F476357

General Info

Members Datasets Scaffolds Average Seq Length
704 399 700 260

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1037899|Ga0209025_10378992
Length 295
Sequence MTLPRRPLPFVLCSSNHGTMIVNYKDSRMVNATAGYGVGHQLLNNACFDPSEIDMVLQLLTARRRTAGDGVVALDCGANIGVHSIEWARHMHQWGRVLAFEAQERIYYALAGNIALNNCFNARAFHVALGERAGRLRIPQPDYNRSASFGSLELRRNSRTEYIGQNISYEDADCEQVDMMAIDDLCVEGMELDVLAGASRSIEKYKPLMLIEQIKVDSQRLQQWLKEKGYVVYPMGMNVLAIHPSDPVSTQLQVTPAQPRGPGLHPADGFVRRRPLNPGAPAQDAHSPVPRCEDL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
5 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
6 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
7 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
8 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
9 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
10 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
11 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
12 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
13 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
16 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
17 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
25 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
226 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
227 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
239 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
240 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
244 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
277 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
387 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
388 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
389 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
398 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0.28
Rhizoplane 4.83
Rhizosphere 87.64
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_33951 2162886007 Bacteria 1922
2 2214828538 2209111006 Bacteria 9342
3 ARcpr5oldR_c000313 3300000041 Bacteria 7024
4 ARSoilYngRDRAFT_c00053 3300000042 Bacteria 18603
5 ARcpr5yngRDRAFT_c000301 3300000043 Bacteria 6968
6 ARSoilOldRDRAFT_c000153 3300000044 Bacteria 11685
7 ARCol0oldRDRAFT_c00420 3300000045 Bacteria 4070
8 ARCol0yngRDRAFT_1000331 3300000652 Bacteria 6976
9 JGI24032J14994_100120 3300001430 Bacteria 3680
10 JGI24741J21665_1003546 3300001915 Bacteria 3690
11 JGI24752J21851_1002539 3300001976 Bacteria 2430
12 JGI24746J21847_1000814 3300001977 Bacteria 4819
13 JGI24747J21853_1009258 3300001978 Bacteria 971
14 JGI24739J22299_10003550 3300001989 Bacteria 5961
15 JGI24737J22298_10000601 3300001990 Bacteria 12667
16 JGI24737J22298_10004158 3300001990 Bacteria 5058
17 JGI24750J21931_1000123 3300002070 Bacteria 12402
18 JGI24745J21846_1000297 3300002073 Bacteria 4247
19 JGI24748J21848_1000892 3300002074 Bacteria 3232
20 JGI24738J21930_10000038 3300002075 Bacteria 25424
21 JGI24749J21850_1001514 3300002076 Bacteria 3286
22 JGI24749J21850_1007311 3300002076 Bacteria 1539
23 JGI24035J26624_1000111 3300002126 Bacteria 7064
24 JGI24035J26624_1000136 3300002126 Bacteria 6497
25 JGI24035J26624_1000723 3300002126 Bacteria 3091
26 JGI24034J26672_10000166 3300002239 Bacteria 9279
27 JGI24751J29686_10021534 3300002459 Bacteria 1336
28 JGI25153J46596_10022247 3300003215 Bacteria 2343
29 rootH2_10012201 3300003320 Bacteria 10572
30 JGI25405J52794_10009992 3300003911 Bacteria 1801
31 Ga0065716_1001869 3300005277 Bacteria 2953
32 Ga0065704_10004708 3300005289 Bacteria 4266
33 Ga0065712_10007259 3300005290 Bacteria 3518
34 Ga0065712_10069569 3300005290 Bacteria 7041
35 Ga0065712_10074939 3300005290 Bacteria 3975
36 Ga0065715_10091436 3300005293 Bacteria 5771
37 Ga0065707_10090977 3300005295 Bacteria 4028
38 Ga0070676_10000799 3300005328 Bacteria 15558
39 Ga0070683_100000121 3300005329 Bacteria 50845
40 Ga0070683_100026074 3300005329 Bacteria 5257
41 Ga0070683_100073252 3300005329 Bacteria 3198
42 Ga0070683_100264664 3300005329 Bacteria 1636
43 Ga0070690_100003148 3300005330 Bacteria 8985
44 Ga0070690_100010712 3300005330 Bacteria 5345
45 Ga0070670_100347819 3300005331 Bacteria 1302
46 Ga0070677_10000173 3300005333 Bacteria 22439
47 Ga0068869_100035313 3300005334 Bacteria 3542
48 Ga0070666_10025730 3300005335 Bacteria 3839
49 Ga0070680_100009394 3300005336 Bacteria 7513
50 Ga0070680_100118497 3300005336 Bacteria 2208
51 Ga0070680_100191574 3300005336 Unclassified 1723
52 Ga0070680_100242891 3300005336 Bacteria 1522
53 Ga0070680_100519650 3300005336 Bacteria 1019
54 Ga0070682_100000657 3300005337 Bacteria 20972
55 Ga0070682_100050171 3300005337 Bacteria 2604
56 Ga0068868_100003270 3300005338 Bacteria 11282
57 Ga0070660_100005245 3300005339 Bacteria 8959
58 Ga0070660_100032617 3300005339 Bacteria 3920
59 Ga0070689_100002414 3300005340 Bacteria 12212
60 Ga0070691_10000646 3300005341 Bacteria 13462
61 Ga0070661_100000532 3300005344 Bacteria 29218
62 Ga0070661_100149064 3300005344 Bacteria 1767
63 Ga0070661_100383775 3300005344 Bacteria 1108
64 Ga0070692_10001016 3300005345 Bacteria 9656
65 Ga0070692_10061433 3300005345 Bacteria 1980
66 Ga0070668_100004720 3300005347 Bacteria 10102
67 Ga0070668_100052767 3300005347 Bacteria 3135
68 Ga0070669_100000271 3300005353 Bacteria 41957
69 Ga0070669_100087105 3300005353 Bacteria 2334
70 Ga0070675_100001127 3300005354 Bacteria 19307
71 Ga0070671_100000771 3300005355 Bacteria 23007
72 Ga0070674_100000116 3300005356 Bacteria 37121
73 Ga0070673_100004024 3300005364 Bacteria 9255
74 Ga0070673_100031056 3300005364 Bacteria 4006
75 Ga0070688_100029442 3300005365 Bacteria 3288
76 Ga0070659_100003582 3300005366 Bacteria 11048
77 Ga0070667_100001755 3300005367 Bacteria 19329
78 Ga0070703_10008628 3300005406 Bacteria 2868
79 Ga0070709_10003284 3300005434 Bacteria 8697
80 Ga0070709_10173471 3300005434 Bacteria 1509
81 Ga0070709_10195621 3300005434 Bacteria 1429
82 Ga0070714_100026630 3300005435 Bacteria 4781
83 Ga0070714_100228408 3300005435 Bacteria 1713
84 Ga0070713_100001721 3300005436 Bacteria 14092
85 Ga0070713_100137115 3300005436 Bacteria 2163
86 Ga0070710_10009699 3300005437 Bacteria 4716
87 Ga0070710_10018284 3300005437 Bacteria 3604
88 Ga0070701_10022765 3300005438 Bacteria 3008
89 Ga0070711_100020384 3300005439 Bacteria 4272
90 Ga0070711_100022380 3300005439 Bacteria 4096
91 Ga0070711_100028549 3300005439 Bacteria 3672
92 Ga0070705_100001685 3300005440 Bacteria 11573
93 Ga0070700_100001234 3300005441 Bacteria 12671
94 Ga0070700_100055522 3300005441 Bacteria 2479
95 Ga0070694_100023465 3300005444 Bacteria 3968
96 Ga0070708_100033540 3300005445 Bacteria 4461
97 Ga0070708_100180278 3300005445 Bacteria 1974
98 Ga0070663_100003065 3300005455 Bacteria 9554
99 Ga0070663_100078045 3300005455 Bacteria 2426
100 Ga0070678_100001829 3300005456 Bacteria 11472
101 Ga0070662_100000164 3300005457 Bacteria 38586
102 Ga0070662_100046957 3300005457 Bacteria 3104
103 Ga0070681_10000701 3300005458 Bacteria 27812
104 Ga0070681_10009919 3300005458 Bacteria 9386
105 Ga0070681_10011117 3300005458 Bacteria 8910
106 Ga0070681_10059021 3300005458 Bacteria 3816
107 Ga0070681_10091277 3300005458 Bacteria 2996
108 Ga0070681_10172203 3300005458 Bacteria 2087
109 Ga0070681_10206772 3300005458 Bacteria 1880
110 Ga0068867_100000082 3300005459 Bacteria 59236
111 Ga0070685_10001328 3300005466 Bacteria 12994
112 Ga0070707_100193337 3300005468 Bacteria 1984
113 Ga0070699_100133337 3300005518 Bacteria 2190
114 Ga0070679_100006574 3300005530 Bacteria 10830
115 Ga0070679_100142030 3300005530 Bacteria 2380
116 Ga0070679_100226764 3300005530 Bacteria 1828
117 Ga0070684_100001318 3300005535 Bacteria 17770
118 Ga0070684_100016560 3300005535 Bacteria 6028
119 Ga0070684_100017018 3300005535 Bacteria 5958
120 Ga0068853_100130587 3300005539 Bacteria 2248
121 Ga0068853_100288262 3300005539 Bacteria 1515
122 Ga0070672_100000255 3300005543 Bacteria 30160
123 Ga0070686_100001726 3300005544 Bacteria 12212
124 Ga0070686_100414207 3300005544 Unclassified 1028
125 Ga0070695_100001928 3300005545 Bacteria 11747
126 Ga0070695_100029212 3300005545 Bacteria 3424
127 Ga0070696_100006308 3300005546 Bacteria 7940
128 Ga0070696_100032178 3300005546 Unclassified 3598
129 Ga0070696_100066329 3300005546 Bacteria 2531
130 Ga0070693_100000112 3300005547 Bacteria 36249
131 Ga0070693_100180122 3300005547 Bacteria 1360
132 Ga0070704_100001489 3300005549 Bacteria 12586
133 Ga0070704_100009285 3300005549 Bacteria 5933
134 Ga0068855_100008692 3300005563 Bacteria 12277
135 Ga0070664_100000373 3300005564 Bacteria 33223
136 Ga0068857_100000603 3300005577 Bacteria 26431
137 Ga0068857_100599543 3300005577 Bacteria 1041
138 Ga0068854_100000140 3300005578 Bacteria 50187
139 Ga0068856_100002491 3300005614 Bacteria 18952
140 Ga0068856_100095310 3300005614 Bacteria 2964
141 Ga0070702_100000220 3300005615 Bacteria 19201
142 Ga0068859_100008360 3300005617 Bacteria 10488
143 Ga0068864_100000477 3300005618 Bacteria 34661
144 Ga0068866_10000658 3300005718 Bacteria 15718
145 Ga0068861_100051959 3300005719 Bacteria 3113
146 Ga0068861_100060572 3300005719 Bacteria 2901
147 Ga0068870_10001108 3300005840 Bacteria 10725
148 Ga0068863_100002673 3300005841 Bacteria 17620
149 Ga0068858_100007716 3300005842 Bacteria 10388
150 Ga0068858_100124306 3300005842 Bacteria 2415
151 Ga0068860_100006849 3300005843 Bacteria 11427
152 Ga0068860_100105673 3300005843 Bacteria 2689
153 Ga0068862_100007893 3300005844 Bacteria 8808
154 Ga0081455_10008902 3300005937 Bacteria 10380
155 Ga0081455_10039366 3300005937 Bacteria 4178
156 Ga0081540_1033505 3300005983 Bacteria 2788
157 Ga0081540_1053606 3300005983 Bacteria 1977
158 Ga0081540_1081415 3300005983 Bacteria 1456
159 Ga0070717_10004642 3300006028 Bacteria 9960
160 Ga0070717_10278863 3300006028 Bacteria 1482
161 Ga0075432_10013533 3300006058 Bacteria 2772
162 Ga0070715_10128967 3300006163 Bacteria 1215
163 Ga0070716_100046342 3300006173 Bacteria 2446
164 Ga0070716_100360750 3300006173 Bacteria 1032
165 Ga0070712_100020552 3300006175 Bacteria 4321
166 Ga0075367_10002122 3300006178 Bacteria 8920
167 Ga0097621_100000083 3300006237 Bacteria 50576
168 Ga0097621_100027474 3300006237 Bacteria 4475
169 Ga0068871_100000067 3300006358 Bacteria 57681
170 Ga0068871_100139170 3300006358 Bacteria 2063
171 Ga0068871_100274802 3300006358 Bacteria 1472
172 Ga0075433_10000023 3300006852 Bacteria 59195
173 Ga0075433_10018499 3300006852 Bacteria 5794
174 Ga0075434_100000980 3300006871 Bacteria 23061
175 Ga0075434_100073196 3300006871 Bacteria 3419
176 Ga0075434_100520564 3300006871 Bacteria 1210
177 Ga0068865_100000622 3300006881 Bacteria 19947
178 Ga0068865_100063289 3300006881 Unclassified 2600
179 Ga0097620_100008360 3300006931 Bacteria 10488
180 Ga0075435_100003962 3300007076 Bacteria 10121
181 Ga0075435_100188240 3300007076 Unclassified 1746
182 Ga0099794_10165543 3300007265 Bacteria 1126
183 Ga0105240_10061993 3300009093 Bacteria 4657
184 Ga0105240_10244116 3300009093 Bacteria 2080
185 Ga0105240_10498577 3300009093 Bacteria 1354
186 Ga0111539_10003501 3300009094 Bacteria 20704
187 Ga0111539_10004884 3300009094 Bacteria 17454
188 Ga0105245_10001233 3300009098 Bacteria 23079
189 Ga0105245_10100285 3300009098 Unclassified 2678
190 Ga0105245_10116944 3300009098 Bacteria 2486
191 Ga0105247_10001479 3300009101 Bacteria 16887
192 Ga0105247_10021338 3300009101 Bacteria 3897
193 Ga0105243_10002805 3300009148 Bacteria 14474
194 Ga0105241_10001174 3300009174 Bacteria 19962
195 Ga0105241_10105061 3300009174 Bacteria 2252
196 Ga0105242_10000036 3300009176 Bacteria 91470
197 Ga0105248_10004963 3300009177 Bacteria 14701
198 Ga0105248_10313680 3300009177 Bacteria 1766
199 Ga0105237_10005966 3300009545 Bacteria 13649
200 Ga0105237_10023052 3300009545 Bacteria 6383
201 Ga0105237_10184641 3300009545 Bacteria 2085
202 Ga0105237_10313821 3300009545 Bacteria 1571
203 Ga0105238_10007520 3300009551 Bacteria 10911
204 Ga0105238_10069804 3300009551 Bacteria 3514
205 Ga0105238_10200201 3300009551 Bacteria 1972
206 Ga0105238_10328367 3300009551 Bacteria 1516
207 Ga0105249_10001279 3300009553 Bacteria 22069
208 Ga0105249_10005862 3300009553 Bacteria 10631
209 Ga0105239_10003292 3300010375 Bacteria 19914
210 Ga0105239_10076051 3300010375 Bacteria 3692
211 Ga0105239_10248049 3300010375 Bacteria 2000
212 Ga0105239_10480449 3300010375 Bacteria 1411
213 Ga0105246_10001244 3300011119 Bacteria 14952
214 Ga0157371_10149528 3300013102 Bacteria 1665
215 Ga0157371_10288013 3300013102 Bacteria 1187
216 Ga0157370_10156759 3300013104 Bacteria 2118
217 Ga0157370_10424110 3300013104 Bacteria 1224
218 Ga0157369_10009653 3300013105 Bacteria 11037
219 Ga0157369_10060341 3300013105 Unclassified 4090
220 Ga0157369_10065485 3300013105 Bacteria 3911
221 Ga0157369_10548649 3300013105 Bacteria 1195
222 Ga0157374_10001349 3300013296 Bacteria 20893
223 Ga0157374_10019654 3300013296 Bacteria 5981
224 Ga0157374_10221977 3300013296 Bacteria 1854
225 Ga0157378_10096701 3300013297 Unclassified 2691
226 Ga0163162_10001803 3300013306 Bacteria 20099
227 Ga0163162_10652453 3300013306 Bacteria 1176
228 Ga0157372_10047696 3300013307 Bacteria 4761
229 Ga0157372_10433353 3300013307 Bacteria 1532
230 Ga0157372_10533040 3300013307 Bacteria 1369
231 Ga0157375_10003554 3300013308 Bacteria 13528
232 Ga0163163_10007224 3300014325 Bacteria 9788
233 Ga0163163_10031750 3300014325 Bacteria 5099
234 Ga0157380_10000141 3300014326 Bacteria 40564
235 Ga0157377_10000124 3300014745 Bacteria 49953
236 Ga0157379_10003074 3300014968 Bacteria 14113
237 Ga0157379_10013614 3300014968 Bacteria 7127
238 Ga0157379_10090019 3300014968 Bacteria 2753
239 Ga0157376_10000115 3300014969 Bacteria 57170
240 Ga0163161_10002816 3300017792 Bacteria 12338
241 Ga0163161_10368356 3300017792 Bacteria 1146
242 Ga0213876_10039373 3300021384 Bacteria 2497
243 Ga0213876_10054784 3300021384 Bacteria 2105
244 Ga0213876_10138633 3300021384 Bacteria 1294
245 Ga0213875_10000067 3300021388 Bacteria 127481
246 Ga0207425_1000690 3300025245 Bacteria 18329
247 Ga0209565_1000331 3300025263 Bacteria 42154
248 Ga0207666_1000192 3300025271 Bacteria 9174
249 Ga0207673_1000006 3300025290 Bacteria 16960
250 Ga0209675_1001925 3300025291 Bacteria 11209
251 Ga0209025_1037899 3300025294 Bacteria 2130
252 Ga0209758_1027845 3300025297 Bacteria 2406
253 Ga0207697_10000039 3300025315 Bacteria 49235
254 Ga0207697_10054462 3300025315 Bacteria 1657
255 Ga0207653_10003137 3300025885 Bacteria 5230
256 Ga0207682_10000135 3300025893 Bacteria 33308
257 Ga0207642_10000274 3300025899 Bacteria 15439
258 Ga0207710_10006877 3300025900 Bacteria 4841
259 Ga0207688_10003046 3300025901 Bacteria 9135
260 Ga0207688_10051095 3300025901 Bacteria 2315
261 Ga0207680_10023583 3300025903 Bacteria 3363
262 Ga0207647_10001409 3300025904 Bacteria 18461
263 Ga0207647_10094134 3300025904 Bacteria 1785
264 Ga0207699_10019208 3300025906 Bacteria 3639
265 Ga0207699_10043403 3300025906 Bacteria 2611
266 Ga0207699_10078439 3300025906 Bacteria 2040
267 Ga0207699_10109785 3300025906 Bacteria 1766
268 Ga0207645_10000114 3300025907 Bacteria 60880
269 Ga0207643_10000134 3300025908 Bacteria 50474
270 Ga0207654_10000402 3300025911 Bacteria 25192
271 Ga0207654_10084407 3300025911 Bacteria 1920
272 Ga0207654_10129390 3300025911 Bacteria 1596
273 Ga0207707_10003615 3300025912 Bacteria 13709
274 Ga0207707_10042718 3300025912 Bacteria 3955
275 Ga0207707_10060913 3300025912 Unclassified 3283
276 Ga0207707_10091837 3300025912 Bacteria 2653
277 Ga0207707_10128549 3300025912 Bacteria 2215
278 Ga0207707_10337276 3300025912 Bacteria 1300
279 Ga0207695_10106617 3300025913 Bacteria 2788
280 Ga0207695_10201890 3300025913 Bacteria 1902
281 Ga0207695_10617462 3300025913 Bacteria 965
282 Ga0207671_10014739 3300025914 Bacteria 6164
283 Ga0207693_10017830 3300025915 Bacteria 5660
284 Ga0207693_10019862 3300025915 Bacteria 5343
285 Ga0207693_10029107 3300025915 Bacteria 4365
286 Ga0207663_10019094 3300025916 Bacteria 3853
287 Ga0207660_10000034 3300025917 Bacteria 65783
288 Ga0207660_10006133 3300025917 Bacteria 7800
289 Ga0207660_10180918 3300025917 Bacteria 1637
290 Ga0207660_10221176 3300025917 Bacteria 1486
291 Ga0207660_10484450 3300025917 Bacteria 1003
292 Ga0207662_10002535 3300025918 Bacteria 9196
293 Ga0207662_10020419 3300025918 Bacteria 3780
294 Ga0207657_10000425 3300025919 Bacteria 44792
295 Ga0207657_10039018 3300025919 Bacteria 4223
296 Ga0207657_10092861 3300025919 Bacteria 2514
297 Ga0207649_10000142 3300025920 Bacteria 60023
298 Ga0207652_10001667 3300025921 Bacteria 19439
299 Ga0207652_10079746 3300025921 Bacteria 2860
300 Ga0207652_10097875 3300025921 Bacteria 2587
301 Ga0207652_10132287 3300025921 Unclassified 2226
302 Ga0207652_10428228 3300025921 Bacteria 1193
303 Ga0207652_10726189 3300025921 Bacteria 885
304 Ga0207681_10000065 3300025923 Bacteria 98832
305 Ga0207694_10058086 3300025924 Bacteria 3009
306 Ga0207694_10063171 3300025924 Bacteria 2884
307 Ga0207694_10362989 3300025924 Bacteria 1200
308 Ga0207650_10356289 3300025925 Bacteria 1205
309 Ga0207659_10000078 3300025926 Bacteria 61403
310 Ga0207687_10000125 3300025927 Bacteria 51567
311 Ga0207700_10006043 3300025928 Bacteria 7289
312 Ga0207700_10023777 3300025928 Bacteria 4232
313 Ga0207700_10199301 3300025928 Bacteria 1686
314 Ga0207700_10208378 3300025928 Bacteria 1651
315 Ga0207700_10621161 3300025928 Unclassified 962
316 Ga0207664_10032469 3300025929 Bacteria 4001
317 Ga0207664_10132715 3300025929 Bacteria 2098
318 Ga0207644_10003174 3300025931 Bacteria 10575
319 Ga0207690_10000200 3300025932 Bacteria 46868
320 Ga0207706_10000435 3300025933 Bacteria 44792
321 Ga0207706_10032289 3300025933 Bacteria 4662
322 Ga0207706_10123127 3300025933 Bacteria 2281
323 Ga0207686_10000251 3300025934 Bacteria 40894
324 Ga0207686_10003168 3300025934 Bacteria 8855
325 Ga0207709_10000183 3300025935 Bacteria 83374
326 Ga0207670_10001020 3300025936 Bacteria 14811
327 Ga0207669_10000081 3300025937 Bacteria 48214
328 Ga0207704_10000419 3300025938 Bacteria 19146
329 Ga0207704_10044669 3300025938 Bacteria 2626
330 Ga0207665_10025889 3300025939 Bacteria 3870
331 Ga0207665_10067630 3300025939 Bacteria 2433
332 Ga0207665_10321244 3300025939 Bacteria 1162
333 Ga0207691_10002274 3300025940 Bacteria 18817
334 Ga0207691_10188363 3300025940 Bacteria 1801
335 Ga0207711_10000766 3300025941 Bacteria 31591
336 Ga0207711_10496167 3300025941 Bacteria 1138
337 Ga0207689_10000144 3300025942 Bacteria 61402
338 Ga0207661_10000670 3300025944 Bacteria 22177
339 Ga0207661_10002727 3300025944 Bacteria 12148
340 Ga0207661_10017615 3300025944 Bacteria 5291
341 Ga0207661_10341515 3300025944 Bacteria 1349
342 Ga0207679_10000064 3300025945 Bacteria 98118
343 Ga0207667_10011544 3300025949 Bacteria 10261
344 Ga0207667_10141119 3300025949 Bacteria 2480
345 Ga0207667_10603608 3300025949 Bacteria 1107
346 Ga0207651_10001490 3300025960 Bacteria 10656
347 Ga0207712_10001565 3300025961 Bacteria 15403
348 Ga0207712_10025428 3300025961 Bacteria 3934
349 Ga0207668_10000162 3300025972 Bacteria 46411
350 Ga0207668_10006356 3300025972 Bacteria 6987
351 Ga0207640_10001145 3300025981 Bacteria 14558
352 Ga0207640_10079881 3300025981 Bacteria 2231
353 Ga0207658_10001102 3300025986 Bacteria 21774
354 Ga0207658_10048410 3300025986 Bacteria 3117
355 Ga0207677_10673376 3300026023 Bacteria 915
356 Ga0207703_10006015 3300026035 Bacteria 9713
357 Ga0207703_10331462 3300026035 Bacteria 1396
358 Ga0207639_10002011 3300026041 Bacteria 13697
359 Ga0207639_10047217 3300026041 Bacteria 3253
360 Ga0207639_10074311 3300026041 Bacteria 2669
361 Ga0207639_10387055 3300026041 Bacteria 1257
362 Ga0207678_10000344 3300026067 Bacteria 42040
363 Ga0207678_10043627 3300026067 Bacteria 3880
364 Ga0207678_10426963 3300026067 Bacteria 1150
365 Ga0207708_10004403 3300026075 Bacteria 10377
366 Ga0207708_10176850 3300026075 Bacteria 1693
367 Ga0207708_10181252 3300026075 Bacteria 1672
368 Ga0207702_10003261 3300026078 Bacteria 14986
369 Ga0207702_10093318 3300026078 Bacteria 2640
370 Ga0207702_10373027 3300026078 Unclassified 1370
371 Ga0207641_10000941 3300026088 Bacteria 30006
372 Ga0207648_10009121 3300026089 Bacteria 9534
373 Ga0207676_10000079 3300026095 Bacteria 94811
374 Ga0207674_10000323 3300026116 Bacteria 61026
375 Ga0207674_10022025 3300026116 Bacteria 6853
376 Ga0207675_100000270 3300026118 Bacteria 49235
377 Ga0207675_100072520 3300026118 Bacteria 3221
378 Ga0207683_10000037 3300026121 Bacteria 100920
379 Ga0207683_10016464 3300026121 Bacteria 6293
380 Ga0207683_10654965 3300026121 Bacteria 973
381 Ga0209968_1007176 3300027526 Bacteria 1684
382 Ga0210002_1000408 3300027617 Bacteria 5861
383 Ga0209971_1004232 3300027682 Bacteria 3405
384 Ga0209971_1005256 3300027682 Bacteria 3076
385 Ga0209971_1015152 3300027682 Bacteria 1827
386 Ga0209998_10015227 3300027717 Bacteria 1608
387 Ga0209974_10000966 3300027876 Bacteria 10083
388 Ga0209974_10036917 3300027876 Bacteria 1623
389 Ga0207428_10000292 3300027907 Bacteria 67070
390 Ga0207428_10001579 3300027907 Bacteria 23723
391 Ga0207428_10003547 3300027907 Bacteria 15076
392 Ga0268266_10036702 3300028379 Bacteria 4174
393 Ga0268265_10001049 3300028380 Bacteria 24845
394 Ga0268265_10042149 3300028380 Bacteria 3384
395 Ga0268264_10000583 3300028381 Bacteria 44280
396 Ga0268264_10062581 3300028381 Bacteria 3125
397 Ga0265323_10002189 3300028653 Bacteria 9111
398 Ga0265322_10029696 3300028654 Bacteria 1562
399 Ga0265336_10006616 3300028666 Bacteria 4163
400 Ga0265338_10013740 3300028800 Bacteria 9104
401 Ga0265338_10083353 3300028800 Bacteria 2674
402 Ga0265328_10012438 3300031239 Bacteria 3386
403 Ga0265339_10000068 3300031249 Bacteria 91555
404 Ga0265339_10001392 3300031249 Bacteria 18003
405 Ga0265331_10046882 3300031250 Bacteria 2082
406 Ga0265327_10000233 3300031251 Bacteria 112052
407 Ga0265327_10001600 3300031251 Bacteria 27530
408 Ga0265316_10000190 3300031344 Bacteria 71043
409 Ga0265316_10146049 3300031344 Bacteria 1774
410 Ga0265313_10000088 3300031595 Bacteria 90711
411 Ga0265314_10004951 3300031711 Bacteria 12152
412 Ga0315911_1000015 3300033442 Bacteria 185247
413 Ga0373930_0000021 3300034816 Bacteria 15168
414 Ga0373948_0010220 3300034817 Bacteria 1634
415 Ga0373950_0000378 3300034818 Bacteria 5510
416 Ga0373958_0001112 3300034819 Bacteria 3556
417 Ga0373958_0002233 3300034819 Bacteria 2693
418 Ga0373959_0000359 3300034820 Bacteria 9138
419 Ga0373938_0000071 3300034957 Bacteria 13485
420 Ga0373938_0008054 3300034957 Bacteria 1873
421 Ga0373928_0000327 3300035084 Bacteria 9510
422 Ga0373929_0000383 3300035085 Bacteria 8309
423 Ga0373929_0012950 3300035085 Bacteria 1591
424 Ga0373929_0014921 3300035085 Bacteria 1506
425 Ga0373934_0003749 3300035086 Bacteria 5592
426 Ga0373944_0031713 3300035089 Bacteria 1592
427 Ga0373949_0001992 3300035090 Bacteria 5459
428 Ga0373949_0005070 3300035090 Bacteria 2964
429 Ga0373951_0000680 3300035091 Bacteria 9359
430 Ga0373951_0016149 3300035091 Bacteria 1683
431 Ga0373952_0000018 3300035092 Bacteria 20077
432 Ga0373952_0001492 3300035092 Bacteria 4254
433 Ga0373923_0004717 3300035111 Bacteria 4551
434 Ga0373923_0012189 3300035111 Bacteria 3171
435 Ga0373923_0015440 3300035111 Bacteria 2884
436 Ga0373932_0001209 3300035112 Bacteria 7344
437 Ga0373932_0007755 3300035112 Bacteria 2561
438 Ga0373936_0010672 3300035113 Bacteria 3467
439 Ga0373939_0000588 3300035114 Bacteria 9059
440 Ga0373939_0037201 3300035114 Bacteria 1444
441 Ga0373939_0049723 3300035114 Bacteria 1297
442 Ga0373941_0010419 3300035115 Bacteria 2374
443 Ga0373953_0243817 3300035117 Bacteria 780
444 Ga0373954_0001346 3300035118 Bacteria 9907
445 Ga0373954_0002846 3300035118 Bacteria 7291
446 Ga0373954_0034334 3300035118 Bacteria 2349
447 Ga0373956_0024985 3300035119 Bacteria 2579
448 Ga0373957_0015792 3300035120 Bacteria 2604
449 Ga0373957_0020186 3300035120 Bacteria 2352
450 Ga0373960_0003427 3300035121 Bacteria 3589
451 Ga0373960_0008483 3300035121 Bacteria 2463
452 Ga0373943_0003447 3300035170 Bacteria 7195
453 Ga0373946_0003623 3300035171 Bacteria 5472
454 Ga0373946_0209724 3300035171 Bacteria 936
455 Ga0373955_0001882 3300035172 Bacteria 9051
456 Ga0373955_0018510 3300035172 Bacteria 3465
457 Ga0373942_0005273 3300035207 Bacteria 2995
458 Ga0373942_0008670 3300035207 Bacteria 2373
459 Ga0373961_0002538 3300035241 Bacteria 4707
460 Ga0373961_0003990 3300035241 Bacteria 3596
461 Ga0373962_0000206 3300035242 Bacteria 12480
462 Ga0373924_0023344 3300035410 Bacteria 2425
463 Ga0373931_0000393 3300035691 Bacteria 17943
464 Ga0373931_0000727 3300035691 Bacteria 13705
465 Ga0373935_0044689 3300035692 Bacteria 2793
466 Ga0373933_0000405 3300035724 Bacteria 27323
467 Ga0373933_0002769 3300035724 Bacteria 9781
468 Ga0373933_0011966 3300035724 Bacteria 4791
469 Ga0373933_0029430 3300035724 Bacteria 3176
470 Ga0373947_0195164 3300035725 Bacteria 1322
471 Ga0373937_0006739 3300036401 Bacteria 9910
472 Ga0373937_0011730 3300036401 Bacteria 7686
473 Ga0373937_0576359 3300036401 Bacteria 1069
474 Ga0373925_0013964 3300037068 Bacteria 5813
475 Ga0373925_0134612 3300037068 Bacteria 1930
476 Ga0373925_0330099 3300037068 Unclassified 1235
477 Ga0373925_0492587 3300037068 Bacteria 1006
478 Ga0395898_0029983 3300037466 Bacteria 5446
479 Ga0395898_0034323 3300037466 Bacteria 5057
480 Ga0395898_0092017 3300037466 Bacteria 2917
481 Ga0436364_0231307 3300037853 Bacteria 2228
482 Ga0436364_0367201 3300037853 Bacteria 32911
483 Ga0395901_0114157 3300038443 Bacteria 2837
484 Ga0395901_0453083 3300038443 Bacteria 1312
485 Ga0400486_17854 3300038742 Unclassified 2380
486 Ga0242420_002702 3300038996 Bacteria 2560
487 Ga0436365_0096100 3300039437 Bacteria 2993
488 Ga0436365_0310774 3300039437 Bacteria 2596
489 Ga0436365_1135249 3300039437 Bacteria 2983
490 Ga0436365_1717019 3300039437 Bacteria 1975
491 Ga0439463_026509 3300042016 Bacteria 1456
492 Ga0439464_0008938 3300042439 Bacteria 2628
493 Ga0451577_0150468 3300042876 Bacteria 2094
494 Ga0466961_0135066 3300044693 Bacteria 1545
495 Ga0466963_0074625 3300044694 Bacteria 2288
496 Ga0466963_0146379 3300044694 Bacteria 1639
497 Ga0466964_0020698 3300044706 Bacteria 2536
498 Ga0453684_0297295 3300044712 Bacteria 1836
499 Ga0466968_0120191 3300044735 Bacteria 1188
500 Ga0466957_0254349 3300044842 Bacteria 1169
501 Ga0466959_0068328 3300045049 Bacteria 2575
502 Ga0466959_0285310 3300045049 Bacteria 1132
503 Ga0466959_0311031 3300045049 Bacteria 1078
504 Ga0466958_0000026 3300045836 Bacteria 42258
505 Ga0466958_0107111 3300045836 Bacteria 1743
506 Ga0466967_0253595 3300045976 Bacteria 1681
507 Ga0495592_0018264 3300046454 Bacteria 5330
508 Ga0495592_0024446 3300046454 Bacteria 4593
509 Ga0495592_0037236 3300046454 Bacteria 3663
510 Ga0495603_0030221 3300046455 Bacteria 3264
511 Ga0495603_0119075 3300046455 Bacteria 1539
512 Ga0495629_0028631 3300046459 Bacteria 3954
513 Ga0495638_0024123 3300046460 Bacteria 3970
514 Ga0495641_0040792 3300046461 Bacteria 2158
515 Ga0495641_0165525 3300046461 Bacteria 989
516 Ga0495651_0010810 3300046462 Bacteria 7017
517 Ga0495651_0141818 3300046462 Bacteria 1742
518 Ga0495653_0012969 3300046463 Bacteria 6800
519 Ga0495580_0059778 3300046472 Bacteria 2678
520 Ga0495582_0273918 3300046473 Unclassified 969
521 Ga0495639_0177395 3300046475 Bacteria 1036
522 Ga0495662_0021827 3300046476 Bacteria 3094
523 Ga0495662_0040419 3300046476 Bacteria 2252
524 Ga0495662_0075736 3300046476 Bacteria 1633
525 Ga0495664_0003198 3300046477 Bacteria 8892
526 Ga0495664_0006628 3300046477 Bacteria 6403
527 Ga0495664_0028886 3300046477 Bacteria 3240
528 Ga0495664_0032449 3300046477 Bacteria 3064
529 Ga0495584_0044146 3300046491 Bacteria 2250
530 Ga0495594_0025442 3300046499 Bacteria 3182
531 Ga0495608_0028120 3300046511 Bacteria 3822
532 Ga0495608_0069865 3300046511 Bacteria 2293
533 Ga0495618_0002331 3300046514 Bacteria 12273
534 Ga0495618_0023163 3300046514 Bacteria 3838
535 Ga0495628_0007123 3300046516 Bacteria 9685
536 Ga0495628_0064633 3300046516 Unclassified 2864
537 Ga0495628_0221425 3300046516 Bacteria 1421
538 Ga0495628_0335647 3300046516 Unclassified 1113
539 Ga0495628_0346195 3300046516 Bacteria 1093
540 Ga0495630_0045284 3300046517 Bacteria 3287
541 Ga0495630_0512095 3300046517 Bacteria 920
542 Ga0495666_0087148 3300046526 Unclassified 1475
543 Ga0495652_0048649 3300046529 Bacteria 3631
544 Ga0495652_0205849 3300046529 Bacteria 1490
545 Ga0495640_0008129 3300046533 Bacteria 8236
546 Ga0495640_0030630 3300046533 Bacteria 3850
547 Ga0495586_0037195 3300046535 Bacteria 2612
548 Ga0495587_0001044 3300046536 Bacteria 18250
549 Ga0495587_0104944 3300046536 Bacteria 1626
550 Ga0495587_0197184 3300046536 Bacteria 1139
551 Ga0495645_0001990 3300046543 Bacteria 13887
552 Ga0495645_0052865 3300046543 Bacteria 2954
553 Ga0495645_0097372 3300046543 Bacteria 2095
554 Ga0495667_0004872 3300046559 Bacteria 9072
555 Ga0495634_0008812 3300046642 Bacteria 7481
556 Ga0495634_0015598 3300046642 Bacteria 5453
557 Ga0495635_0009828 3300046663 Bacteria 6689
558 Ga0495635_0040935 3300046663 Bacteria 3201
559 Ga0495635_0135102 3300046663 Bacteria 1681
560 Ga0495657_0002213 3300046675 Bacteria 16467
561 Ga0495657_0242929 3300046675 Bacteria 1086
562 Ga0495599_0001186 3300046678 Bacteria 14781
563 Ga0495599_0007597 3300046678 Bacteria 6583
564 Ga0495599_0298579 3300046678 Bacteria 973
565 Ga0495623_0003875 3300046679 Bacteria 9863
566 Ga0495623_0283695 3300046679 Bacteria 920
567 Ga0495646_0003107 3300046680 Bacteria 10308
568 Ga0495647_0016764 3300046681 Bacteria 2585
569 Ga0495647_0104926 3300046681 Bacteria 1173
570 Ga0495658_0008269 3300046683 Bacteria 5153
571 Ga0495658_0032919 3300046683 Bacteria 2834
572 Ga0495669_0065482 3300046684 Bacteria 1650
573 Ga0495613_0068219 3300046689 Bacteria 2594
574 Ga0495624_0028545 3300046690 Bacteria 3645
575 Ga0495624_0116432 3300046690 Bacteria 1642
576 Ga0495671_0050157 3300046692 Bacteria 2079
577 Ga0495600_0002653 3300046809 Bacteria 10334
578 Ga0495581_0006737 3300047315 Bacteria 6661
579 Ga0495581_0103529 3300047315 Bacteria 1654
580 Ga0495604_0001816 3300047317 Bacteria 17374
581 Ga0495604_0155295 3300047317 Bacteria 1622
582 Ga0495674_0010890 3300047319 Bacteria 8597
583 Ga0495674_0023062 3300047319 Bacteria 5735
584 Ga0495674_0033682 3300047319 Bacteria 4638
585 Ga0495674_0504966 3300047319 Bacteria 967
586 Ga0495676_0179382 3300047321 Bacteria 1485
587 Ga0495680_0003209 3300047322 Bacteria 16267
588 Ga0495680_0034028 3300047322 Bacteria 4122
589 Ga0495680_0385501 3300047322 Bacteria 970
590 Ga0495675_0024808 3300047444 Bacteria 3824
591 Ga0495675_0039625 3300047444 Bacteria 3001
592 Ga0495684_0009235 3300047471 Bacteria 7614
593 Ga0495684_0009698 3300047471 Bacteria 7428
594 Ga0495593_0042607 3300047673 Bacteria 2436
595 Ga0495593_0070075 3300047673 Bacteria 1822
596 Ga0495593_0141805 3300047673 Bacteria 1217
597 Ga0495602_0004062 3300048088 Bacteria 15240
598 Ga0495602_0184909 3300048088 Bacteria 1603
599 Ga0495602_0505145 3300048088 Bacteria 844
600 Ga0496100_0000172 3300048903 Bacteria 35873
601 Ga0496101_0000406 3300048904 Bacteria 27974
602 Ga0496101_0077212 3300048904 Bacteria 2454
603 Ga0496102_0006743 3300048905 Bacteria 9804
604 Ga0496102_0157367 3300048905 Bacteria 2136
605 Ga0496103_0002977 3300048906 Bacteria 10492
606 Ga0496104_0115052 3300048907 Bacteria 2581
607 Ga0496105_0260008 3300048908 Unclassified 1404
608 Ga0496106_0005006 3300048909 Bacteria 9804
609 Ga0496106_0015033 3300048909 Bacteria 5729
610 Ga0496106_0213804 3300048909 Bacteria 1536
611 Ga0496107_0000560 3300048910 Bacteria 20809
612 Ga0496107_0013936 3300048910 Bacteria 5623
613 Ga0496107_0125420 3300048910 Unclassified 1893
614 Ga0496107_0165894 3300048910 Bacteria 1637
615 Ga0496108_0006778 3300048911 Bacteria 9276
616 Ga0496108_0045231 3300048911 Bacteria 3677
617 Ga0496108_0125315 3300048911 Bacteria 2205
618 Ga0496108_0443305 3300048911 Bacteria 1134
619 Ga0496109_0000260 3300048912 Bacteria 50877
620 Ga0496109_0001609 3300048912 Bacteria 18843
621 Ga0496110_0000110 3300048913 Bacteria 44789
622 Ga0496110_0141302 3300048913 Bacteria 2177
623 Ga0496110_0190051 3300048913 Unclassified 1865
624 Ga0496110_0338644 3300048913 Bacteria 1370
625 Ga0496111_0091813 3300048914 Bacteria 2225
626 Ga0496111_0142400 3300048914 Bacteria 1777
627 Ga0496111_0193692 3300048914 Bacteria 1511
628 Ga0496112_0063965 3300048915 Bacteria 3629
629 Ga0496112_0181405 3300048915 Bacteria 2069
630 Ga0496113_0000719 3300048916 Bacteria 16932
631 Ga0496113_0207870 3300048916 Bacteria 1557
632 Ga0496114_0000689 3300048917 Bacteria 25131
633 Ga0496115_0010342 3300048918 Bacteria 6967
634 Ga0496121_0156870 3300048924 Bacteria 1669
635 Ga0496121_0165595 3300048924 Bacteria 1611
636 Ga0496123_0206022 3300048926 Bacteria 1004
637 Ga0496124_0182868 3300048927 Bacteria 1611
638 Ga0496125_0081337 3300048928 Bacteria 2475
639 Ga0496126_0051799 3300048929 Bacteria 3735
640 Ga0496126_0063401 3300048929 Bacteria 3313
641 Ga0496126_0084150 3300048929 Bacteria 2806
642 Ga0501031_0143906 3300049568 Bacteria 1558
643 Ga0501036_0065004 3300049572 Bacteria 3087
644 Ga0501037_0039333 3300049573 Bacteria 3482
645 Ga0501038_0156023 3300049574 Bacteria 1858
646 Ga0501047_0037116 3300049581 Bacteria 4711
647 Ga0501067_0013283 3300049583 Bacteria 4561
648 Ga0501070_0011879 3300049586 Bacteria 7354
649 Ga0501070_0114544 3300049586 Bacteria 2227
650 Ga0501073_0021312 3300049589 Bacteria 4672
651 Ga0501073_0124055 3300049589 Bacteria 1790
652 Ga0501080_0154403 3300049742 Bacteria 2120
653 Ga0501035_0217641 3300049822 Bacteria 1632
654 Ga0501044_0058173 3300049823 Bacteria 3965
655 Ga0501044_0447162 3300049823 Bacteria 1199
656 nmdc:mga04h51_15605_c1 3300050495 Bacteria 2190
657 nmdc:mga07m45_76269_c1 3300050496 Bacteria 1911
658 nmdc:mga09592_305_c1 3300050508 Bacteria 35821
659 nmdc:mga0qj67_690_c1 3300050509 Bacteria 22997
660 nmdc:mga08y16_108532_c1 3300050511 Bacteria 2890
661 nmdc:mga08y16_2782_c1 3300050511 Bacteria 17931
662 nmdc:mga08y16_70534_c1 3300050511 Bacteria 3643
663 nmdc:mga0n895_495822_c1 3300050512 Bacteria 1231
664 nmdc:mga0n895_512_c1 3300050512 Bacteria 26362
665 nmdc:mga0n895_636_c1 3300050512 Bacteria 24376
666 nmdc:mga0rr50_16801_c1 3300050513 Bacteria 4870
667 nmdc:mga0rr50_258687_c1 3300050513 Unclassified 1448
668 nmdc:mga0a205_9418_c1 3300050515 Bacteria 8929
669 Ga0495601_0001947 3300053077 Bacteria 11553
670 Ga0495601_0039735 3300053077 Bacteria 2947
671 Ga0495601_0056066 3300053077 Bacteria 2495
672 Ga0495612_0014271 3300053078 Bacteria 3196
673 Ga0495612_0035362 3300053078 Bacteria 2025
674 Ga0495612_0046223 3300053078 Bacteria 1782
675 Ga0500635_0009086 3300053080 Bacteria 2747
676 Ga0495595_0000210 3300053084 Bacteria 23560
677 Ga0495619_0021558 3300053085 Bacteria 4114
678 Ga0495619_0043947 3300053085 Bacteria 2931
679 Ga0500647_0013413 3300053091 Bacteria 3707
680 Ga0500647_0014706 3300053091 Bacteria 3564
681 Ga0500651_0279020 3300053093 Bacteria 964
682 Ga0500566_0000601 3300053094 Bacteria 20208
683 Ga0500640_002416 3300053095 Bacteria 6166
684 Ga0500572_000764 3300053111 Bacteria 10327
685 Ga0500572_002445 3300053111 Bacteria 4470
686 Ga0500608_009711 3300053122 Bacteria 4097
687 Ga0500614_012119 3300053123 Bacteria 1876
688 Ga0500559_0001730 3300053136 Bacteria 11975
689 Ga0500603_000048 3300053150 Bacteria 29163
690 Ga0500603_000817 3300053150 Bacteria 7433
691 Ga0500616_0000002 3300053153 Bacteria 1611257
692 Ga0500630_001904 3300053159 Bacteria 10017
693 Ga0500638_014810 3300053162 Bacteria 3564
694 Ga0500639_000166 3300053163 Bacteria 32001
695 Ga0500639_103660 3300053163 Bacteria 1395
696 Ga0500637_0000100 3300053178 Bacteria 31119
697 Ga0500637_0030934 3300053178 Bacteria 2981
698 Ga0500596_000099 3300053735 Bacteria 11805
699 Ga0500601_003394 3300053737 Bacteria 1726
700 Ga0466962_0105239 3300061719 Bacteria 1356

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0512095 Ga0495630_0512095_19_690 200
2 3300046516 Ga0495628_0335647 Ga0495628_0335647_327_1058 206
3 3300048088 Ga0495602_0505145 Ga0495602_0505145_83_733 208
4 3300049589 Ga0501073_0124055 Ga0501073_0124055_1060_1761 208
5 3300035692 Ga0373935_0044689 Ga0373935_0044689_1084_1800 214
6 3300037068 Ga0373925_0492587 Ga0373925_0492587_224_940 214
7 3300048927 Ga0496124_0182868 Ga0496124_0182868_10_726 215
8 3300035117 Ga0373953_0243817 Ga0373953_0243817_33_767 218
9 3300026121 Ga0207683_10654965 Ga0207683_106549652 220
10 3300007265 Ga0099794_10165543 Ga0099794_101655431 226
11 3300028800 Ga0265338_10083353 Ga0265338_100833533 227
12 3300031249 Ga0265339_10000068 Ga0265339_1000006827 227
13 3300031595 Ga0265313_10000088 Ga0265313_1000008858 227
14 3300035171 Ga0373946_0209724 Ga0373946_0209724_23_787 231
15 3300025245 Ga0207425_1000690 Ga0207425_10006903 232
16 3300035118 Ga0373954_0002846 Ga0373954_0002846_2505_3320 234
17 3300046454 Ga0495592_0037236 Ga0495592_0037236_423_1238 234
18 3300046678 Ga0495599_0007597 Ga0495599_0007597_1084_1899 234
19 3300005329 Ga0070683_100264664 Ga0070683_1002646642 235
20 3300005344 Ga0070661_100383775 Ga0070661_1003837751 235
21 3300005539 Ga0068853_100288262 Ga0068853_1002882622 235
22 3300005577 Ga0068857_100599543 Ga0068857_1005995432 235
23 3300005614 Ga0068856_100095310 Ga0068856_1000953102 235
24 3300009093 Ga0105240_10061993 Ga0105240_100619933 235
25 3300013104 Ga0157370_10156759 Ga0157370_101567591 235
26 3300013104 Ga0157370_10424110 Ga0157370_104241102 235
27 3300013105 Ga0157369_10009653 Ga0157369_100096536 235
28 3300013105 Ga0157369_10065485 Ga0157369_100654853 235
29 3300013307 Ga0157372_10047696 Ga0157372_100476962 235
30 3300021384 Ga0213876_10138633 Ga0213876_101386332 235
31 3300025913 Ga0207695_10201890 Ga0207695_102018902 235
32 3300025944 Ga0207661_10341515 Ga0207661_103415151 235
33 3300026041 Ga0207639_10047217 Ga0207639_100472173 235
34 3300026041 Ga0207639_10387055 Ga0207639_103870551 235
35 3300037466 Ga0395898_0034323 Ga0395898_0034323_1808_2626 235
36 3300038443 Ga0395901_0114157 Ga0395901_0114157_149_967 235
37 3300039437 Ga0436365_1717019 Ga0436365_1717019_834_1655 235
38 3300047319 Ga0495674_0504966 Ga0495674_0504966_139_918 235
39 iso_pu_bacteria 2808606384 2808973493 235
40 iso_pu_bacteria 2808606390 2809008342 235
41 iso_pu_bacteria 2808606391 2809015320 235
42 3300036401 Ga0373937_0576359 Ga0373937_0576359_73_852 236
43 3300046536 Ga0495587_0197184 Ga0495587_0197184_281_1060 236
44 3300046675 Ga0495657_0242929 Ga0495657_0242929_45_824 236
45 3300046678 Ga0495599_0298579 Ga0495599_0298579_87_866 236
46 3300047317 Ga0495604_0155295 Ga0495604_0155295_805_1584 236
47 3300047322 Ga0495680_0385501 Ga0495680_0385501_106_885 236
48 3300053163 Ga0500639_103660 Ga0500639_103660_210_1007 236
49 3300006358 Ga0068871_100274802 Ga0068871_1002748021 237
50 3300026067 Ga0207678_10426963 Ga0207678_104269631 237
51 3300003320 rootH2_10012201 rootH2_100122015 238
52 3300021388 Ga0213875_10000067 Ga0213875_10000067104 238
53 3300031711 Ga0265314_10004951 Ga0265314_100049512 238
54 3300035114 Ga0373939_0049723 Ga0373939_0049723_428_1225 238
55 3300037068 Ga0373925_0134612 Ga0373925_0134612_517_1320 238
56 3300037853 Ga0436364_0367201 Ga0436364_0367201_15673_16503 238
57 3300045836 Ga0466958_0000026 Ga0466958_0000026_20650_21441 238
58 3300046455 Ga0495603_0119075 Ga0495603_0119075_237_1040 238
59 3300037466 Ga0395898_0092017 Ga0395898_0092017_1417_2235 239
60 3300037853 Ga0436364_0231307 Ga0436364_0231307_824_1648 239
61 3300038443 Ga0395901_0453083 Ga0395901_0453083_143_961 239
62 3300038742 Ga0400486_17854 Ga0400486_17854_1187_1981 239
63 3300005336 Ga0070680_100519650 Ga0070680_1005196501 240
64 3300009551 Ga0105238_10007520 Ga0105238_100075202 240
65 3300025917 Ga0207660_10484450 Ga0207660_104844502 240
66 3300031251 Ga0265327_10001600 Ga0265327_100016005 240
67 3300035691 Ga0373931_0000393 Ga0373931_0000393_9342_10139 240
68 3300039437 Ga0436365_0310774 Ga0436365_0310774_238_1032 240
69 3300046516 Ga0495628_0064633 Ga0495628_0064633_1117_1908 240
70 3300048913 Ga0496110_0000110 Ga0496110_0000110_25885_26685 240
71 3300048914 Ga0496111_0142400 Ga0496111_0142400_178_978 240
72 3300053150 Ga0500603_000048 Ga0500603_000048_13751_14545 240
73 3300053178 Ga0500637_0000100 Ga0500637_0000100_8055_8849 240
74 iso_pu_bacteria 2513237137 2513862716 240
75 3300003215 JGI25153J46596_10022247 JGI25153J46596_100222472 241
76 3300005434 Ga0070709_10173471 Ga0070709_101734711 241
77 3300005436 Ga0070713_100137115 Ga0070713_1001371152 241
78 3300005437 Ga0070710_10018284 Ga0070710_100182842 241
79 3300005439 Ga0070711_100022380 Ga0070711_1000223802 241
80 3300006028 Ga0070717_10278863 Ga0070717_102788632 241
81 3300006163 Ga0070715_10128967 Ga0070715_101289672 241
82 3300006175 Ga0070712_100020552 Ga0070712_1000205523 241
83 3300025297 Ga0209758_1027845 Ga0209758_10278452 241
84 3300025906 Ga0207699_10043403 Ga0207699_100434032 241
85 3300025915 Ga0207693_10029107 Ga0207693_100291072 241
86 3300025928 Ga0207700_10208378 Ga0207700_102083781 241
87 3300025928 Ga0207700_10621161 Ga0207700_106211611 241
88 3300025929 Ga0207664_10132715 Ga0207664_101327152 241
89 3300031239 Ga0265328_10012438 Ga0265328_100124382 241
90 3300031250 Ga0265331_10046882 Ga0265331_100468822 241
91 3300031251 Ga0265327_10000233 Ga0265327_100002338 241
92 3300031344 Ga0265316_10000190 Ga0265316_1000019054 241
93 3300044694 Ga0466963_0146379 Ga0466963_0146379_117_911 241
94 3300044842 Ga0466957_0254349 Ga0466957_0254349_48_842 241
95 3300045049 Ga0466959_0068328 Ga0466959_0068328_1417_2211 241
96 3300045836 Ga0466958_0107111 Ga0466958_0107111_101_895 241
97 3300046692 Ga0495671_0050157 Ga0495671_0050157_660_1460 241
98 3300048929 Ga0496126_0063401 Ga0496126_0063401_1855_2661 241
99 3300005458 Ga0070681_10059021 Ga0070681_100590212 242
100 3300013105 Ga0157369_10060341 Ga0157369_100603412 242
101 3300046462 Ga0495651_0141818 Ga0495651_0141818_197_994 242
102 3300047444 Ga0495675_0039625 Ga0495675_0039625_1083_1880 242
103 3300049568 Ga0501031_0143906 Ga0501031_0143906_253_1056 242
104 3300049572 Ga0501036_0065004 Ga0501036_0065004_1865_2668 242
105 3300049573 Ga0501037_0039333 Ga0501037_0039333_2550_3353 242
106 3300049574 Ga0501038_0156023 Ga0501038_0156023_621_1424 242
107 3300049586 Ga0501070_0114544 Ga0501070_0114544_1321_2124 242
108 3300049742 Ga0501080_0154403 Ga0501080_0154403_154_957 242
109 3300049822 Ga0501035_0217641 Ga0501035_0217641_110_913 242
110 3300049823 Ga0501044_0447162 Ga0501044_0447162_256_1059 242
111 3300005842 Ga0068858_100124306 Ga0068858_1001243062 243
112 3300005937 Ga0081455_10039366 Ga0081455_100393662 243
113 3300005983 Ga0081540_1033505 Ga0081540_10335053 243
114 3300006871 Ga0075434_100073196 Ga0075434_1000731964 243
115 3300009545 Ga0105237_10023052 Ga0105237_100230524 243
116 3300009551 Ga0105238_10069804 Ga0105238_100698043 243
117 3300010375 Ga0105239_10480449 Ga0105239_104804492 243
118 3300013296 Ga0157374_10019654 Ga0157374_100196543 243
119 3300013306 Ga0163162_10652453 Ga0163162_106524532 243
120 3300025924 Ga0207694_10058086 Ga0207694_100580862 243
121 3300025924 Ga0207694_10362989 Ga0207694_103629891 243
122 3300025949 Ga0207667_10141119 Ga0207667_101411192 243
123 3300026035 Ga0207703_10331462 Ga0207703_103314621 243
124 3300028653 Ga0265323_10002189 Ga0265323_100021896 243
125 3300028654 Ga0265322_10029696 Ga0265322_100296961 243
126 3300028666 Ga0265336_10006616 Ga0265336_100066163 243
127 3300028800 Ga0265338_10013740 Ga0265338_100137406 243
128 3300039437 Ga0436365_0096100 Ga0436365_0096100_899_1708 243
129 3300048926 Ga0496123_0206022 Ga0496123_0206022_178_978 243
130 3300048928 Ga0496125_0081337 Ga0496125_0081337_811_1611 243
131 3300005983 Ga0081540_1081415 Ga0081540_10814151 244
132 3300033442 Ga0315911_1000015 Ga0315911_1000015145 244
133 3300049583 Ga0501067_0013283 Ga0501067_0013283_386_1192 244
134 3300035724 Ga0373933_0011966 Ga0373933_0011966_3307_4113 245
135 3300036401 Ga0373937_0011730 Ga0373937_0011730_3743_4549 245
136 3300037068 Ga0373925_0013964 Ga0373925_0013964_1637_2443 245
137 3300046476 Ga0495662_0075736 Ga0495662_0075736_516_1322 245
138 3300046529 Ga0495652_0205849 Ga0495652_0205849_215_1021 245
139 3300049581 Ga0501047_0037116 Ga0501047_0037116_3671_4477 245
140 3300049586 Ga0501070_0011879 Ga0501070_0011879_2877_3683 245
141 3300049589 Ga0501073_0021312 Ga0501073_0021312_2050_2856 245
142 3300049823 Ga0501044_0058173 Ga0501044_0058173_323_1129 245
143 3300053080 Ga0500635_0009086 Ga0500635_0009086_792_1604 245
144 3300053178 Ga0500637_0030934 Ga0500637_0030934_208_1020 245
145 3300005329 Ga0070683_100026074 Ga0070683_1000260746 246
146 3300005329 Ga0070683_100073252 Ga0070683_1000732522 246
147 3300005336 Ga0070680_100118497 Ga0070680_1001184972 246
148 3300005434 Ga0070709_10003284 Ga0070709_100032842 246
149 3300005434 Ga0070709_10195621 Ga0070709_101956212 246
150 3300005435 Ga0070714_100026630 Ga0070714_1000266302 246
151 3300005436 Ga0070713_100001721 Ga0070713_1000017219 246
152 3300005437 Ga0070710_10009699 Ga0070710_100096992 246
153 3300005439 Ga0070711_100028549 Ga0070711_1000285493 246
154 3300005458 Ga0070681_10011117 Ga0070681_100111172 246
155 3300005458 Ga0070681_10091277 Ga0070681_100912773 246
156 3300005458 Ga0070681_10172203 Ga0070681_101722032 246
157 3300005458 Ga0070681_10206772 Ga0070681_102067722 246
158 3300005530 Ga0070679_100142030 Ga0070679_1001420302 246
159 3300005530 Ga0070679_100226764 Ga0070679_1002267642 246
160 3300005535 Ga0070684_100016560 Ga0070684_1000165603 246
161 3300005535 Ga0070684_100017018 Ga0070684_1000170187 246
162 3300005547 Ga0070693_100180122 Ga0070693_1001801222 246
163 3300006028 Ga0070717_10004642 Ga0070717_100046425 246
164 3300006173 Ga0070716_100046342 Ga0070716_1000463422 246
165 3300006173 Ga0070716_100360750 Ga0070716_1003607501 246
166 3300006358 Ga0068871_100139170 Ga0068871_1001391703 246
167 3300009174 Ga0105241_10105061 Ga0105241_101050612 246
168 3300009545 Ga0105237_10184641 Ga0105237_101846412 246
169 3300009551 Ga0105238_10328367 Ga0105238_103283672 246
170 3300010375 Ga0105239_10076051 Ga0105239_100760514 246
171 3300013105 Ga0157369_10548649 Ga0157369_105486492 246
172 3300021384 Ga0213876_10039373 Ga0213876_100393732 246
173 3300021384 Ga0213876_10054784 Ga0213876_100547841 246
174 3300025906 Ga0207699_10019208 Ga0207699_100192082 246
175 3300025906 Ga0207699_10078439 Ga0207699_100784392 246
176 3300025911 Ga0207654_10129390 Ga0207654_101293902 246
177 3300025912 Ga0207707_10091837 Ga0207707_100918373 246
178 3300025912 Ga0207707_10128549 Ga0207707_101285492 246
179 3300025912 Ga0207707_10337276 Ga0207707_103372762 246
180 3300025913 Ga0207695_10106617 Ga0207695_101066172 246
181 3300025913 Ga0207695_10617462 Ga0207695_106174621 246
182 3300025915 Ga0207693_10017830 Ga0207693_100178302 246
183 3300025916 Ga0207663_10019094 Ga0207663_100190943 246
184 3300025917 Ga0207660_10006133 Ga0207660_100061334 246
185 3300025917 Ga0207660_10221176 Ga0207660_102211761 246
186 3300025921 Ga0207652_10097875 Ga0207652_100978752 246
187 3300025921 Ga0207652_10428228 Ga0207652_104282282 246
188 3300025921 Ga0207652_10726189 Ga0207652_107261891 246
189 3300025928 Ga0207700_10006043 Ga0207700_100060432 246
190 3300025928 Ga0207700_10023777 Ga0207700_100237772 246
191 3300025929 Ga0207664_10032469 Ga0207664_100324692 246
192 3300025939 Ga0207665_10067630 Ga0207665_100676302 246
193 3300025939 Ga0207665_10321244 Ga0207665_103212441 246
194 3300025944 Ga0207661_10002727 Ga0207661_100027273 246
195 3300025944 Ga0207661_10017615 Ga0207661_100176152 246
196 3300025949 Ga0207667_10603608 Ga0207667_106036081 246
197 3300025981 Ga0207640_10079881 Ga0207640_100798811 246
198 3300026116 Ga0207674_10022025 Ga0207674_100220254 246
199 3300031249 Ga0265339_10001392 Ga0265339_100013928 246
200 3300035111 Ga0373923_0004717 Ga0373923_0004717_1964_2782 246
201 3300035113 Ga0373936_0010672 Ga0373936_0010672_2509_3327 246
202 3300035118 Ga0373954_0034334 Ga0373954_0034334_887_1705 246
203 3300035120 Ga0373957_0020186 Ga0373957_0020186_140_958 246
204 3300035170 Ga0373943_0003447 Ga0373943_0003447_1913_2731 246
205 3300035171 Ga0373946_0003623 Ga0373946_0003623_3911_4729 246
206 3300035172 Ga0373955_0018510 Ga0373955_0018510_1773_2591 246
207 3300035410 Ga0373924_0023344 Ga0373924_0023344_666_1484 246
208 3300035724 Ga0373933_0000405 Ga0373933_0000405_1893_2702 246
209 3300035724 Ga0373933_0029430 Ga0373933_0029430_2019_2837 246
210 3300035725 Ga0373947_0195164 Ga0373947_0195164_150_968 246
211 3300039437 Ga0436365_1135249 Ga0436365_1135249_1229_2065 246
212 3300044693 Ga0466961_0135066 Ga0466961_0135066_573_1451 246
213 3300044694 Ga0466963_0074625 Ga0466963_0074625_629_1456 246
214 3300044706 Ga0466964_0020698 Ga0466964_0020698_1257_2135 246
215 3300045049 Ga0466959_0285310 Ga0466959_0285310_22_900 246
216 3300045976 Ga0466967_0253595 Ga0466967_0253595_395_1213 246
217 3300046455 Ga0495603_0030221 Ga0495603_0030221_1920_2738 246
218 3300046459 Ga0495629_0028631 Ga0495629_0028631_2934_3752 246
219 3300046461 Ga0495641_0040792 Ga0495641_0040792_168_986 246
220 3300046472 Ga0495580_0059778 Ga0495580_0059778_1741_2559 246
221 3300046475 Ga0495639_0177395 Ga0495639_0177395_92_910 246
222 3300046476 Ga0495662_0021827 Ga0495662_0021827_1287_2105 246
223 3300046477 Ga0495664_0006628 Ga0495664_0006628_5185_6003 246
224 3300046477 Ga0495664_0032449 Ga0495664_0032449_1069_1887 246
225 3300046511 Ga0495608_0069865 Ga0495608_0069865_1061_1879 246
226 3300046514 Ga0495618_0023163 Ga0495618_0023163_2353_3171 246
227 3300046516 Ga0495628_0346195 Ga0495628_0346195_54_872 246
228 3300046533 Ga0495640_0030630 Ga0495640_0030630_2854_3672 246
229 3300046536 Ga0495587_0104944 Ga0495587_0104944_180_998 246
230 3300046543 Ga0495645_0097372 Ga0495645_0097372_880_1698 246
231 3300046642 Ga0495634_0008812 Ga0495634_0008812_1186_2004 246
232 3300046663 Ga0495635_0135102 Ga0495635_0135102_49_867 246
233 3300046679 Ga0495623_0283695 Ga0495623_0283695_73_891 246
234 3300046681 Ga0495647_0016764 Ga0495647_0016764_1245_2063 246
235 3300046683 Ga0495658_0008269 Ga0495658_0008269_2725_3543 246
236 3300046690 Ga0495624_0116432 Ga0495624_0116432_217_1035 246
237 3300047315 Ga0495581_0006737 Ga0495581_0006737_344_1162 246
238 3300047319 Ga0495674_0033682 Ga0495674_0033682_2058_2876 246
239 3300047471 Ga0495684_0009235 Ga0495684_0009235_5510_6328 246
240 3300047673 Ga0495593_0070075 Ga0495593_0070075_786_1604 246
241 3300048924 Ga0496121_0156870 Ga0496121_0156870_396_1214 246
242 3300048929 Ga0496126_0051799 Ga0496126_0051799_1798_2616 246
243 3300048929 Ga0496126_0084150 Ga0496126_0084150_291_1103 246
244 3300053077 Ga0495601_0039735 Ga0495601_0039735_1878_2696 246
245 3300053078 Ga0495612_0035362 Ga0495612_0035362_746_1564 246
246 3300053085 Ga0495619_0043947 Ga0495619_0043947_2085_2903 246
247 3300061719 Ga0466962_0105239 Ga0466962_0105239_17_895 246
248 3300014969 Ga0157376_10000115 Ga0157376_1000011512 247
249 3300035092 Ga0373952_0001492 Ga0373952_0001492_3417_4241 247
250 3300037466 Ga0395898_0029983 Ga0395898_0029983_3755_4576 247
251 3300044735 Ga0466968_0120191 Ga0466968_0120191_61_873 247
252 3300045049 Ga0466959_0311031 Ga0466959_0311031_55_867 247
253 3300046454 Ga0495592_0024446 Ga0495592_0024446_348_1160 247
254 3300046516 Ga0495628_0221425 Ga0495628_0221425_576_1388 247
255 3300048088 Ga0495602_0184909 Ga0495602_0184909_542_1354 247
256 3300053091 Ga0500647_0013413 Ga0500647_0013413_2595_3407 247
257 3300053111 Ga0500572_002445 Ga0500572_002445_942_1754 247
258 3300005983 Ga0081540_1053606 Ga0081540_10536062 248
259 3300031344 Ga0265316_10146049 Ga0265316_101460492 248
260 3300048924 Ga0496121_0165595 Ga0496121_0165595_528_1346 248
261 3300053091 Ga0500647_0014706 Ga0500647_0014706_123_947 248
262 3300053094 Ga0500566_0000601 Ga0500566_0000601_7586_8410 248
263 3300053095 Ga0500640_002416 Ga0500640_002416_1764_2588 248
264 3300053111 Ga0500572_000764 Ga0500572_000764_610_1434 248
265 3300053122 Ga0500608_009711 Ga0500608_009711_1344_2168 248
266 3300053123 Ga0500614_012119 Ga0500614_012119_700_1524 248
267 3300053136 Ga0500559_0001730 Ga0500559_0001730_2823_3647 248
268 3300053150 Ga0500603_000817 Ga0500603_000817_5413_6237 248
269 3300053159 Ga0500630_001904 Ga0500630_001904_7439_8263 248
270 3300053162 Ga0500638_014810 Ga0500638_014810_1586_2410 248
271 3300053163 Ga0500639_000166 Ga0500639_000166_19248_20072 248
272 3300053735 Ga0500596_000099 Ga0500596_000099_6637_7461 248
273 3300053737 Ga0500601_003394 Ga0500601_003394_438_1262 248
274 3300005336 Ga0070680_100191574 Ga0070680_1001915742 250
275 3300005337 Ga0070682_100050171 Ga0070682_1000501712 250
276 3300005344 Ga0070661_100149064 Ga0070661_1001490642 250
277 3300005364 Ga0070673_100031056 Ga0070673_1000310562 250
278 3300005435 Ga0070714_100228408 Ga0070714_1002284082 250
279 3300005439 Ga0070711_100020384 Ga0070711_1000203842 250
280 3300005445 Ga0070708_100180278 Ga0070708_1001802782 250
281 3300005455 Ga0070663_100078045 Ga0070663_1000780452 250
282 3300005458 Ga0070681_10009919 Ga0070681_100099193 250
283 3300005468 Ga0070707_100193337 Ga0070707_1001933372 250
284 3300005546 Ga0070696_100032178 Ga0070696_1000321782 250
285 3300006237 Ga0097621_100027474 Ga0097621_1000274742 250
286 3300006881 Ga0068865_100063289 Ga0068865_1000632892 250
287 3300007076 Ga0075435_100188240 Ga0075435_1001882402 250
288 3300009093 Ga0105240_10498577 Ga0105240_104985772 250
289 3300009098 Ga0105245_10100285 Ga0105245_101002852 250
290 3300009177 Ga0105248_10313680 Ga0105248_103136802 250
291 3300010375 Ga0105239_10248049 Ga0105239_102480491 250
292 3300013102 Ga0157371_10149528 Ga0157371_101495282 250
293 3300013296 Ga0157374_10221977 Ga0157374_102219772 250
294 3300013297 Ga0157378_10096701 Ga0157378_100967012 250
295 3300013307 Ga0157372_10433353 Ga0157372_104333532 250
296 3300014968 Ga0157379_10090019 Ga0157379_100900192 250
297 3300017792 Ga0163161_10368356 Ga0163161_103683561 250
298 3300025906 Ga0207699_10109785 Ga0207699_101097852 250
299 3300025911 Ga0207654_10084407 Ga0207654_100844072 250
300 3300025912 Ga0207707_10060913 Ga0207707_100609132 250
301 3300025915 Ga0207693_10019862 Ga0207693_100198623 250
302 3300025919 Ga0207657_10092861 Ga0207657_100928612 250
303 3300025921 Ga0207652_10132287 Ga0207652_101322871 250
304 3300025924 Ga0207694_10063171 Ga0207694_100631712 250
305 3300025928 Ga0207700_10199301 Ga0207700_101993012 250
306 3300025933 Ga0207706_10123127 Ga0207706_101231272 250
307 3300025934 Ga0207686_10003168 Ga0207686_100031686 250
308 3300025938 Ga0207704_10044669 Ga0207704_100446692 250
309 3300025939 Ga0207665_10025889 Ga0207665_100258892 250
310 3300025941 Ga0207711_10496167 Ga0207711_104961672 250
311 3300025986 Ga0207658_10048410 Ga0207658_100484103 250
312 3300026023 Ga0207677_10673376 Ga0207677_106733761 250
313 3300026067 Ga0207678_10043627 Ga0207678_100436273 250
314 3300026075 Ga0207708_10181252 Ga0207708_101812522 250
315 3300026078 Ga0207702_10093318 Ga0207702_100933182 250
316 3300026121 Ga0207683_10016464 Ga0207683_100164642 250
317 3300035085 Ga0373929_0014921 Ga0373929_0014921_562_1383 250
318 3300035086 Ga0373934_0003749 Ga0373934_0003749_2618_3439 250
319 3300035089 Ga0373944_0031713 Ga0373944_0031713_202_1023 250
320 3300035111 Ga0373923_0012189 Ga0373923_0012189_1899_2720 250
321 3300035111 Ga0373923_0015440 Ga0373923_0015440_1327_2148 250
322 3300035118 Ga0373954_0001346 Ga0373954_0001346_6685_7506 250
323 3300035119 Ga0373956_0024985 Ga0373956_0024985_1542_2363 250
324 3300035120 Ga0373957_0015792 Ga0373957_0015792_562_1383 250
325 3300035172 Ga0373955_0001882 Ga0373955_0001882_3129_3950 250
326 3300035724 Ga0373933_0002769 Ga0373933_0002769_5844_6665 250
327 3300036401 Ga0373937_0006739 Ga0373937_0006739_7265_8086 250
328 3300037068 Ga0373925_0330099 Ga0373925_0330099_268_1089 250
329 3300046454 Ga0495592_0018264 Ga0495592_0018264_171_992 250
330 3300046461 Ga0495641_0165525 Ga0495641_0165525_66_887 250
331 3300046462 Ga0495651_0010810 Ga0495651_0010810_2101_2922 250
332 3300046463 Ga0495653_0012969 Ga0495653_0012969_5147_5968 250
333 3300046473 Ga0495582_0273918 Ga0495582_0273918_19_840 250
334 3300046476 Ga0495662_0040419 Ga0495662_0040419_1366_2187 250
335 3300046477 Ga0495664_0003198 Ga0495664_0003198_4977_5798 250
336 3300046477 Ga0495664_0028886 Ga0495664_0028886_1792_2613 250
337 3300046499 Ga0495594_0025442 Ga0495594_0025442_1000_1821 250
338 3300046511 Ga0495608_0028120 Ga0495608_0028120_2035_2856 250
339 3300046514 Ga0495618_0002331 Ga0495618_0002331_10577_11398 250
340 3300046516 Ga0495628_0007123 Ga0495628_0007123_4654_5475 250
341 3300046517 Ga0495630_0045284 Ga0495630_0045284_2417_3238 250
342 3300046526 Ga0495666_0087148 Ga0495666_0087148_505_1326 250
343 3300046529 Ga0495652_0048649 Ga0495652_0048649_2163_2984 250
344 3300046533 Ga0495640_0008129 Ga0495640_0008129_914_1735 250
345 3300046535 Ga0495586_0037195 Ga0495586_0037195_63_884 250
346 3300046536 Ga0495587_0001044 Ga0495587_0001044_14177_14998 250
347 3300046543 Ga0495645_0001990 Ga0495645_0001990_2513_3334 250
348 3300046543 Ga0495645_0052865 Ga0495645_0052865_463_1284 250
349 3300046559 Ga0495667_0004872 Ga0495667_0004872_820_1641 250
350 3300046642 Ga0495634_0015598 Ga0495634_0015598_1961_2782 250
351 3300046663 Ga0495635_0009828 Ga0495635_0009828_2594_3415 250
352 3300046663 Ga0495635_0040935 Ga0495635_0040935_1776_2597 250
353 3300046675 Ga0495657_0002213 Ga0495657_0002213_14372_15193 250
354 3300046678 Ga0495599_0001186 Ga0495599_0001186_7137_7958 250
355 3300046679 Ga0495623_0003875 Ga0495623_0003875_6880_7701 250
356 3300046680 Ga0495646_0003107 Ga0495646_0003107_8369_9190 250
357 3300046681 Ga0495647_0104926 Ga0495647_0104926_208_1029 250
358 3300046683 Ga0495658_0032919 Ga0495658_0032919_1526_2347 250
359 3300046689 Ga0495613_0068219 Ga0495613_0068219_1189_2010 250
360 3300046690 Ga0495624_0028545 Ga0495624_0028545_199_1020 250
361 3300046809 Ga0495600_0002653 Ga0495600_0002653_6104_6925 250
362 3300047315 Ga0495581_0103529 Ga0495581_0103529_425_1246 250
363 3300047317 Ga0495604_0001816 Ga0495604_0001816_14169_14990 250
364 3300047319 Ga0495674_0010890 Ga0495674_0010890_2845_3666 250
365 3300047319 Ga0495674_0023062 Ga0495674_0023062_2845_3666 250
366 3300047321 Ga0495676_0179382 Ga0495676_0179382_528_1349 250
367 3300047322 Ga0495680_0003209 Ga0495680_0003209_12336_13157 250
368 3300047322 Ga0495680_0034028 Ga0495680_0034028_805_1626 250
369 3300047444 Ga0495675_0024808 Ga0495675_0024808_1885_2706 250
370 3300047471 Ga0495684_0009698 Ga0495684_0009698_5516_6337 250
371 3300047673 Ga0495593_0042607 Ga0495593_0042607_483_1304 250
372 3300047673 Ga0495593_0141805 Ga0495593_0141805_322_1143 250
373 3300048088 Ga0495602_0004062 Ga0495602_0004062_8420_9241 250
374 3300048904 Ga0496101_0077212 Ga0496101_0077212_1254_2075 250
375 3300048909 Ga0496106_0213804 Ga0496106_0213804_389_1210 250
376 3300048910 Ga0496107_0013936 Ga0496107_0013936_4454_5275 250
377 3300048910 Ga0496107_0125420 Ga0496107_0125420_126_947 250
378 3300048911 Ga0496108_0125315 Ga0496108_0125315_828_1649 250
379 3300048913 Ga0496110_0141302 Ga0496110_0141302_152_973 250
380 3300048914 Ga0496111_0193692 Ga0496111_0193692_101_922 250
381 3300048915 Ga0496112_0181405 Ga0496112_0181405_775_1596 250
382 3300050513 nmdc:mga0rr50_258687_c1 nmdc:mga0rr50_258687_c1_577_1398 250
383 3300053077 Ga0495601_0001947 Ga0495601_0001947_10037_10858 250
384 3300053077 Ga0495601_0056066 Ga0495601_0056066_876_1697 250
385 3300053078 Ga0495612_0014271 Ga0495612_0014271_1593_2414 250
386 3300053078 Ga0495612_0046223 Ga0495612_0046223_876_1697 250
387 3300053084 Ga0495595_0000210 Ga0495595_0000210_14576_15397 250
388 3300053085 Ga0495619_0021558 Ga0495619_0021558_876_1697 250
389 3300053093 Ga0500651_0279020 Ga0500651_0279020_52_876 250
390 3300053153 Ga0500616_0000002 Ga0500616_0000002_359540_360364 250
391 2162886007 SwRhRL2b_contig_33951 SwRhRL2b_0963.00004510 251
392 2209111006 2214828538 2213866829 251
393 3300000041 ARcpr5oldR_c000313 ARcpr5oldR_0003132 251
394 3300000042 ARSoilYngRDRAFT_c00053 ARSoilYngRDRAFT_0005314 251
395 3300000043 ARcpr5yngRDRAFT_c000301 ARcpr5yngRDRAFT_0003015 251
396 3300000044 ARSoilOldRDRAFT_c000153 ARSoilOldRDRAFT_0001532 251
397 3300000045 ARCol0oldRDRAFT_c00420 ARCol0oldRDRAFT_004202 251
398 3300000652 ARCol0yngRDRAFT_1000331 ARCol0yngRDRAFT_10003312 251
399 3300001430 JGI24032J14994_100120 JGI24032J14994_1001202 251
400 3300001915 JGI24741J21665_1003546 JGI24741J21665_10035462 251
401 3300001976 JGI24752J21851_1002539 JGI24752J21851_10025391 251
402 3300001977 JGI24746J21847_1000814 JGI24746J21847_10008142 251
403 3300001978 JGI24747J21853_1009258 JGI24747J21853_10092581 251
404 3300001989 JGI24739J22299_10003550 JGI24739J22299_100035504 251
405 3300001990 JGI24737J22298_10000601 JGI24737J22298_100006012 251
406 3300001990 JGI24737J22298_10004158 JGI24737J22298_100041585 251
407 3300002070 JGI24750J21931_1000123 JGI24750J21931_10001238 251
408 3300002073 JGI24745J21846_1000297 JGI24745J21846_10002972 251
409 3300002074 JGI24748J21848_1000892 JGI24748J21848_10008922 251
410 3300002075 JGI24738J21930_10000038 JGI24738J21930_1000003811 251
411 3300002076 JGI24749J21850_1001514 JGI24749J21850_10015142 251
412 3300002076 JGI24749J21850_1007311 JGI24749J21850_10073112 251
413 3300002126 JGI24035J26624_1000111 JGI24035J26624_10001116 251
414 3300002126 JGI24035J26624_1000136 JGI24035J26624_10001364 251
415 3300002126 JGI24035J26624_1000723 JGI24035J26624_10007232 251
416 3300002239 JGI24034J26672_10000166 JGI24034J26672_100001662 251
417 3300002459 JGI24751J29686_10021534 JGI24751J29686_100215341 251
418 3300003911 JGI25405J52794_10009992 JGI25405J52794_100099921 251
419 3300005277 Ga0065716_1001869 Ga0065716_10018692 251
420 3300005289 Ga0065704_10004708 Ga0065704_100047082 251
421 3300005290 Ga0065712_10007259 Ga0065712_100072592 251
422 3300005290 Ga0065712_10069569 Ga0065712_100695695 251
423 3300005290 Ga0065712_10074939 Ga0065712_100749393 251
424 3300005293 Ga0065715_10091436 Ga0065715_100914365 251
425 3300005295 Ga0065707_10090977 Ga0065707_100909772 251
426 3300005328 Ga0070676_10000799 Ga0070676_100007996 251
427 3300005329 Ga0070683_100000121 Ga0070683_10000012113 251
428 3300005330 Ga0070690_100003148 Ga0070690_1000031485 251
429 3300005330 Ga0070690_100010712 Ga0070690_1000107123 251
430 3300005331 Ga0070670_100347819 Ga0070670_1003478192 251
431 3300005333 Ga0070677_10000173 Ga0070677_1000017320 251
432 3300005334 Ga0068869_100035313 Ga0068869_1000353132 251
433 3300005335 Ga0070666_10025730 Ga0070666_100257302 251
434 3300005336 Ga0070680_100009394 Ga0070680_1000093942 251
435 3300005336 Ga0070680_100242891 Ga0070680_1002428912 251
436 3300005337 Ga0070682_100000657 Ga0070682_10000065710 251
437 3300005338 Ga0068868_100003270 Ga0068868_1000032707 251
438 3300005339 Ga0070660_100005245 Ga0070660_1000052456 251
439 3300005339 Ga0070660_100032617 Ga0070660_1000326172 251
440 3300005340 Ga0070689_100002414 Ga0070689_1000024148 251
441 3300005341 Ga0070691_10000646 Ga0070691_100006466 251
442 3300005344 Ga0070661_100000532 Ga0070661_10000053218 251
443 3300005345 Ga0070692_10001016 Ga0070692_100010168 251
444 3300005345 Ga0070692_10061433 Ga0070692_100614332 251
445 3300005347 Ga0070668_100004720 Ga0070668_1000047207 251
446 3300005347 Ga0070668_100052767 Ga0070668_1000527672 251
447 3300005353 Ga0070669_100000271 Ga0070669_10000027112 251
448 3300005353 Ga0070669_100087105 Ga0070669_1000871052 251
449 3300005354 Ga0070675_100001127 Ga0070675_1000011278 251
450 3300005355 Ga0070671_100000771 Ga0070671_10000077114 251
451 3300005356 Ga0070674_100000116 Ga0070674_10000011628 251
452 3300005364 Ga0070673_100004024 Ga0070673_1000040243 251
453 3300005365 Ga0070688_100029442 Ga0070688_1000294422 251
454 3300005366 Ga0070659_100003582 Ga0070659_1000035821 251
455 3300005367 Ga0070667_100001755 Ga0070667_10000175510 251
456 3300005406 Ga0070703_10008628 Ga0070703_100086282 251
457 3300005438 Ga0070701_10022765 Ga0070701_100227652 251
458 3300005440 Ga0070705_100001685 Ga0070705_1000016852 251
459 3300005441 Ga0070700_100001234 Ga0070700_1000012349 251
460 3300005441 Ga0070700_100055522 Ga0070700_1000555222 251
461 3300005444 Ga0070694_100023465 Ga0070694_1000234653 251
462 3300005445 Ga0070708_100033540 Ga0070708_1000335405 251
463 3300005455 Ga0070663_100003065 Ga0070663_1000030657 251
464 3300005456 Ga0070678_100001829 Ga0070678_1000018295 251
465 3300005457 Ga0070662_100000164 Ga0070662_1000001645 251
466 3300005457 Ga0070662_100046957 Ga0070662_1000469572 251
467 3300005458 Ga0070681_10000701 Ga0070681_1000070122 251
468 3300005459 Ga0068867_100000082 Ga0068867_10000008221 251
469 3300005466 Ga0070685_10001328 Ga0070685_100013285 251
470 3300005518 Ga0070699_100133337 Ga0070699_1001333372 251
471 3300005530 Ga0070679_100006574 Ga0070679_1000065741 251
472 3300005535 Ga0070684_100001318 Ga0070684_1000013183 251
473 3300005539 Ga0068853_100130587 Ga0068853_1001305872 251
474 3300005543 Ga0070672_100000255 Ga0070672_10000025520 251
475 3300005544 Ga0070686_100001726 Ga0070686_1000017268 251
476 3300005544 Ga0070686_100414207 Ga0070686_1004142072 251
477 3300005545 Ga0070695_100001928 Ga0070695_1000019288 251
478 3300005545 Ga0070695_100029212 Ga0070695_1000292122 251
479 3300005546 Ga0070696_100006308 Ga0070696_1000063082 251
480 3300005546 Ga0070696_100066329 Ga0070696_1000663292 251
481 3300005547 Ga0070693_100000112 Ga0070693_1000001123 251
482 3300005549 Ga0070704_100001489 Ga0070704_1000014898 251
483 3300005549 Ga0070704_100009285 Ga0070704_1000092852 251
484 3300005563 Ga0068855_100008692 Ga0068855_1000086922 251
485 3300005564 Ga0070664_100000373 Ga0070664_1000003732 251
486 3300005577 Ga0068857_100000603 Ga0068857_10000060314 251
487 3300005578 Ga0068854_100000140 Ga0068854_10000014040 251
488 3300005614 Ga0068856_100002491 Ga0068856_10000249119 251
489 3300005615 Ga0070702_100000220 Ga0070702_10000022010 251
490 3300005617 Ga0068859_100008360 Ga0068859_1000083602 251
491 3300005618 Ga0068864_100000477 Ga0068864_10000047730 251
492 3300005718 Ga0068866_10000658 Ga0068866_100006582 251
493 3300005719 Ga0068861_100051959 Ga0068861_1000519592 251
494 3300005719 Ga0068861_100060572 Ga0068861_1000605722 251
495 3300005840 Ga0068870_10001108 Ga0068870_100011087 251
496 3300005841 Ga0068863_100002673 Ga0068863_1000026737 251
497 3300005842 Ga0068858_100007716 Ga0068858_1000077162 251
498 3300005843 Ga0068860_100006849 Ga0068860_1000068493 251
499 3300005843 Ga0068860_100105673 Ga0068860_1001056732 251
500 3300005844 Ga0068862_100007893 Ga0068862_1000078936 251
501 3300005937 Ga0081455_10008902 Ga0081455_100089022 251
502 3300006058 Ga0075432_10013533 Ga0075432_100135331 251
503 3300006178 Ga0075367_10002122 Ga0075367_100021227 251
504 3300006237 Ga0097621_100000083 Ga0097621_10000008339 251
505 3300006358 Ga0068871_100000067 Ga0068871_10000006739 251
506 3300006852 Ga0075433_10000023 Ga0075433_1000002358 251
507 3300006852 Ga0075433_10018499 Ga0075433_100184992 251
508 3300006871 Ga0075434_100000980 Ga0075434_1000009809 251
509 3300006871 Ga0075434_100520564 Ga0075434_1005205642 251
510 3300006881 Ga0068865_100000622 Ga0068865_1000006229 251
511 3300006931 Ga0097620_100008360 Ga0097620_1000083602 251
512 3300007076 Ga0075435_100003962 Ga0075435_1000039622 251
513 3300009093 Ga0105240_10244116 Ga0105240_102441162 251
514 3300009094 Ga0111539_10003501 Ga0111539_1000350110 251
515 3300009094 Ga0111539_10004884 Ga0111539_1000488415 251
516 3300009098 Ga0105245_10001233 Ga0105245_1000123313 251
517 3300009098 Ga0105245_10116944 Ga0105245_101169442 251
518 3300009101 Ga0105247_10001479 Ga0105247_100014797 251
519 3300009101 Ga0105247_10021338 Ga0105247_100213382 251
520 3300009148 Ga0105243_10002805 Ga0105243_1000280511 251
521 3300009174 Ga0105241_10001174 Ga0105241_1000117411 251
522 3300009176 Ga0105242_10000036 Ga0105242_1000003657 251
523 3300009177 Ga0105248_10004963 Ga0105248_1000496311 251
524 3300009545 Ga0105237_10005966 Ga0105237_1000596611 251
525 3300009545 Ga0105237_10313821 Ga0105237_103138212 251
526 3300009551 Ga0105238_10200201 Ga0105238_102002012 251
527 3300009553 Ga0105249_10001279 Ga0105249_1000127912 251
528 3300009553 Ga0105249_10005862 Ga0105249_100058624 251
529 3300010375 Ga0105239_10003292 Ga0105239_100032929 251
530 3300011119 Ga0105246_10001244 Ga0105246_100012445 251
531 3300013102 Ga0157371_10288013 Ga0157371_102880132 251
532 3300013296 Ga0157374_10001349 Ga0157374_1000134910 251
533 3300013306 Ga0163162_10001803 Ga0163162_1000180310 251
534 3300013307 Ga0157372_10533040 Ga0157372_105330401 251
535 3300013308 Ga0157375_10003554 Ga0157375_100035547 251
536 3300014325 Ga0163163_10007224 Ga0163163_100072242 251
537 3300014325 Ga0163163_10031750 Ga0163163_100317503 251
538 3300014326 Ga0157380_10000141 Ga0157380_100001418 251
539 3300014745 Ga0157377_10000124 Ga0157377_1000012439 251
540 3300014968 Ga0157379_10003074 Ga0157379_100030745 251
541 3300014968 Ga0157379_10013614 Ga0157379_100136142 251
542 3300017792 Ga0163161_10002816 Ga0163161_100028165 251
543 3300025263 Ga0209565_1000331 Ga0209565_100033113 251
544 3300025271 Ga0207666_1000192 Ga0207666_10001922 251
545 3300025290 Ga0207673_1000006 Ga0207673_10000064 251
546 3300025291 Ga0209675_1001925 Ga0209675_10019253 251
547 3300025294 Ga0209025_1037899 Ga0209025_10378992 251
548 3300025315 Ga0207697_10000039 Ga0207697_1000003939 251
549 3300025315 Ga0207697_10054462 Ga0207697_100544622 251
550 3300025885 Ga0207653_10003137 Ga0207653_100031372 251
551 3300025893 Ga0207682_10000135 Ga0207682_1000013531 251
552 3300025899 Ga0207642_10000274 Ga0207642_1000027410 251
553 3300025900 Ga0207710_10006877 Ga0207710_100068772 251
554 3300025901 Ga0207688_10003046 Ga0207688_100030462 251
555 3300025901 Ga0207688_10051095 Ga0207688_100510952 251
556 3300025903 Ga0207680_10023583 Ga0207680_100235832 251
557 3300025904 Ga0207647_10001409 Ga0207647_100014099 251
558 3300025904 Ga0207647_10094134 Ga0207647_100941342 251
559 3300025907 Ga0207645_10000114 Ga0207645_1000011412 251
560 3300025908 Ga0207643_10000134 Ga0207643_1000013442 251
561 3300025911 Ga0207654_10000402 Ga0207654_1000040212 251
562 3300025912 Ga0207707_10003615 Ga0207707_100036159 251
563 3300025912 Ga0207707_10042718 Ga0207707_100427182 251
564 3300025914 Ga0207671_10014739 Ga0207671_100147395 251
565 3300025917 Ga0207660_10000034 Ga0207660_1000003419 251
566 3300025917 Ga0207660_10180918 Ga0207660_101809182 251
567 3300025918 Ga0207662_10002535 Ga0207662_100025352 251
568 3300025918 Ga0207662_10020419 Ga0207662_100204192 251
569 3300025919 Ga0207657_10000425 Ga0207657_1000042512 251
570 3300025919 Ga0207657_10039018 Ga0207657_100390183 251
571 3300025920 Ga0207649_10000142 Ga0207649_100001428 251
572 3300025921 Ga0207652_10001667 Ga0207652_1000166717 251
573 3300025921 Ga0207652_10079746 Ga0207652_100797462 251
574 3300025923 Ga0207681_10000065 Ga0207681_1000006547 251
575 3300025925 Ga0207650_10356289 Ga0207650_103562892 251
576 3300025926 Ga0207659_10000078 Ga0207659_1000007852 251
577 3300025927 Ga0207687_10000125 Ga0207687_1000012552 251
578 3300025931 Ga0207644_10003174 Ga0207644_1000317410 251
579 3300025932 Ga0207690_10000200 Ga0207690_100002008 251
580 3300025933 Ga0207706_10000435 Ga0207706_1000043531 251
581 3300025933 Ga0207706_10032289 Ga0207706_100322894 251
582 3300025934 Ga0207686_10000251 Ga0207686_1000025136 251
583 3300025935 Ga0207709_10000183 Ga0207709_1000018339 251
584 3300025936 Ga0207670_10001020 Ga0207670_100010203 251
585 3300025937 Ga0207669_10000081 Ga0207669_1000008114 251
586 3300025938 Ga0207704_10000419 Ga0207704_1000041913 251
587 3300025940 Ga0207691_10002274 Ga0207691_100022748 251
588 3300025940 Ga0207691_10188363 Ga0207691_101883632 251
589 3300025941 Ga0207711_10000766 Ga0207711_1000076628 251
590 3300025942 Ga0207689_10000144 Ga0207689_1000014442 251
591 3300025944 Ga0207661_10000670 Ga0207661_100006702 251
592 3300025945 Ga0207679_10000064 Ga0207679_1000006454 251
593 3300025949 Ga0207667_10011544 Ga0207667_100115444 251
594 3300025960 Ga0207651_10001490 Ga0207651_100014904 251
595 3300025961 Ga0207712_10001565 Ga0207712_100015654 251
596 3300025961 Ga0207712_10025428 Ga0207712_100254282 251
597 3300025972 Ga0207668_10000162 Ga0207668_100001628 251
598 3300025972 Ga0207668_10006356 Ga0207668_100063564 251
599 3300025981 Ga0207640_10001145 Ga0207640_100011459 251
600 3300025986 Ga0207658_10001102 Ga0207658_100011029 251
601 3300026035 Ga0207703_10006015 Ga0207703_100060154 251
602 3300026041 Ga0207639_10002011 Ga0207639_1000201112 251
603 3300026041 Ga0207639_10074311 Ga0207639_100743112 251
604 3300026067 Ga0207678_10000344 Ga0207678_1000034431 251
605 3300026075 Ga0207708_10004403 Ga0207708_100044032 251
606 3300026075 Ga0207708_10176850 Ga0207708_101768502 251
607 3300026078 Ga0207702_10003261 Ga0207702_100032617 251
608 3300026078 Ga0207702_10373027 Ga0207702_103730272 251
609 3300026088 Ga0207641_10000941 Ga0207641_100009412 251
610 3300026089 Ga0207648_10009121 Ga0207648_100091212 251
611 3300026095 Ga0207676_10000079 Ga0207676_1000007948 251
612 3300026116 Ga0207674_10000323 Ga0207674_1000032312 251
613 3300026118 Ga0207675_100000270 Ga0207675_10000027039 251
614 3300026118 Ga0207675_100072520 Ga0207675_1000725202 251
615 3300026121 Ga0207683_10000037 Ga0207683_1000003752 251
616 3300027526 Ga0209968_1007176 Ga0209968_10071762 251
617 3300027617 Ga0210002_1000408 Ga0210002_10004085 251
618 3300027682 Ga0209971_1004232 Ga0209971_10042321 251
619 3300027682 Ga0209971_1005256 Ga0209971_10052562 251
620 3300027682 Ga0209971_1015152 Ga0209971_10151522 251
621 3300027717 Ga0209998_10015227 Ga0209998_100152272 251
622 3300027876 Ga0209974_10000966 Ga0209974_100009662 251
623 3300027876 Ga0209974_10036917 Ga0209974_100369172 251
624 3300027907 Ga0207428_10000292 Ga0207428_1000029241 251
625 3300027907 Ga0207428_10001579 Ga0207428_1000157914 251
626 3300027907 Ga0207428_10003547 Ga0207428_1000354710 251
627 3300028379 Ga0268266_10036702 Ga0268266_100367023 251
628 3300028380 Ga0268265_10001049 Ga0268265_100010498 251
629 3300028380 Ga0268265_10042149 Ga0268265_100421492 251
630 3300028381 Ga0268264_10000583 Ga0268264_1000058310 251
631 3300028381 Ga0268264_10062581 Ga0268264_100625812 251
632 3300034816 Ga0373930_0000021 Ga0373930_0000021_12164_12988 251
633 3300034817 Ga0373948_0010220 Ga0373948_0010220_276_1100 251
634 3300034818 Ga0373950_0000378 Ga0373950_0000378_3721_4545 251
635 3300034819 Ga0373958_0001112 Ga0373958_0001112_1943_2767 251
636 3300034819 Ga0373958_0002233 Ga0373958_0002233_1697_2521 251
637 3300034820 Ga0373959_0000359 Ga0373959_0000359_640_1464 251
638 3300034957 Ga0373938_0000071 Ga0373938_0000071_698_1522 251
639 3300034957 Ga0373938_0008054 Ga0373938_0008054_520_1344 251
640 3300035084 Ga0373928_0000327 Ga0373928_0000327_4392_5216 251
641 3300035085 Ga0373929_0000383 Ga0373929_0000383_6084_6908 251
642 3300035085 Ga0373929_0012950 Ga0373929_0012950_275_1099 251
643 3300035090 Ga0373949_0001992 Ga0373949_0001992_4359_5183 251
644 3300035090 Ga0373949_0005070 Ga0373949_0005070_506_1330 251
645 3300035091 Ga0373951_0000680 Ga0373951_0000680_7753_8577 251
646 3300035091 Ga0373951_0016149 Ga0373951_0016149_612_1436 251
647 3300035092 Ga0373952_0000018 Ga0373952_0000018_1454_2278 251
648 3300035112 Ga0373932_0001209 Ga0373932_0001209_5728_6552 251
649 3300035112 Ga0373932_0007755 Ga0373932_0007755_531_1355 251
650 3300035114 Ga0373939_0000588 Ga0373939_0000588_7452_8276 251
651 3300035114 Ga0373939_0037201 Ga0373939_0037201_20_844 251
652 3300035115 Ga0373941_0010419 Ga0373941_0010419_277_1101 251
653 3300035121 Ga0373960_0003427 Ga0373960_0003427_1981_2805 251
654 3300035121 Ga0373960_0008483 Ga0373960_0008483_434_1258 251
655 3300035207 Ga0373942_0005273 Ga0373942_0005273_1033_1857 251
656 3300035207 Ga0373942_0008670 Ga0373942_0008670_1397_2221 251
657 3300035241 Ga0373961_0002538 Ga0373961_0002538_3032_3856 251
658 3300035241 Ga0373961_0003990 Ga0373961_0003990_2240_3064 251
659 3300035242 Ga0373962_0000206 Ga0373962_0000206_9932_10756 251
660 3300035691 Ga0373931_0000727 Ga0373931_0000727_4434_5258 251
661 3300038996 Ga0242420_002702 Ga0242420_002702_1576_2400 251
662 3300042016 Ga0439463_026509 Ga0439463_026509_219_1043 251
663 3300042439 Ga0439464_0008938 Ga0439464_0008938_425_1249 251
664 3300042876 Ga0451577_0150468 Ga0451577_0150468_640_1464 251
665 3300044712 Ga0453684_0297295 Ga0453684_0297295_276_1100 251
666 3300046460 Ga0495638_0024123 Ga0495638_0024123_1932_2756 251
667 3300046491 Ga0495584_0044146 Ga0495584_0044146_910_1734 251
668 3300046684 Ga0495669_0065482 Ga0495669_0065482_499_1323 251
669 3300048903 Ga0496100_0000172 Ga0496100_0000172_31100_31924 251
670 3300048904 Ga0496101_0000406 Ga0496101_0000406_20515_21339 251
671 3300048905 Ga0496102_0006743 Ga0496102_0006743_3870_4694 251
672 3300048905 Ga0496102_0157367 Ga0496102_0157367_244_1068 251
673 3300048906 Ga0496103_0002977 Ga0496103_0002977_5111_5935 251
674 3300048907 Ga0496104_0115052 Ga0496104_0115052_1113_1937 251
675 3300048908 Ga0496105_0260008 Ga0496105_0260008_339_1163 251
676 3300048909 Ga0496106_0005006 Ga0496106_0005006_5111_5935 251
677 3300048909 Ga0496106_0015033 Ga0496106_0015033_3253_4077 251
678 3300048910 Ga0496107_0000560 Ga0496107_0000560_9890_10714 251
679 3300048910 Ga0496107_0165894 Ga0496107_0165894_463_1287 251
680 3300048911 Ga0496108_0006778 Ga0496108_0006778_7358_8182 251
681 3300048911 Ga0496108_0045231 Ga0496108_0045231_383_1207 251
682 3300048911 Ga0496108_0443305 Ga0496108_0443305_287_1111 251
683 3300048912 Ga0496109_0000260 Ga0496109_0000260_37706_38530 251
684 3300048912 Ga0496109_0001609 Ga0496109_0001609_10909_11733 251
685 3300048913 Ga0496110_0190051 Ga0496110_0190051_670_1494 251
686 3300048913 Ga0496110_0338644 Ga0496110_0338644_64_888 251
687 3300048914 Ga0496111_0091813 Ga0496111_0091813_1248_2072 251
688 3300048915 Ga0496112_0063965 Ga0496112_0063965_1380_2204 251
689 3300048916 Ga0496113_0000719 Ga0496113_0000719_9386_10210 251
690 3300048916 Ga0496113_0207870 Ga0496113_0207870_595_1419 251
691 3300048917 Ga0496114_0000689 Ga0496114_0000689_3780_4604 251
692 3300048918 Ga0496115_0010342 Ga0496115_0010342_4411_5235 251
693 3300050495 nmdc:mga04h51_15605_c1 nmdc:mga04h51_15605_c1_1031_1855 251
694 3300050496 nmdc:mga07m45_76269_c1 nmdc:mga07m45_76269_c1_51_875 251
695 3300050508 nmdc:mga09592_305_c1 nmdc:mga09592_305_c1_20031_20855 251
696 3300050509 nmdc:mga0qj67_690_c1 nmdc:mga0qj67_690_c1_16846_17670 251
697 3300050511 nmdc:mga08y16_108532_c1 nmdc:mga08y16_108532_c1_142_966 251
698 3300050511 nmdc:mga08y16_2782_c1 nmdc:mga08y16_2782_c1_816_1640 251
699 3300050511 nmdc:mga08y16_70534_c1 nmdc:mga08y16_70534_c1_252_1076 251
700 3300050512 nmdc:mga0n895_495822_c1 nmdc:mga0n895_495822_c1_171_995 251
701 3300050512 nmdc:mga0n895_512_c1 nmdc:mga0n895_512_c1_22485_23309 251
702 3300050512 nmdc:mga0n895_636_c1 nmdc:mga0n895_636_c1_13614_14438 251
703 3300050513 nmdc:mga0rr50_16801_c1 nmdc:mga0rr50_16801_c1_2534_3358 251
704 3300050515 nmdc:mga0a205_9418_c1 nmdc:mga0a205_9418_c1_7401_8225 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05050

Methyltransf_21

Methyltransferase FkbM domain

75

232

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wwr-assembly2.cif.gz_B crystal structure of human nsun6/trna/sfg 0.9151 69 125
2b9e-assembly1.cif.gz_A human nsun5 protein 0.8946 69 128
5dnk-assembly1.cif.gz_B the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.8478 69 128
5wwq-assembly1.cif.gz_A crystal structure of human nsun6 0.8415 73 125
7ogj-assembly1.cif.gz_A crystal structure of human mettl1 in complex with sah 0.8254 70 126
ID Description Score Start End Superfamily
af_Q8TEA1_224_469_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9168 69 125 3.40.50.150
af_Q8L8R4_95_308_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9083 72 124 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9073 71 128 3.40.50.150
af_Q96P11_211_428_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9032 69 128 3.40.50.150
4kigA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8739 71 128 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2S5R0D4-F1-model_v4 FkbM family methyltransferase 0.9743 3 237 GO:0008168
GO:0032259
AF-A0A258NV33-F1-model_v4 FkbM family methyltransferase 0.9737 20 240 GO:0008168
GO:0032259
AF-A0A2S5N492-F1-model_v4 FkbM family methyltransferase 0.9692 69 237 GO:0008168
GO:0032259
AF-A0A3S5F5F4-F1-model_v4 deleted 0.9644 1 130
AF-A0A522IDU9-F1-model_v4 FkbM family methyltransferase 0.9614 1 243 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map