ga0070700_100055522 | Ga0070700_1000555222 | 251 |
| 461 | 3300005444 | Ga0070694_100023465 | Ga0070694_1000234653 | 251 |
| 462 | 3300005445 | Ga0070708_100033540 | Ga0070708_1000335405 | 251 |
| 463 | 3300005455 | Ga0070663_100003065 | Ga0070663_1000030657 | 251 |
| 464 | 3300005456 | Ga0070678_100001829 | Ga0070678_1000018295 | 251 |
| 465 | 3300005457 | Ga0070662_100000164 | Ga0070662_1000001645 | 251 |
| 466 | 3300005457 | Ga0070662_100046957 | Ga0070662_1000469572 | 251 |
| 467 | 3300005458 | Ga0070681_10000701 | Ga0070681_1000070122 | 251 |
| 468 | 3300005459 | Ga0068867_100000082 | Ga0068867_10000008221 | 251 |
| 469 | 3300005466 | Ga0070685_10001328 | Ga0070685_100013285 | 251 |
| 470 | 3300005518 | Ga0070699_100133337 | Ga0070699_1001333372 | 251 |
| 471 | 3300005530 | Ga0070679_100006574 | Ga0070679_1000065741 | 251 |
| 472 | 3300005535 | Ga0070684_100001318 | Ga0070684_1000013183 | 251 |
| 473 | 3300005539 | Ga0068853_100130587 | Ga0068853_1001305872 | 251 |
| 474 | 3300005543 | Ga0070672_100000255 | Ga0070672_10000025520 | 251 |
| 475 | 3300005544 | Ga0070686_100001726 | Ga0070686_1000017268 | 251 |
| 476 | 3300005544 | Ga0070686_100414207 | Ga0070686_1004142072 | 251 |
| 477 | 3300005545 | Ga0070695_100001928 | Ga0070695_1000019288 | 251 |
| 478 | 3300005545 | Ga0070695_100029212 | Ga0070695_1000292122 | 251 |
| 479 | 3300005546 | Ga0070696_100006308 | Ga0070696_1000063082 | 251 |
| 480 | 3300005546 | Ga0070696_100066329 | Ga0070696_1000663292 | 251 |
| 481 | 3300005547 | Ga0070693_100000112 | Ga0070693_1000001123 | 251 |
| 482 | 3300005549 | Ga0070704_100001489 | Ga0070704_1000014898 | 251 |
| 483 | 3300005549 | Ga0070704_100009285 | Ga0070704_1000092852 | 251 |
| 484 | 3300005563 | Ga0068855_100008692 | Ga0068855_1000086922 | 251 |
| 485 | 3300005564 | Ga0070664_100000373 | Ga0070664_1000003732 | 251 |
| 486 | 3300005577 | Ga0068857_100000603 | Ga0068857_10000060314 | 251 |
| 487 | 3300005578 | Ga0068854_100000140 | Ga0068854_10000014040 | 251 |
| 488 | 3300005614 | Ga0068856_100002491 | Ga0068856_10000249119 | 251 |
| 489 | 3300005615 | Ga0070702_100000220 | Ga0070702_10000022010 | 251 |
| 490 | 3300005617 | Ga0068859_100008360 | Ga0068859_1000083602 | 251 |
| 491 | 3300005618 | Ga0068864_100000477 | Ga0068864_10000047730 | 251 |
| 492 | 3300005718 | Ga0068866_10000658 | Ga0068866_100006582 | 251 |
| 493 | 3300005719 | Ga0068861_100051959 | Ga0068861_1000519592 | 251 |
| 494 | 3300005719 | Ga0068861_100060572 | Ga0068861_1000605722 | 251 |
| 495 | 3300005840 | Ga0068870_10001108 | Ga0068870_100011087 | 251 |
| 496 | 3300005841 | Ga0068863_100002673 | Ga0068863_1000026737 | 251 |
| 497 | 3300005842 | Ga0068858_100007716 | Ga0068858_1000077162 | 251 |
| 498 | 3300005843 | Ga0068860_100006849 | Ga0068860_1000068493 | 251 |
| 499 | 3300005843 | Ga0068860_100105673 | Ga0068860_1001056732 | 251 |
| 500 | 3300005844 | Ga0068862_100007893 | Ga0068862_1000078936 | 251 |
| 501 | 3300005937 | Ga0081455_10008902 | Ga0081455_100089022 | 251 |
| 502 | 3300006058 | Ga0075432_10013533 | Ga0075432_100135331 | 251 |
| 503 | 3300006178 | Ga0075367_10002122 | Ga0075367_100021227 | 251 |
| 504 | 3300006237 | Ga0097621_100000083 | Ga0097621_10000008339 | 251 |
| 505 | 3300006358 | Ga0068871_100000067 | Ga0068871_10000006739 | 251 |
| 506 | 3300006852 | Ga0075433_10000023 | Ga0075433_1000002358 | 251 |
| 507 | 3300006852 | Ga0075433_10018499 | Ga0075433_100184992 | 251 |
| 508 | 3300006871 | Ga0075434_100000980 | Ga0075434_1000009809 | 251 |
| 509 | 3300006871 | Ga0075434_100520564 | Ga0075434_1005205642 | 251 |
| 510 | 3300006881 | Ga0068865_100000622 | Ga0068865_1000006229 | 251 |
| 511 | 3300006931 | Ga0097620_100008360 | Ga0097620_1000083602 | 251 |
| 512 | 3300007076 | Ga0075435_100003962 | Ga0075435_1000039622 | 251 |
| 513 | 3300009093 | Ga0105240_10244116 | Ga0105240_102441162 | 251 |
| 514 | 3300009094 | Ga0111539_10003501 | Ga0111539_1000350110 | 251 |
| 515 | 3300009094 | Ga0111539_10004884 | Ga0111539_1000488415 | 251 |
| 516 | 3300009098 | Ga0105245_10001233 | Ga0105245_1000123313 | 251 |
| 517 | 3300009098 | Ga0105245_10116944 | Ga0105245_101169442 | 251 |
| 518 | 3300009101 | Ga0105247_10001479 | Ga0105247_100014797 | 251 |
| 519 | 3300009101 | Ga0105247_10021338 | Ga0105247_100213382 | 251 |
| 520 | 3300009148 | Ga0105243_10002805 | Ga0105243_1000280511 | 251 |
| 521 | 3300009174 | Ga0105241_10001174 | Ga0105241_1000117411 | 251 |
| 522 | 3300009176 | Ga0105242_10000036 | Ga0105242_1000003657 | 251 |
| 523 | 3300009177 | Ga0105248_10004963 | Ga0105248_1000496311 | 251 |
| 524 | 3300009545 | Ga0105237_10005966 | Ga0105237_1000596611 | 251 |
| 525 | 3300009545 | Ga0105237_10313821 | Ga0105237_103138212 | 251 |
| 526 | 3300009551 | Ga0105238_10200201 | Ga0105238_102002012 | 251 |
| 527 | 3300009553 | Ga0105249_10001279 | Ga0105249_1000127912 | 251 |
| 528 | 3300009553 | Ga0105249_10005862 | Ga0105249_100058624 | 251 |
| 529 | 3300010375 | Ga0105239_10003292 | Ga0105239_100032929 | 251 |
| 530 | 3300011119 | Ga0105246_10001244 | Ga0105246_100012445 | 251 |
| 531 | 3300013102 | Ga0157371_10288013 | Ga0157371_102880132 | 251 |
| 532 | 3300013296 | Ga0157374_10001349 | Ga0157374_1000134910 | 251 |
| 533 | 3300013306 | Ga0163162_10001803 | Ga0163162_1000180310 | 251 |
| 534 | 3300013307 | Ga0157372_10533040 | Ga0157372_105330401 | 251 |
| 535 | 3300013308 | Ga0157375_10003554 | Ga0157375_100035547 | 251 |
| 536 | 3300014325 | Ga0163163_10007224 | Ga0163163_100072242 | 251 |
| 537 | 3300014325 | Ga0163163_10031750 | Ga0163163_100317503 | 251 |
| 538 | 3300014326 | Ga0157380_10000141 | Ga0157380_100001418 | 251 |
| 539 | 3300014745 | Ga0157377_10000124 | Ga0157377_1000012439 | 251 |
| 540 | 3300014968 | Ga0157379_10003074 | Ga0157379_100030745 | 251 |
| 541 | 3300014968 | Ga0157379_10013614 | Ga0157379_100136142 | 251 |
| 542 | 3300017792 | Ga0163161_10002816 | Ga0163161_100028165 | 251 |
| 543 | 3300025263 | Ga0209565_1000331 | Ga0209565_100033113 | 251 |
| 544 | 3300025271 | Ga0207666_1000192 | Ga0207666_10001922 | 251 |
| 545 | 3300025290 | Ga0207673_1000006 | Ga0207673_10000064 | 251 |
| 546 | 3300025291 | Ga0209675_1001925 | Ga0209675_10019253 | 251 |
| 547 | 3300025294 | Ga0209025_1037899 | Ga0209025_10378992 | 251 |
| 548 | 3300025315 | Ga0207697_10000039 | Ga0207697_1000003939 | 251 |
| 549 | 3300025315 | Ga0207697_10054462 | Ga0207697_100544622 | 251 |
| 550 | 3300025885 | Ga0207653_10003137 | Ga0207653_100031372 | 251 |
| 551 | 3300025893 | Ga0207682_10000135 | Ga0207682_1000013531 | 251 |
| 552 | 3300025899 | Ga0207642_10000274 | Ga0207642_1000027410 | 251 |
| 553 | 3300025900 | Ga0207710_10006877 | Ga0207710_100068772 | 251 |
| 554 | 3300025901 | Ga0207688_10003046 | Ga0207688_100030462 | 251 |
| 555 | 3300025901 | Ga0207688_10051095 | Ga0207688_100510952 | 251 |
| 556 | 3300025903 | Ga0207680_10023583 | Ga0207680_100235832 | 251 |
| 557 | 3300025904 | Ga0207647_10001409 | Ga0207647_100014099 | 251 |
| 558 | 3300025904 | Ga0207647_10094134 | Ga0207647_100941342 | 251 |
| 559 | 3300025907 | Ga0207645_10000114 | Ga0207645_1000011412 | 251 |
| 560 | 3300025908 | Ga0207643_10000134 | Ga0207643_1000013442 | 251 |
| 561 | 3300025911 | Ga0207654_10000402 | Ga0207654_1000040212 | 251 |
| 562 | 3300025912 | Ga0207707_10003615 | Ga0207707_100036159 | 251 |
| 563 | 3300025912 | Ga0207707_10042718 | Ga0207707_100427182 | 251 |
| 564 | 3300025914 | Ga0207671_10014739 | Ga0207671_100147395 | 251 |
| 565 | 3300025917 | Ga0207660_10000034 | Ga0207660_1000003419 | 251 |
| 566 | 3300025917 | Ga0207660_10180918 | Ga0207660_101809182 | 251 |
| 567 | 3300025918 | Ga0207662_10002535 | Ga0207662_100025352 | 251 |
| 568 | 3300025918 | Ga0207662_10020419 | Ga0207662_100204192 | 251 |
| 569 | 3300025919 | Ga0207657_10000425 | Ga0207657_1000042512 | 251 |
| 570 | 3300025919 | Ga0207657_10039018 | Ga0207657_100390183 | 251 |
| 571 | 3300025920 | Ga0207649_10000142 | Ga0207649_100001428 | 251 |
| 572 | 3300025921 | Ga0207652_10001667 | Ga0207652_1000166717 | 251 |
| 573 | 3300025921 | Ga0207652_10079746 | Ga0207652_100797462 | 251 |
| 574 | 3300025923 | Ga0207681_10000065 | Ga0207681_1000006547 | 251 |
| 575 | 3300025925 | Ga0207650_10356289 | Ga0207650_103562892 | 251 |
| 576 | 3300025926 | Ga0207659_10000078 | Ga0207659_1000007852 | 251 |
| 577 | 3300025927 | Ga0207687_10000125 | Ga0207687_1000012552 | 251 |
| 578 | 3300025931 | Ga0207644_10003174 | Ga0207644_1000317410 | 251 |
| 579 | 3300025932 | Ga0207690_10000200 | Ga0207690_100002008 | 251 |
| 580 | 3300025933 | Ga0207706_10000435 | Ga0207706_1000043531 | 251 |
| 581 | 3300025933 | Ga0207706_10032289 | Ga0207706_100322894 | 251 |
| 582 | 3300025934 | Ga0207686_10000251 | Ga0207686_1000025136 | 251 |
| 583 | 3300025935 | Ga0207709_10000183 | Ga0207709_1000018339 | 251 |
| 584 | 3300025936 | Ga0207670_10001020 | Ga0207670_100010203 | 251 |
| 585 | 3300025937 | Ga0207669_10000081 | Ga0207669_1000008114 | 251 |
| 586 | 3300025938 | Ga0207704_10000419 | Ga0207704_1000041913 | 251 |
| 587 | 3300025940 | Ga0207691_10002274 | Ga0207691_100022748 | 251 |
| 588 | 3300025940 | Ga0207691_10188363 | Ga0207691_101883632 | 251 |
| 589 | 3300025941 | Ga0207711_10000766 | Ga0207711_1000076628 | 251 |
| 590 | 3300025942 | Ga0207689_10000144 | Ga0207689_1000014442 | 251 |
| 591 | 3300025944 | Ga0207661_10000670 | Ga0207661_100006702 | 251 |
| 592 | 3300025945 | Ga0207679_10000064 | Ga0207679_1000006454 | 251 |
| 593 | 3300025949 | Ga0207667_10011544 | Ga0207667_100115444 | 251 |
| 594 | 3300025960 | Ga0207651_10001490 | Ga0207651_100014904 | 251 |
| 595 | 3300025961 | Ga0207712_10001565 | Ga0207712_100015654 | 251 |
| 596 | 3300025961 | Ga0207712_10025428 | Ga0207712_100254282 | 251 |
| 597 | 3300025972 | Ga0207668_10000162 | Ga0207668_100001628 | 251 |
| 598 | 3300025972 | Ga0207668_10006356 | Ga0207668_100063564 | 251 |
| 599 | 3300025981 | Ga0207640_10001145 | Ga0207640_100011459 | 251 |
| 600 | 3300025986 | Ga0207658_10001102 | Ga0207658_100011029 | 251 |
| 601 | 3300026035 | Ga0207703_10006015 | Ga0207703_100060154 | 251 |
| 602 | 3300026041 | Ga0207639_10002011 | Ga0207639_1000201112 | 251 |
| 603 | 3300026041 | Ga0207639_10074311 | Ga0207639_100743112 | 251 |
| 604 | 3300026067 | Ga0207678_10000344 | Ga0207678_1000034431 | 251 |
| 605 | 3300026075 | Ga0207708_10004403 | Ga0207708_100044032 | 251 |
| 606 | 3300026075 | Ga0207708_10176850 | Ga0207708_101768502 | 251 |
| 607 | 3300026078 | Ga0207702_10003261 | Ga0207702_100032617 | 251 |
| 608 | 3300026078 | Ga0207702_10373027 | Ga0207702_103730272 | 251 |
| 609 | 3300026088 | Ga0207641_10000941 | Ga0207641_100009412 | 251 |
| 610 | 3300026089 | Ga0207648_10009121 | Ga0207648_100091212 | 251 |
| 611 | 3300026095 | Ga0207676_10000079 | Ga0207676_1000007948 | 251 |
| 612 | 3300026116 | Ga0207674_10000323 | Ga0207674_1000032312 | 251 |
| 613 | 3300026118 | Ga0207675_100000270 | Ga0207675_10000027039 | 251 |
| 614 | 3300026118 | Ga0207675_100072520 | Ga0207675_1000725202 | 251 |
| 615 | 3300026121 | Ga0207683_10000037 | Ga0207683_1000003752 | 251 |
| 616 | 3300027526 | Ga0209968_1007176 | Ga0209968_10071762 | 251 |
| 617 | 3300027617 | Ga0210002_1000408 | Ga0210002_10004085 | 251 |
| 618 | 3300027682 | Ga0209971_1004232 | Ga0209971_10042321 | 251 |
| 619 | 3300027682 | Ga0209971_1005256 | Ga0209971_10052562 | 251 |
| 620 | 3300027682 | Ga0209971_1015152 | Ga0209971_10151522 | 251 |
| 621 | 3300027717 | Ga0209998_10015227 | Ga0209998_100152272 | 251 |
| 622 | 3300027876 | Ga0209974_10000966 | Ga0209974_100009662 | 251 |
| 623 | 3300027876 | Ga0209974_10036917 | Ga0209974_100369172 | 251 |
| 624 | 3300027907 | Ga0207428_10000292 | Ga0207428_1000029241 | 251 |
| 625 | 3300027907 | Ga0207428_10001579 | Ga0207428_1000157914 | 251 |
| 626 | 3300027907 | Ga0207428_10003547 | Ga0207428_1000354710 | 251 |
| 627 | 3300028379 | Ga0268266_10036702 | Ga0268266_100367023 | 251 |
| 628 | 3300028380 | Ga0268265_10001049 | Ga0268265_100010498 | 251 |
| 629 | 3300028380 | Ga0268265_10042149 | Ga0268265_100421492 | 251 |
| 630 | 3300028381 | Ga0268264_10000583 | Ga0268264_1000058310 | 251 |
| 631 | 3300028381 | Ga0268264_10062581 | Ga0268264_100625812 | 251 |
| 632 | 3300034816 | Ga0373930_0000021 | Ga0373930_0000021_12164_12988 | 251 |
| 633 | 3300034817 | Ga0373948_0010220 | Ga0373948_0010220_276_1100 | 251 |
| 634 | 3300034818 | Ga0373950_0000378 | Ga0373950_0000378_3721_4545 | 251 |
| 635 | 3300034819 | Ga0373958_0001112 | Ga0373958_0001112_1943_2767 | 251 |
| 636 | 3300034819 | Ga0373958_0002233 | Ga0373958_0002233_1697_2521 | 251 |
| 637 | 3300034820 | Ga0373959_0000359 | Ga0373959_0000359_640_1464 | 251 |
| 638 | 3300034957 | Ga0373938_0000071 | Ga0373938_0000071_698_1522 | 251 |
| 639 | 3300034957 | Ga0373938_0008054 | Ga0373938_0008054_520_1344 | 251 |
| 640 | 3300035084 | Ga0373928_0000327 | Ga0373928_0000327_4392_5216 | 251 |
| 641 | 3300035085 | Ga0373929_0000383 | Ga0373929_0000383_6084_6908 | 251 |
| 642 | 3300035085 | Ga0373929_0012950 | Ga0373929_0012950_275_1099 | 251 |
| 643 | 3300035090 | Ga0373949_0001992 | Ga0373949_0001992_4359_5183 | 251 |
| 644 | 3300035090 | Ga0373949_0005070 | Ga0373949_0005070_506_1330 | 251 |
| 645 | 3300035091 | Ga0373951_0000680 | Ga0373951_0000680_7753_8577 | 251 |
| 646 | 3300035091 | Ga0373951_0016149 | Ga0373951_0016149_612_1436 | 251 |
| 647 | 3300035092 | Ga0373952_0000018 | Ga0373952_0000018_1454_2278 | 251 |
| 648 | 3300035112 | Ga0373932_0001209 | Ga0373932_0001209_5728_6552 | 251 |
| 649 | 3300035112 | Ga0373932_0007755 | Ga0373932_0007755_531_1355 | 251 |
| 650 | 3300035114 | Ga0373939_0000588 | Ga0373939_0000588_7452_8276 | 251 |
| 651 | 3300035114 | Ga0373939_0037201 | Ga0373939_0037201_20_844 | 251 |
| 652 | 3300035115 | Ga0373941_0010419 | Ga0373941_0010419_277_1101 | 251 |
| 653 | 3300035121 | Ga0373960_0003427 | Ga0373960_0003427_1981_2805 | 251 |
| 654 | 3300035121 | Ga0373960_0008483 | Ga0373960_0008483_434_1258 | 251 |
| 655 | 3300035207 | Ga0373942_0005273 | Ga0373942_0005273_1033_1857 | 251 |
| 656 | 3300035207 | Ga0373942_0008670 | Ga0373942_0008670_1397_2221 | 251 |
| 657 | 3300035241 | Ga0373961_0002538 | Ga0373961_0002538_3032_3856 | 251 |
| 658 | 3300035241 | Ga0373961_0003990 | Ga0373961_0003990_2240_3064 | 251 |
| 659 | 3300035242 | Ga0373962_0000206 | Ga0373962_0000206_9932_10756 | 251 |
| 660 | 3300035691 | Ga0373931_0000727 | Ga0373931_0000727_4434_5258 | 251 |
| 661 | 3300038996 | Ga0242420_002702 | Ga0242420_002702_1576_2400 | 251 |
| 662 | 3300042016 | Ga0439463_026509 | Ga0439463_026509_219_1043 | 251 |
| 663 | 3300042439 | Ga0439464_0008938 | Ga0439464_0008938_425_1249 | 251 |
| 664 | 3300042876 | Ga0451577_0150468 | Ga0451577_0150468_640_1464 | 251 |
| 665 | 3300044712 | Ga0453684_0297295 | Ga0453684_0297295_276_1100 | 251 |
| 666 | 3300046460 | Ga0495638_0024123 | Ga0495638_0024123_1932_2756 | 251 |
| 667 | 3300046491 | Ga0495584_0044146 | Ga0495584_0044146_910_1734 | 251 |
| 668 | 3300046684 | Ga0495669_0065482 | Ga0495669_0065482_499_1323 | 251 |
| 669 | 3300048903 | Ga0496100_0000172 | Ga0496100_0000172_31100_31924 | 251 |
| 670 | 3300048904 | Ga0496101_0000406 | Ga0496101_0000406_20515_21339 | 251 |
| 671 | 3300048905 | Ga0496102_0006743 | Ga0496102_0006743_3870_4694 | 251 |
| 672 | 3300048905 | Ga0496102_0157367 | Ga0496102_0157367_244_1068 | 251 |
| 673 | 3300048906 | Ga0496103_0002977 | Ga0496103_0002977_5111_5935 | 251 |
| 674 | 3300048907 | Ga0496104_0115052 | Ga0496104_0115052_1113_1937 | 251 |
| 675 | 3300048908 | Ga0496105_0260008 | Ga0496105_0260008_339_1163 | 251 |
| 676 | 3300048909 | Ga0496106_0005006 | Ga0496106_0005006_5111_5935 | 251 |
| 677 | 3300048909 | Ga0496106_0015033 | Ga0496106_0015033_3253_4077 | 251 |
| 678 | 3300048910 | Ga0496107_0000560 | Ga0496107_0000560_9890_10714 | 251 |
| 679 | 3300048910 | Ga0496107_0165894 | Ga0496107_0165894_463_1287 | 251 |
| 680 | 3300048911 | Ga0496108_0006778 | Ga0496108_0006778_7358_8182 | 251 |
| 681 | 3300048911 | Ga0496108_0045231 | Ga0496108_0045231_383_1207 | 251 |
| 682 | 3300048911 | Ga0496108_0443305 | Ga0496108_0443305_287_1111 | 251 |
| 683 | 3300048912 | Ga0496109_0000260 | Ga0496109_0000260_37706_38530 | 251 |
| 684 | 3300048912 | Ga0496109_0001609 | Ga0496109_0001609_10909_11733 | 251 |
| 685 | 3300048913 | Ga0496110_0190051 | Ga0496110_0190051_670_1494 | 251 |
| 686 | 3300048913 | Ga0496110_0338644 | Ga0496110_0338644_64_888 | 251 |
| 687 | 3300048914 | Ga0496111_0091813 | Ga0496111_0091813_1248_2072 | 251 |
| 688 | 3300048915 | Ga0496112_0063965 | Ga0496112_0063965_1380_2204 | 251 |
| 689 | 3300048916 | Ga0496113_0000719 | Ga0496113_0000719_9386_10210 | 251 |
| 690 | 3300048916 | Ga0496113_0207870 | Ga0496113_0207870_595_1419 | 251 |
| 691 | 3300048917 | Ga0496114_0000689 | Ga0496114_0000689_3780_4604 | 251 |
| 692 | 3300048918 | Ga0496115_0010342 | Ga0496115_0010342_4411_5235 | 251 |
| 693 | 3300050495 | nmdc:mga04h51_15605_c1 | nmdc:mga04h51_15605_c1_1031_1855 | 251 |
| 694 | 3300050496 | nmdc:mga07m45_76269_c1 | nmdc:mga07m45_76269_c1_51_875 | 251 |
| 695 | 3300050508 | nmdc:mga09592_305_c1 | nmdc:mga09592_305_c1_20031_20855 | 251 |
| 696 | 3300050509 | nmdc:mga0qj67_690_c1 | nmdc:mga0qj67_690_c1_16846_17670 | 251 |
| 697 | 3300050511 | nmdc:mga08y16_108532_c1 | nmdc:mga08y16_108532_c1_142_966 | 251 |
| 698 | 3300050511 | nmdc:mga08y16_2782_c1 | nmdc:mga08y16_2782_c1_816_1640 | 251 |
| 699 | 3300050511 | nmdc:mga08y16_70534_c1 | nmdc:mga08y16_70534_c1_252_1076 | 251 |
| 700 | 3300050512 | nmdc:mga0n895_495822_c1 | nmdc:mga0n895_495822_c1_171_995 | 251 |
| 701 | 3300050512 | nmdc:mga0n895_512_c1 | nmdc:mga0n895_512_c1_22485_23309 | 251 |
| 702 | 3300050512 | nmdc:mga0n895_636_c1 | nmdc:mga0n895_636_c1_13614_14438 | 251 |
| 703 | 3300050513 | nmdc:mga0rr50_16801_c1 | nmdc:mga0rr50_16801_c1_2534_3358 | 251 |
| 704 | 3300050515 | nmdc:mga0a205_9418_c1 | nmdc:mga0a205_9418_c1_7401_8225 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wwr-assembly2.cif.gz_B | crystal structure of human nsun6/trna/sfg | 0.9151 | 69 | 125 |
| 2b9e-assembly1.cif.gz_A | human nsun5 protein | 0.8946 | 69 | 128 |
| 5dnk-assembly1.cif.gz_B | the structure of pkmt1 from rickettsia prowazekii in complex with adohcy | 0.8478 | 69 | 128 |
| 5wwq-assembly1.cif.gz_A | crystal structure of human nsun6 | 0.8415 | 73 | 125 |
| 7ogj-assembly1.cif.gz_A | crystal structure of human mettl1 in complex with sah | 0.8254 | 70 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8TEA1_224_469_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9168 | 69 | 125 | 3.40.50.150 |
| af_Q8L8R4_95_308_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9083 | 72 | 124 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9073 | 71 | 128 | 3.40.50.150 |
| af_Q96P11_211_428_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9032 | 69 | 128 | 3.40.50.150 |
| 4kigA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8739 | 71 | 128 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5R0D4-F1-model_v4 | FkbM family methyltransferase | 0.9743 | 3 | 237 |
GO:0008168
GO:0032259 |
| AF-A0A258NV33-F1-model_v4 | FkbM family methyltransferase | 0.9737 | 20 | 240 |
GO:0008168
GO:0032259 |
| AF-A0A2S5N492-F1-model_v4 | FkbM family methyltransferase | 0.9692 | 69 | 237 |
GO:0008168
GO:0032259 |
| AF-A0A3S5F5F4-F1-model_v4 | deleted | 0.9644 | 1 | 130 |
|
| AF-A0A522IDU9-F1-model_v4 | FkbM family methyltransferase | 0.9614 | 1 | 243 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar