F476242

General Info

Members Datasets Scaffolds Average Seq Length
702 326 683 300

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0016771|Ga0501069_0016771_2458_3462
Length 334
Sequence LKSRFLLLGAALWCCAQGADASSAASRFCDAAAPMSARQEDRLLRFAAIVRQELDKSGETVALVARSGVDLGRFGLRYSHAGVSLKASGNTPWSVRQLYYACDEQRPRLYDQGLSGFLFGTGDPDAGYVSIVLLNGADAAALEHAAQDTALALRLLAASYSANAYPFSVSYQNCNQWVAELLAAAWGSLDDAPDLRERAQGWLLKSGYEPTAVDVGSHWLMALAPFVPFMHFDDHPPDDAYALRVRTSLPRAIEAFVHKRLPAAVRIEMCHDGGKAVIHRGWQPIAQGCRPRDGDRVVDLDGRFARSEAPTSSPPPSTDPRRDRCRRCRTALAR

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221660 Methylibium sp. Root1272 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2738541277 Variovorax sp. GV051 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738543018 Massilia sp. GV045 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2831864461 Roseateles noduli HZ7 Isolate Nodule
15 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
16 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
17 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
18 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
202 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
323 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.29
Metatranscriptomes 0
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.53
Nodule 0.71
Rhizoplane 1.28
Rhizosphere 74.5
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000149 3300002705 Bacteria 51819
2 JGI25154J39366_1003663 3300002738 Bacteria 3111
3 JGI25157J39369_1000192 3300002741 Bacteria 51783
4 JGI25159J45721_1001772 3300002987 Bacteria 8671
5 JGI25153J46596_10001052 3300003215 Bacteria 16838
6 rootH1_10033226 3300003316 Bacteria 5688
7 rootH2_10018082 3300003320 Bacteria 11753
8 rootL2_10001457 3300003322 Bacteria 117785
9 rootL2_10024434 3300003322 Bacteria 5116
10 rootL2_10046301 3300003322 Bacteria 4628
11 rootL2_10062783 3300003322 Bacteria 3025
12 rootL2_10077657 3300003322 Bacteria 5306
13 rootH1_10013779 3300003323 Bacteria 5444
14 rootH1_10015942 3300003323 Bacteria 14163
15 rootH1_10020465 3300003323 Bacteria 4161
16 rootH1_10099691 3300003323 Bacteria 3074
17 Ga0055525_1000006 3300003759 Bacteria 642912
18 Ga0055525_1000053 3300003759 Bacteria 218067
19 Ga0055526_1001590 3300003771 Bacteria 15942
20 Ga0055526_1001902 3300003771 Bacteria 14469
21 Ga0055537_1000139 3300003773 Bacteria 54248
22 Ga0055524_1000310 3300003775 Bacteria 46341
23 Ga0055524_1000469 3300003775 Bacteria 32369
24 Ga0055534_1000942 3300003784 Bacteria 12974
25 Ga0055528_1000703 3300003790 Bacteria 23724
26 Ga0055530_10000630 3300003791 Bacteria 30400
27 Ga0055540_1000173 3300003792 Bacteria 63434
28 Ga0055540_1032310 3300003792 Bacteria 1195
29 Ga0055531_10002922 3300003794 Bacteria 11126
30 Ga0055531_10003132 3300003794 Bacteria 10666
31 Ga0055543_1007311 3300004625 Bacteria 2568
32 Ga0065165_1000220 3300005262 Bacteria 100027
33 Ga0065165_1000590 3300005262 Bacteria 53214
34 Ga0065165_1001052 3300005262 Bacteria 33179
35 Ga0065165_1050188 3300005262 Bacteria 1189
36 Ga0065712_10001949 3300005290 Bacteria 5275
37 Ga0065707_10088331 3300005295 Bacteria 4690
38 Ga0070658_10131552 3300005327 Bacteria 2085
39 Ga0070683_100005154 3300005329 Bacteria 10869
40 Ga0070690_100117169 3300005330 Bacteria 1784
41 Ga0068869_100074025 3300005334 Bacteria 2527
42 Ga0070666_10216573 3300005335 Bacteria 1350
43 Ga0070660_100100087 3300005339 Bacteria 2295
44 Ga0070689_100032310 3300005340 Bacteria 3980
45 Ga0070687_100172304 3300005343 Bacteria 1289
46 Ga0070661_100047409 3300005344 Bacteria 3144
47 Ga0070668_100117523 3300005347 Bacteria 2122
48 Ga0070675_100083588 3300005354 Bacteria 2665
49 Ga0070671_100062310 3300005355 Bacteria 3106
50 Ga0070671_100158775 3300005355 Bacteria 1911
51 Ga0070659_100019281 3300005366 Bacteria 5165
52 Ga0070659_100321657 3300005366 Bacteria 1293
53 Ga0070667_100128572 3300005367 Bacteria 2210
54 Ga0070667_100239763 3300005367 Bacteria 1619
55 Ga0070700_100122044 3300005441 Bacteria 1747
56 Ga0070663_100000131 3300005455 Bacteria 35664
57 Ga0070678_100014409 3300005456 Bacteria 4989
58 Ga0070678_100237995 3300005456 Bacteria 1521
59 Ga0070662_100051059 3300005457 Bacteria 2985
60 Ga0070662_100130984 3300005457 Bacteria 1933
61 Ga0068867_100061328 3300005459 Bacteria 2792
62 Ga0068867_100068947 3300005459 Bacteria 2640
63 Ga0068867_100304076 3300005459 Bacteria 1316
64 Ga0070706_100076703 3300005467 Bacteria 3093
65 Ga0070698_100157406 3300005471 Bacteria 2217
66 Ga0070684_100006125 3300005535 Bacteria 9269
67 Ga0070684_100076143 3300005535 Bacteria 2961
68 Ga0068853_100019086 3300005539 Bacteria 5680
69 Ga0068853_100033545 3300005539 Bacteria 4356
70 Ga0068853_100056344 3300005539 Bacteria 3389
71 Ga0068853_100314873 3300005539 Unclassified 1450
72 Ga0070672_100052997 3300005543 Bacteria 3170
73 Ga0070695_100383640 3300005545 Bacteria 1061
74 Ga0070693_100009342 3300005547 Bacteria 4874
75 Ga0068855_100052990 3300005563 Bacteria 4774
76 Ga0068855_100105646 3300005563 Bacteria 3237
77 Ga0068855_100125016 3300005563 Bacteria 2941
78 Ga0070664_100072533 3300005564 Bacteria 2953
79 Ga0070664_100172592 3300005564 Bacteria 1918
80 Ga0070664_100227099 3300005564 Bacteria 1672
81 Ga0070664_100232867 3300005564 Bacteria 1651
82 Ga0068857_100010026 3300005577 Bacteria 8227
83 Ga0068857_100016044 3300005577 Bacteria 6562
84 Ga0068857_100031088 3300005577 Bacteria 4718
85 Ga0068854_100027116 3300005578 Bacteria 3946
86 Ga0068854_100121084 3300005578 Bacteria 1986
87 Ga0068856_100002916 3300005614 Bacteria 17515
88 Ga0068856_100221497 3300005614 Bacteria 1907
89 Ga0068852_100061555 3300005616 Bacteria 3262
90 Ga0068852_100082393 3300005616 Bacteria 2858
91 Ga0068852_100118752 3300005616 Bacteria 2417
92 Ga0068866_10020218 3300005718 Bacteria 3047
93 Ga0068861_100001974 3300005719 Bacteria 13233
94 Ga0068861_100121470 3300005719 Bacteria 2108
95 Ga0068851_10219863 3300005834 Bacteria 1067
96 Ga0068863_100200097 3300005841 Bacteria 1921
97 Ga0068858_100042928 3300005842 Bacteria 4193
98 Ga0068858_100067116 3300005842 Bacteria 3322
99 Ga0068858_100405678 3300005842 Bacteria 1310
100 Ga0068860_100008753 3300005843 Bacteria 10079
101 Ga0068860_100021643 3300005843 Bacteria 6225
102 Ga0068860_100475079 3300005843 Bacteria 1245
103 Ga0068862_100007344 3300005844 Bacteria 9154
104 Ga0068862_100009708 3300005844 Bacteria 7955
105 Ga0068862_100110247 3300005844 Bacteria 2415
106 Ga0075365_10087121 3300006038 Bacteria 2123
107 Ga0075363_100056933 3300006048 Bacteria 2097
108 Ga0075364_10031906 3300006051 Bacteria 3384
109 Ga0075362_10028078 3300006177 Bacteria 2414
110 Ga0075362_10040933 3300006177 Bacteria 2041
111 Ga0075367_10002423 3300006178 Bacteria 8519
112 Ga0075367_10015968 3300006178 Bacteria 4093
113 Ga0075367_10119355 3300006178 Bacteria 1624
114 Ga0075367_10193941 3300006178 Bacteria 1268
115 Ga0075367_10242445 3300006178 Bacteria 1130
116 Ga0075369_10002395 3300006186 Bacteria 6682
117 Ga0075369_10004683 3300006186 Bacteria 5074
118 Ga0075366_10003369 3300006195 Bacteria 8416
119 Ga0075366_10008235 3300006195 Bacteria 5786
120 Ga0075366_10009182 3300006195 Bacteria 5514
121 Ga0075366_10017467 3300006195 Bacteria 4128
122 Ga0075366_10063612 3300006195 Bacteria 2193
123 Ga0075366_10069207 3300006195 Bacteria 2101
124 Ga0075366_10150380 3300006195 Bacteria 1410
125 Ga0075366_10243336 3300006195 Bacteria 1097
126 Ga0097621_100059890 3300006237 Bacteria 3119
127 Ga0075370_10001022 3300006353 Bacteria 11620
128 Ga0075370_10053721 3300006353 Bacteria 2286
129 Ga0075370_10062768 3300006353 Bacteria 2117
130 Ga0075370_10127648 3300006353 Bacteria 1483
131 Ga0068871_100248951 3300006358 Bacteria 1547
132 Ga0075430_100013700 3300006846 Bacteria 6913
133 Ga0075429_100002011 3300006880 Bacteria 16902
134 Ga0068865_100000764 3300006881 Bacteria 18049
135 Ga0099823_1003210 3300006944 Bacteria 15335
136 Ga0079104_1000294 3300006946 Bacteria 63150
137 Ga0105240_10009086 3300009093 Bacteria 14109
138 Ga0105240_10293943 3300009093 Bacteria 1861
139 Ga0105240_10309258 3300009093 Bacteria 1805
140 Ga0105240_10326796 3300009093 Bacteria 1746
141 Ga0105240_10385291 3300009093 Bacteria 1582
142 Ga0105245_10207921 3300009098 Bacteria 1882
143 Ga0105243_10006332 3300009148 Bacteria 9143
144 Ga0105243_10038177 3300009148 Bacteria 3739
145 Ga0105243_10092437 3300009148 Bacteria 2494
146 Ga0105243_10145981 3300009148 Bacteria 2024
147 Ga0105241_10004946 3300009174 Bacteria 9829
148 Ga0105241_10131066 3300009174 Unclassified 2030
149 Ga0105237_10206071 3300009545 Bacteria 1967
150 Ga0105237_10291089 3300009545 Bacteria 1636
151 Ga0105249_10004244 3300009553 Bacteria 12397
152 Ga0105239_10063734 3300010375 Bacteria 4046
153 Ga0157319_1000003 3300012497 Bacteria 397199
154 Ga0157373_10169567 3300013100 Bacteria 1536
155 Ga0157370_10039074 3300013104 Bacteria 4587
156 Ga0157369_10042581 3300013105 Bacteria 4952
157 Ga0157369_10355325 3300013105 Unclassified 1522
158 Ga0157374_10073653 3300013296 Bacteria 3223
159 Ga0157374_10073775 3300013296 Bacteria 3221
160 Ga0157378_10044552 3300013297 Bacteria 3940
161 Ga0163162_10196908 3300013306 Bacteria 2144
162 Ga0157372_10029653 3300013307 Bacteria 5976
163 Ga0157372_10045465 3300013307 Bacteria 4871
164 Ga0157372_10822322 3300013307 Bacteria 1079
165 Ga0157375_10020187 3300013308 Bacteria 6080
166 Ga0157375_10402742 3300013308 Bacteria 1535
167 Ga0157380_10054801 3300014326 Bacteria 3166
168 Ga0157380_10300365 3300014326 Bacteria 1479
169 Ga0157380_10373623 3300014326 Bacteria 1343
170 Ga0157379_10159338 3300014968 Bacteria 2037
171 Ga0157379_10241863 3300014968 Bacteria 1637
172 Ga0182006_1000129 3300015261 Bacteria 81237
173 Ga0213872_10000007 3300021361 Bacteria 228206
174 Ga0213872_10000021 3300021361 Bacteria 158749
175 Ga0213872_10126472 3300021361 Bacteria 1128
176 Ga0209563_100014 3300025230 Bacteria 940582
177 Ga0209563_100022 3300025230 Bacteria 643318
178 Ga0207427_100611 3300025231 Bacteria 17760
179 Ga0209258_100941 3300025242 Bacteria 14133
180 Ga0209258_105576 3300025242 Bacteria 2106
181 Ga0209646_1000258 3300025246 Bacteria 51783
182 Ga0209026_1000011 3300025250 Bacteria 507291
183 Ga0209677_100633 3300025253 Bacteria 18825
184 Ga0209677_102651 3300025253 Bacteria 6491
185 Ga0209759_1000034 3300025256 Bacteria 271209
186 Ga0209759_1009391 3300025256 Bacteria 2959
187 Ga0209565_1000055 3300025263 Bacteria 201184
188 Ga0209673_1000040 3300025273 Bacteria 312633
189 Ga0209673_1013029 3300025273 Bacteria 3308
190 Ga0209673_1026656 3300025273 Bacteria 1893
191 Ga0209130_1000195 3300025284 Bacteria 83371
192 Ga0209675_1000052 3300025291 Bacteria 201332
193 Ga0209564_1000003 3300025295 Bacteria 1585848
194 Ga0209564_1000121 3300025295 Bacteria 204081
195 Ga0209758_1000045 3300025297 Bacteria 369174
196 Ga0209050_1000529 3300025298 Bacteria 63410
197 Ga0209050_1000916 3300025298 Bacteria 38869
198 Ga0209050_1002907 3300025298 Bacteria 13459
199 Ga0209050_1007394 3300025298 Bacteria 6172
200 Ga0209256_1000036 3300025299 Bacteria 386664
201 Ga0209256_1000100 3300025299 Bacteria 201246
202 Ga0209256_1000150 3300025299 Bacteria 146086
203 Ga0209256_1000344 3300025299 Bacteria 75635
204 Ga0209051_1000379 3300025303 Bacteria 63486
205 Ga0209051_1000386 3300025303 Bacteria 62211
206 Ga0209051_1002249 3300025303 Bacteria 14189
207 Ga0209257_1000141 3300025304 Bacteria 201130
208 Ga0209257_1000318 3300025304 Bacteria 101186
209 Ga0209257_1000399 3300025304 Bacteria 85231
210 Ga0207680_10210072 3300025903 Bacteria 1330
211 Ga0207705_10055974 3300025909 Bacteria 2843
212 Ga0207705_10076694 3300025909 Bacteria 2430
213 Ga0207684_10127538 3300025910 Bacteria 2184
214 Ga0207654_10003469 3300025911 Bacteria 7972
215 Ga0207654_10121201 3300025911 Bacteria 1642
216 Ga0207695_10019287 3300025913 Bacteria 7853
217 Ga0207695_10042210 3300025913 Bacteria 4875
218 Ga0207695_10165403 3300025913 Bacteria 2141
219 Ga0207671_10036606 3300025914 Bacteria 3640
220 Ga0207671_10076846 3300025914 Bacteria 2499
221 Ga0207657_10025339 3300025919 Bacteria 5470
222 Ga0207657_10095706 3300025919 Bacteria 2470
223 Ga0207657_10285550 3300025919 Bacteria 1309
224 Ga0207694_10051260 3300025924 Bacteria 3199
225 Ga0207659_10068065 3300025926 Bacteria 2589
226 Ga0207659_10139509 3300025926 Bacteria 1880
227 Ga0207687_10224417 3300025927 Bacteria 1481
228 Ga0207706_10002701 3300025933 Bacteria 17286
229 Ga0207706_10031551 3300025933 Bacteria 4720
230 Ga0207706_10132114 3300025933 Bacteria 2196
231 Ga0207670_10412196 3300025936 Bacteria 1082
232 Ga0207691_10066221 3300025940 Bacteria 3269
233 Ga0207691_10069752 3300025940 Bacteria 3175
234 Ga0207711_10078035 3300025941 Bacteria 2888
235 Ga0207679_10089646 3300025945 Bacteria 2375
236 Ga0207679_10179261 3300025945 Bacteria 1751
237 Ga0207667_10121278 3300025949 Bacteria 2694
238 Ga0207667_10260974 3300025949 Unclassified 1772
239 Ga0207651_10085215 3300025960 Bacteria 2292
240 Ga0207640_10006820 3300025981 Bacteria 6281
241 Ga0207658_10028962 3300025986 Bacteria 3905
242 Ga0207658_10142446 3300025986 Bacteria 1942
243 Ga0207658_10278192 3300025986 Bacteria 1434
244 Ga0207658_10376513 3300025986 Bacteria 1242
245 Ga0207677_10209810 3300026023 Bacteria 1554
246 Ga0207677_10447058 3300026023 Bacteria 1107
247 Ga0207639_10140918 3300026041 Bacteria 2008
248 Ga0207639_10247393 3300026041 Unclassified 1553
249 Ga0207678_10000500 3300026067 Bacteria 35694
250 Ga0207678_10022183 3300026067 Bacteria 5564
251 Ga0207678_10170660 3300026067 Bacteria 1857
252 Ga0207702_10002432 3300026078 Bacteria 17664
253 Ga0207648_10206489 3300026089 Bacteria 1743
254 Ga0207674_10016404 3300026116 Bacteria 8109
255 Ga0207674_10024335 3300026116 Bacteria 6473
256 Ga0207674_10313003 3300026116 Bacteria 1519
257 Ga0207698_10003370 3300026142 Bacteria 9625
258 Ga0207698_10044191 3300026142 Bacteria 3345
259 Ga0207698_10049266 3300026142 Bacteria 3205
260 Ga0207698_10186857 3300026142 Bacteria 1841
261 Ga0209281_1000423 3300027111 Bacteria 63126
262 Ga0209389_1007866 3300027296 Bacteria 9433
263 Ga0209974_10011964 3300027876 Bacteria 2907
264 Ga0268265_10028851 3300028380 Bacteria 3977
265 Ga0268264_10369181 3300028381 Bacteria 1371
266 Ga0307515_10000030 3300028794 Bacteria 364482
267 Ga0307515_10000494 3300028794 Bacteria 94354
268 Ga0307515_10006133 3300028794 Bacteria 24177
269 Ga0307515_10009239 3300028794 Bacteria 19087
270 Ga0307515_10081051 3300028794 Bacteria 4221
271 Ga0307512_10075120 3300030522 Bacteria 2475
272 Ga0265328_10034260 3300031239 Bacteria 1880
273 Ga0265328_10071574 3300031239 Bacteria 1274
274 Ga0265331_10001748 3300031250 Bacteria 15614
275 Ga0265327_10000143 3300031251 Bacteria 156870
276 Ga0265327_10000407 3300031251 Bacteria 79425
277 Ga0307513_10019112 3300031456 Bacteria 8166
278 Ga0307513_10031815 3300031456 Bacteria 5965
279 Ga0307513_10436228 3300031456 Bacteria 1037
280 Ga0307509_10001361 3300031507 Bacteria 41386
281 Ga0307509_10072227 3300031507 Bacteria 3596
282 Ga0307509_10152689 3300031507 Bacteria 2221
283 Ga0307408_100149218 3300031548 Unclassified 1844
284 Ga0307508_10000096 3300031616 Bacteria 103730
285 Ga0307514_10000330 3300031649 Bacteria 113231
286 Ga0307514_10038352 3300031649 Bacteria 3789
287 Ga0307514_10048470 3300031649 Bacteria 3309
288 Ga0307516_10000677 3300031730 Bacteria 46191
289 Ga0307516_10014241 3300031730 Bacteria 8424
290 Ga0307413_10346740 3300031824 Bacteria 1144
291 Ga0307416_100035688 3300032002 Bacteria 3801
292 Ga0307510_10001484 3300033180 Bacteria 25882
293 Ga0307510_10042584 3300033180 Bacteria 4946
294 Ga0373959_0008059 3300034820 Bacteria 1783
295 Ga0373934_0031007 3300035086 Bacteria 2092
296 Ga0373946_0029993 3300035171 Unclassified 2169
297 Ga0373931_0043075 3300035691 Bacteria 2375
298 Ga0373935_0163467 3300035692 Unclassified 1519
299 Ga0373937_0390033 3300036401 Bacteria 1321
300 Ga0373925_0001650 3300037068 Bacteria 18812
301 Ga0373925_0309674 3300037068 Bacteria 1276
302 Ga0395899_0022687 3300037312 Bacteria 4754
303 Ga0395899_0027162 3300037312 Bacteria 4317
304 Ga0395899_0066414 3300037312 Bacteria 2648
305 Ga0395900_0008081 3300037418 Bacteria 10830
306 Ga0395900_0019362 3300037418 Bacteria 6943
307 Ga0395900_0021938 3300037418 Bacteria 6528
308 Ga0395900_0025270 3300037418 Bacteria 6080
309 Ga0395900_0103129 3300037418 Bacteria 2930
310 Ga0395900_0434367 3300037418 Bacteria 1271
311 Ga0395898_0012097 3300037466 Bacteria 8937
312 Ga0395905_0042900 3300037471 Bacteria 4244
313 Ga0395905_0042976 3300037471 Bacteria 4240
314 Ga0395905_0070807 3300037471 Bacteria 3268
315 Ga0395905_0168013 3300037471 Bacteria 2061
316 Ga0395905_0184217 3300037471 Bacteria 1960
317 Ga0395901_0000103 3300038443 Bacteria 115060
318 Ga0395901_0006663 3300038443 Bacteria 11673
319 Ga0395901_0087498 3300038443 Bacteria 3257
320 Ga0395901_0291755 3300038443 Bacteria 1692
321 Ga0395901_0520509 3300038443 Bacteria 1208
322 Ga0436365_1857266 3300039437 Bacteria 3268
323 Ga0436361_0163583 3300039447 Bacteria 173204
324 Ga0436361_0354255 3300039447 Bacteria 247479
325 Ga0436361_0480843 3300039447 Bacteria 6796
326 Ga0436361_1070932 3300039447 Bacteria 4602
327 Ga0451793_1226599 3300041452 Bacteria 1657
328 Ga0451833_0106143 3300041491 Bacteria 2235
329 Ga0451839_0327417 3300041496 Bacteria 924
330 Ga0451841_0520278 3300041498 Bacteria 1774
331 Ga0451843_1242208 3300041509 Bacteria 2430
332 Ga0439431_0030756 3300041997 Bacteria 1331
333 Ga0439448_0057029 3300042005 Bacteria 1286
334 Ga0439449_0009892 3300042007 Bacteria 3606
335 Ga0439450_006282 3300042008 Bacteria 2133
336 Ga0439455_0041351 3300042012 Bacteria 1181
337 Ga0450919_005657 3300042121 Bacteria 1495
338 Ga0450904_002018 3300042139 Bacteria 2571
339 Ga0439434_0020570 3300042435 Bacteria 1982
340 Ga0450918_000299 3300042531 Bacteria 11138
341 Ga0451577_0001771 3300042876 Bacteria 27782
342 Ga0451577_0003232 3300042876 Bacteria 18320
343 Ga0451577_0061411 3300042876 Bacteria 3351
344 Ga0466969_0000017 3300044656 Bacteria 103792
345 Ga0466969_0002974 3300044656 Bacteria 9044
346 Ga0466969_0012645 3300044656 Bacteria 4447
347 Ga0466969_0053541 3300044656 Bacteria 1979
348 Ga0466972_0000472 3300044658 Bacteria 20400
349 Ga0466965_0001879 3300044683 Bacteria 8749
350 Ga0466965_0012379 3300044683 Bacteria 4011
351 Ga0466965_0032205 3300044683 Bacteria 2560
352 Ga0466965_0089440 3300044683 Bacteria 1565
353 Ga0466966_0000454 3300044684 Bacteria 26412
354 Ga0466966_0007015 3300044684 Bacteria 7461
355 Ga0466966_0013120 3300044684 Bacteria 5486
356 Ga0466966_0019891 3300044684 Bacteria 4415
357 Ga0466966_0098683 3300044684 Bacteria 1808
358 Ga0466966_0136715 3300044684 Bacteria 1498
359 Ga0466961_0000623 3300044693 Bacteria 22167
360 Ga0466961_0165391 3300044693 Bacteria 1377
361 Ga0466961_0221226 3300044693 Bacteria 1167
362 Ga0466963_0062824 3300044694 Bacteria 2484
363 Ga0466963_0073887 3300044694 Bacteria 2299
364 Ga0466964_0006890 3300044706 Bacteria 4243
365 Ga0466964_0008771 3300044706 Bacteria 3801
366 Ga0453684_0009992 3300044712 Bacteria 16357
367 Ga0466971_0033069 3300044719 Bacteria 2317
368 Ga0466970_0017681 3300044765 Bacteria 3685
369 Ga0466957_0000012 3300044842 Bacteria 72537
370 Ga0466957_0003624 3300044842 Bacteria 8511
371 Ga0466957_0019740 3300044842 Bacteria 3966
372 Ga0466957_0024754 3300044842 Bacteria 3554
373 Ga0466959_0000504 3300045049 Bacteria 22669
374 Ga0466959_0021594 3300045049 Bacteria 4750
375 Ga0466959_0026274 3300045049 Bacteria 4315
376 Ga0466959_0050434 3300045049 Bacteria 3055
377 Ga0466959_0055486 3300045049 Bacteria 2892
378 Ga0466959_0262490 3300045049 Bacteria 1188
379 Ga0466958_0017369 3300045836 Bacteria 4157
380 Ga0466958_0313039 3300045836 Bacteria 1008
381 Ga0466967_0011429 3300045976 Bacteria 6722
382 Ga0466967_0023782 3300045976 Bacteria 5026
383 Ga0495617_000001 3300046452 Bacteria 877032
384 Ga0495617_042516 3300046452 Bacteria 1519
385 Ga0495627_000035 3300046453 Bacteria 213698
386 Ga0495627_006791 3300046453 Bacteria 4453
387 Ga0495592_0000495 3300046454 Bacteria 28713
388 Ga0495592_0160334 3300046454 Bacteria 1548
389 Ga0495590_0000829 3300046457 Bacteria 14000
390 Ga0495590_0029076 3300046457 Bacteria 1938
391 Ga0495638_0027065 3300046460 Bacteria 3714
392 Ga0495638_0173660 3300046460 Bacteria 1235
393 Ga0495653_0075781 3300046463 Bacteria 2502
394 Ga0495580_0055947 3300046472 Bacteria 2778
395 Ga0495582_0009564 3300046473 Bacteria 5338
396 Ga0495605_0000039 3300046474 Bacteria 196802
397 Ga0495605_0000173 3300046474 Bacteria 81369
398 Ga0495605_0004874 3300046474 Bacteria 7843
399 Ga0495605_0021091 3300046474 Bacteria 3455
400 Ga0495605_0029882 3300046474 Bacteria 2798
401 Ga0495605_0072912 3300046474 Bacteria 1618
402 Ga0495584_0000476 3300046491 Bacteria 27527
403 Ga0495584_0000890 3300046491 Bacteria 19181
404 Ga0495584_0001772 3300046491 Bacteria 12564
405 Ga0495584_0036188 3300046491 Bacteria 2494
406 Ga0495584_0043820 3300046491 Bacteria 2258
407 Ga0495584_0065331 3300046491 Bacteria 1830
408 Ga0495585_0005156 3300046492 Bacteria 8296
409 Ga0495585_0137863 3300046492 Bacteria 1279
410 Ga0495594_0036988 3300046499 Bacteria 2663
411 Ga0495594_0038400 3300046499 Bacteria 2614
412 Ga0495596_0000269 3300046500 Bacteria 34417
413 Ga0495596_0001084 3300046500 Bacteria 16113
414 Ga0495596_0001261 3300046500 Bacteria 14662
415 Ga0495596_0004074 3300046500 Bacteria 7195
416 Ga0495596_0004356 3300046500 Bacteria 6919
417 Ga0495596_0004374 3300046500 Bacteria 6899
418 Ga0495596_0006717 3300046500 Bacteria 5265
419 Ga0495596_0023514 3300046500 Bacteria 2499
420 Ga0495607_0004567 3300046501 Bacteria 10152
421 Ga0495607_0010751 3300046501 Bacteria 6129
422 Ga0495607_0030964 3300046501 Bacteria 3278
423 Ga0495583_0000266 3300046506 Bacteria 85810
424 Ga0495583_0000318 3300046506 Bacteria 76178
425 Ga0495583_0000341 3300046506 Bacteria 73548
426 Ga0495583_0000372 3300046506 Bacteria 69750
427 Ga0495583_0004482 3300046506 Bacteria 9978
428 Ga0495583_0012841 3300046506 Bacteria 4712
429 Ga0495583_0013030 3300046506 Bacteria 4665
430 Ga0495583_0013304 3300046506 Bacteria 4597
431 Ga0495583_0015225 3300046506 Bacteria 4193
432 Ga0495583_0106535 3300046506 Bacteria 1191
433 Ga0495606_0009759 3300046507 Bacteria 8072
434 Ga0495606_0036330 3300046507 Bacteria 3356
435 Ga0495606_0044259 3300046507 Bacteria 2962
436 Ga0495606_0059265 3300046507 Bacteria 2456
437 Ga0495606_0125610 3300046507 Bacteria 1530
438 Ga0495610_0064218 3300046512 Bacteria 1736
439 Ga0495616_0000037 3300046513 Bacteria 123624
440 Ga0495616_0000335 3300046513 Bacteria 37189
441 Ga0495616_0001334 3300046513 Bacteria 17245
442 Ga0495616_0013555 3300046513 Bacteria 4593
443 Ga0495616_0014825 3300046513 Bacteria 4350
444 Ga0495616_0106189 3300046513 Bacteria 1310
445 Ga0495630_0026460 3300046517 Bacteria 4295
446 Ga0495630_0032744 3300046517 Bacteria 3875
447 Ga0495631_0001676 3300046518 Bacteria 13178
448 Ga0495631_0005281 3300046518 Bacteria 6786
449 Ga0495631_0006938 3300046518 Bacteria 5803
450 Ga0495631_0018214 3300046518 Bacteria 3309
451 Ga0495631_0045508 3300046518 Bacteria 1932
452 Ga0495632_0000119 3300046519 Bacteria 81170
453 Ga0495632_0000126 3300046519 Bacteria 77591
454 Ga0495632_0000375 3300046519 Bacteria 42575
455 Ga0495632_0006812 3300046519 Bacteria 7292
456 Ga0495632_0008489 3300046519 Bacteria 6296
457 Ga0495632_0041990 3300046519 Bacteria 2294
458 Ga0495643_0000247 3300046522 Bacteria 79969
459 Ga0495643_0000567 3300046522 Bacteria 45722
460 Ga0495643_0002950 3300046522 Bacteria 12886
461 Ga0495643_0007380 3300046522 Bacteria 7102
462 Ga0495643_0032176 3300046522 Bacteria 2913
463 Ga0495643_0085656 3300046522 Bacteria 1633
464 Ga0495644_0072205 3300046523 Bacteria 1297
465 Ga0495648_0000138 3300046524 Bacteria 86438
466 Ga0495648_0017008 3300046524 Bacteria 5219
467 Ga0495648_0023039 3300046524 Bacteria 4272
468 Ga0495648_0040159 3300046524 Bacteria 2970
469 Ga0495663_0006800 3300046525 Bacteria 3154
470 Ga0495663_0072673 3300046525 Unclassified 1097
471 Ga0495666_0007333 3300046526 Bacteria 5528
472 Ga0495666_0099395 3300046526 Bacteria 1371
473 Ga0495642_0000009 3300046528 Bacteria 152645
474 Ga0495642_0000069 3300046528 Bacteria 61616
475 Ga0495642_0000779 3300046528 Bacteria 15514
476 Ga0495642_0005384 3300046528 Bacteria 4910
477 Ga0495642_0006396 3300046528 Bacteria 4517
478 Ga0495642_0012064 3300046528 Bacteria 3330
479 Ga0495654_0000668 3300046530 Bacteria 27040
480 Ga0495654_0012640 3300046530 Bacteria 4533
481 Ga0495586_0017741 3300046535 Bacteria 3787
482 Ga0495586_0154398 3300046535 Bacteria 1292
483 Ga0495609_0000486 3300046538 Bacteria 31853
484 Ga0495609_0007848 3300046538 Bacteria 5280
485 Ga0495609_0017809 3300046538 Bacteria 3296
486 Ga0495609_0018939 3300046538 Bacteria 3188
487 Ga0495621_0051631 3300046539 Bacteria 1472
488 Ga0495597_0009698 3300046542 Bacteria 4744
489 Ga0495597_0050552 3300046542 Bacteria 1834
490 Ga0495622_0064984 3300046557 Bacteria 1687
491 Ga0495633_0001734 3300046558 Bacteria 16299
492 Ga0495633_0048808 3300046558 Bacteria 1998
493 Ga0495656_0006795 3300046615 Bacteria 4022
494 Ga0495656_0024835 3300046615 Bacteria 2371
495 Ga0495656_0083674 3300046615 Bacteria 1445
496 Ga0495668_0000035 3300046616 Bacteria 240241
497 Ga0495668_0000800 3300046616 Bacteria 36258
498 Ga0495668_0001462 3300046616 Bacteria 22723
499 Ga0495668_0020512 3300046616 Bacteria 3802
500 Ga0495668_0027111 3300046616 Bacteria 3246
501 Ga0495668_0031486 3300046616 Bacteria 2989
502 Ga0495668_0044464 3300046616 Bacteria 2468
503 Ga0495668_0053322 3300046616 Bacteria 2236
504 Ga0495668_0132518 3300046616 Bacteria 1364
505 Ga0495668_0145448 3300046616 Bacteria 1297
506 Ga0495634_0021142 3300046642 Bacteria 4604
507 Ga0495611_0001110 3300046648 Bacteria 14172
508 Ga0495611_0009857 3300046648 Bacteria 4041
509 Ga0495611_0013522 3300046648 Bacteria 3476
510 Ga0495611_0045048 3300046648 Bacteria 1975
511 Ga0495625_0001970 3300046660 Bacteria 23171
512 Ga0495625_0002034 3300046660 Bacteria 22774
513 Ga0495625_0002718 3300046660 Bacteria 18765
514 Ga0495625_0003794 3300046660 Bacteria 14641
515 Ga0495625_0058662 3300046660 Bacteria 2734
516 Ga0495625_0162895 3300046660 Bacteria 1493
517 Ga0495625_0194632 3300046660 Bacteria 1341
518 Ga0495659_0000007 3300046664 Bacteria 105393
519 Ga0495659_0001196 3300046664 Bacteria 9010
520 Ga0495659_0041396 3300046664 Bacteria 1645
521 Ga0495661_0000461 3300046665 Bacteria 43183
522 Ga0495661_0000560 3300046665 Bacteria 38438
523 Ga0495661_0002737 3300046665 Bacteria 13416
524 Ga0495661_0009241 3300046665 Bacteria 6774
525 Ga0495661_0030930 3300046665 Bacteria 3403
526 Ga0495661_0083165 3300046665 Bacteria 1841
527 Ga0495661_0087985 3300046665 Bacteria 1774
528 Ga0495661_0143138 3300046665 Bacteria 1298
529 Ga0495661_0245979 3300046665 Bacteria 915
530 Ga0495588_0000059 3300046674 Bacteria 263358
531 Ga0495588_0040764 3300046674 Bacteria 2369
532 Ga0495657_0239327 3300046675 Bacteria 1096
533 Ga0495623_0021707 3300046679 Bacteria 4146
534 Ga0495623_0061342 3300046679 Bacteria 2359
535 Ga0495658_0256722 3300046683 Unclassified 1100
536 Ga0495669_0000094 3300046684 Bacteria 57198
537 Ga0495669_0001761 3300046684 Bacteria 8838
538 Ga0495670_0020963 3300046691 Bacteria 3222
539 Ga0495670_0024900 3300046691 Bacteria 2958
540 Ga0495670_0039787 3300046691 Bacteria 2345
541 Ga0495671_0000047 3300046692 Bacteria 156459
542 Ga0495671_0000089 3300046692 Bacteria 85775
543 Ga0495671_0000715 3300046692 Bacteria 23970
544 Ga0495671_0001120 3300046692 Bacteria 18493
545 Ga0495649_0003092 3300046694 Bacteria 11388
546 Ga0495649_0004491 3300046694 Bacteria 9105
547 Ga0495649_0015623 3300046694 Bacteria 4316
548 Ga0495649_0042146 3300046694 Bacteria 2494
549 Ga0495649_0080528 3300046694 Unclassified 1741
550 Ga0495649_0230341 3300046694 Bacteria 956
551 Ga0495589_0000939 3300046794 Bacteria 17872
552 Ga0495589_0001197 3300046794 Bacteria 15477
553 Ga0495589_0001894 3300046794 Bacteria 11859
554 Ga0495589_0066332 3300046794 Bacteria 1767
555 Ga0495660_0000569 3300046810 Bacteria 29833
556 Ga0495660_0000880 3300046810 Bacteria 22197
557 Ga0495660_0003343 3300046810 Bacteria 9948
558 Ga0495660_0007209 3300046810 Bacteria 6544
559 Ga0495660_0007769 3300046810 Bacteria 6301
560 Ga0495660_0022112 3300046810 Bacteria 3634
561 Ga0495660_0026793 3300046810 Bacteria 3264
562 Ga0495660_0043054 3300046810 Bacteria 2492
563 Ga0495660_0060595 3300046810 Bacteria 2032
564 Ga0495604_0014524 3300047317 Bacteria 6281
565 Ga0495636_0034577 3300047318 Bacteria 2080
566 Ga0495672_0002162 3300047320 Bacteria 18339
567 Ga0495672_0003171 3300047320 Bacteria 14299
568 Ga0495672_0024035 3300047320 Bacteria 3933
569 Ga0495672_0186580 3300047320 Bacteria 1046
570 Ga0495676_0015875 3300047321 Bacteria 6693
571 Ga0495680_0114377 3300047322 Bacteria 1997
572 Ga0495683_0015232 3300047323 Bacteria 4003
573 Ga0495683_0029094 3300047323 Bacteria 2824
574 Ga0495683_0081990 3300047323 Bacteria 1572
575 Ga0495687_000292 3300047443 Bacteria 65859
576 Ga0495687_000646 3300047443 Bacteria 40020
577 Ga0495687_000728 3300047443 Bacteria 36269
578 Ga0495687_000943 3300047443 Bacteria 30021
579 Ga0495687_033256 3300047443 Bacteria 2341
580 Ga0495687_064950 3300047443 Bacteria 1488
581 Ga0495675_0005147 3300047444 Bacteria 7957
582 Ga0495677_0000104 3300047445 Bacteria 41829
583 Ga0495677_0001887 3300047445 Bacteria 8373
584 Ga0495677_0003127 3300047445 Bacteria 6453
585 Ga0495677_0005961 3300047445 Bacteria 4614
586 Ga0495677_0009707 3300047445 Bacteria 3548
587 Ga0495677_0079415 3300047445 Bacteria 1228
588 Ga0495679_005923 3300047446 Bacteria 5354
589 Ga0495679_009721 3300047446 Bacteria 3827
590 Ga0495679_010347 3300047446 Bacteria 3666
591 Ga0495679_017478 3300047446 Bacteria 2565
592 Ga0495681_0000054 3300047470 Bacteria 106578
593 Ga0495681_0000067 3300047470 Bacteria 97630
594 Ga0495681_0001257 3300047470 Bacteria 19244
595 Ga0495681_0001717 3300047470 Bacteria 16200
596 Ga0495681_0002358 3300047470 Bacteria 13557
597 Ga0495681_0026651 3300047470 Bacteria 3003
598 Ga0495686_0000015 3300047472 Bacteria 471703
599 Ga0495686_0000879 3300047472 Bacteria 38312
600 Ga0495686_0007826 3300047472 Bacteria 7948
601 Ga0495593_0086660 3300047673 Bacteria 1615
602 Ga0495615_0002241 3300048090 Bacteria 3068
603 Ga0495626_0000004 3300048091 Bacteria 356599
604 Ga0495626_0000058 3300048091 Bacteria 147007
605 Ga0495626_0003238 3300048091 Bacteria 10535
606 Ga0495626_0006154 3300048091 Bacteria 6870
607 Ga0495626_0006233 3300048091 Bacteria 6812
608 Ga0495626_0006695 3300048091 Bacteria 6528
609 Ga0495626_0011650 3300048091 Bacteria 4641
610 Ga0495626_0018023 3300048091 Bacteria 3556
611 Ga0495626_0022343 3300048091 Bacteria 3126
612 Ga0495626_0024076 3300048091 Bacteria 2988
613 Ga0495626_0034381 3300048091 Bacteria 2424
614 Ga0495626_0036620 3300048091 Bacteria 2336
615 Ga0495626_0042005 3300048091 Bacteria 2149
616 Ga0496102_0000077 3300048905 Bacteria 142501
617 Ga0496102_0018607 3300048905 Bacteria 6108
618 Ga0496102_0267969 3300048905 Bacteria 1610
619 Ga0496103_0026290 3300048906 Bacteria 3523
620 Ga0496109_0007671 3300048912 Bacteria 9149
621 Ga0496109_0275088 3300048912 Bacteria 1587
622 Ga0496113_0005467 3300048916 Bacteria 7928
623 Ga0496114_0028986 3300048917 Bacteria 4547
624 Ga0496121_0087245 3300048924 Bacteria 2450
625 Ga0496122_0000299 3300048925 Bacteria 109780
626 Ga0496122_0000898 3300048925 Bacteria 55008
627 Ga0496122_0053333 3300048925 Bacteria 3049
628 Ga0496123_0000959 3300048926 Bacteria 44656
629 Ga0496123_0003657 3300048926 Bacteria 16986
630 Ga0496123_0009868 3300048926 Bacteria 8523
631 Ga0496124_0017158 3300048927 Bacteria 6841
632 Ga0496124_0017208 3300048927 Bacteria 6824
633 Ga0496124_0050112 3300048927 Bacteria 3559
634 Ga0496124_0057375 3300048927 Bacteria 3281
635 Ga0496124_0199895 3300048927 Bacteria 1521
636 Ga0496125_0000520 3300048928 Bacteria 66776
637 Ga0496126_0361791 3300048929 Bacteria 1185
638 Ga0495678_000122 3300049459 Bacteria 91100
639 Ga0495678_000140 3300049459 Bacteria 86985
640 Ga0495678_004136 3300049459 Bacteria 8578
641 Ga0495678_013402 3300049459 Bacteria 3852
642 Ga0495682_0000645 3300049460 Bacteria 23294
643 Ga0495682_0005882 3300049460 Bacteria 5035
644 Ga0495682_0006654 3300049460 Bacteria 4670
645 Ga0501047_0220534 3300049581 Bacteria 1753
646 Ga0501069_0016771 3300049585 Bacteria 3935
647 Ga0501070_0006049 3300049586 Bacteria 10307
648 Ga0501073_0004816 3300049589 Bacteria 10128
649 Ga0501074_0009715 3300049590 Bacteria 6987
650 Ga0501222_005869 3300049662 Bacteria 1652
651 Ga0501079_0037924 3300049741 Bacteria 3716
652 Ga0501080_0029064 3300049742 Bacteria 5145
653 Ga0501083_0006267 3300049744 Bacteria 8441
654 Ga0501035_0015080 3300049822 Bacteria 7130
655 Ga0501035_0020112 3300049822 Bacteria 6132
656 Ga0501035_0179098 3300049822 Bacteria 1827
657 Ga0501044_0058899 3300049823 Bacteria 3937
658 Ga0501044_0063301 3300049823 Bacteria 3780
659 nmdc:mga03683_6812_c1 3300050489 Bacteria 3933
660 nmdc:mga00v17_59262_c1 3300050491 Bacteria 2348
661 nmdc:mga00v17_99051_c1 3300050491 Bacteria 1838
662 nmdc:mga0yw44_17751_c1 3300050492 Bacteria 3880
663 nmdc:mga0k408_10619_c1 3300050493 Bacteria 4986
664 nmdc:mga0k408_23089_c1 3300050493 Bacteria 3506
665 nmdc:mga0k408_26854_c1 3300050493 Bacteria 3266
666 nmdc:mga0k408_40455_c1 3300050493 Unclassified 2682
667 nmdc:mga0k408_49669_c1 3300050493 Bacteria 2428
668 nmdc:mga0k408_639_c1 3300050493 Bacteria 19312
669 nmdc:mga0k408_7743_c1 3300050493 Bacteria 5743
670 nmdc:mga0k408_96282_c1 3300050493 Bacteria 1742
671 nmdc:mga06z11_12042_c1 3300050494 Bacteria 3750
672 nmdc:mga07m45_94776_c1 3300050496 Bacteria 1712
673 nmdc:mga05p37_224370_c1 3300050507 Bacteria 2266
674 nmdc:mga09592_27696_c1 3300050508 Bacteria 4705
675 nmdc:mga0qj67_12358_c1 3300050509 Bacteria 6431
676 nmdc:mga0sz30_15062_c1 3300050516 Bacteria 3052
677 nmdc:mga0sz30_38075_c1 3300050516 Bacteria 2015
678 Ga0500593_000267 3300053117 Bacteria 21261
679 Ga0500658_0007750 3300053134 Bacteria 3966
680 Ga0500590_007156 3300053148 Bacteria 5490
681 Ga0500622_0020625 3300053156 Bacteria 3500
682 Ga0501084_0010239 3300054114 Bacteria 7758
683 Ga0466962_0133975 3300061719 Bacteria 1198

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10033226 rootH1_100332263 246
2 3300047470 Ga0495681_0000054 Ga0495681_0000054_81451_82365 248
3 3300005295 Ga0065707_10088331 Ga0065707_100883313 253
4 3300005347 Ga0070668_100117523 Ga0070668_1001175232 253
5 3300005367 Ga0070667_100128572 Ga0070667_1001285723 253
6 3300005441 Ga0070700_100122044 Ga0070700_1001220443 253
7 3300005456 Ga0070678_100237995 Ga0070678_1002379952 253
8 3300005459 Ga0068867_100068947 Ga0068867_1000689473 253
9 3300005616 Ga0068852_100118752 Ga0068852_1001187522 253
10 3300005718 Ga0068866_10020218 Ga0068866_100202184 253
11 3300005719 Ga0068861_100001974 Ga0068861_1000019746 253
12 3300005842 Ga0068858_100042928 Ga0068858_1000429284 253
13 3300005843 Ga0068860_100008753 Ga0068860_1000087538 253
14 3300005844 Ga0068862_100007344 Ga0068862_1000073448 253
15 3300006195 Ga0075366_10009182 Ga0075366_100091827 253
16 3300006881 Ga0068865_100000764 Ga0068865_10000076410 253
17 3300009148 Ga0105243_10038177 Ga0105243_100381773 253
18 3300009553 Ga0105249_10004244 Ga0105249_100042448 253
19 3300013297 Ga0157378_10044552 Ga0157378_100445523 253
20 3300013308 Ga0157375_10020187 Ga0157375_100201872 253
21 3300014326 Ga0157380_10054801 Ga0157380_100548012 253
22 3300031456 Ga0307513_10436228 Ga0307513_104362281 253
23 iso_pu_bacteria 2585428062 2587756672 254
24 3300005290 Ga0065712_10001949 Ga0065712_100019497 255
25 3300005354 Ga0070675_100083588 Ga0070675_1000835884 255
26 3300005563 Ga0068855_100052990 Ga0068855_1000529905 255
27 3300013104 Ga0157370_10039074 Ga0157370_100390743 255
28 3300025913 Ga0207695_10019287 Ga0207695_100192876 255
29 3300025926 Ga0207659_10068065 Ga0207659_100680652 255
30 3300026023 Ga0207677_10209810 Ga0207677_102098102 255
31 3300026142 Ga0207698_10003370 Ga0207698_1000337010 255
32 3300046539 Ga0495621_0051631 Ga0495621_0051631_274_1122 255
33 3300046463 Ga0495653_0075781 Ga0495653_0075781_11_865 257
34 3300006178 Ga0075367_10242445 Ga0075367_102424451 258
35 3300028794 Ga0307515_10000494 Ga0307515_1000049425 258
36 3300028794 Ga0307515_10006133 Ga0307515_1000613316 258
37 3300028794 Ga0307515_10009239 Ga0307515_1000923916 258
38 3300030522 Ga0307512_10075120 Ga0307512_100751203 258
39 3300031456 Ga0307513_10019112 Ga0307513_100191125 258
40 3300031456 Ga0307513_10031815 Ga0307513_100318158 258
41 3300031507 Ga0307509_10072227 Ga0307509_100722274 258
42 3300031616 Ga0307508_10000096 Ga0307508_1000009634 258
43 3300031730 Ga0307516_10014241 Ga0307516_100142416 258
44 3300041496 Ga0451839_0327417 Ga0451839_0327417_60_893 258
45 3300046694 Ga0495649_0230341 Ga0495649_0230341_35_850 259
46 3300005456 Ga0070678_100014409 Ga0070678_1000144094 260
47 3300048091 Ga0495626_0000004 Ga0495626_0000004_64074_65027 260
48 3300025910 Ga0207684_10127538 Ga0207684_101275382 261
49 3300003322 rootL2_10077657 rootL2_100776574 262
50 3300031507 Ga0307509_10152689 Ga0307509_101526892 262
51 3300032002 Ga0307416_100035688 Ga0307416_1000356882 262
52 3300046683 Ga0495658_0256722 Ga0495658_0256722_33_863 262
53 3300046500 Ga0495596_0001084 Ga0495596_0001084_15221_16066 263
54 3300046665 Ga0495661_0245979 Ga0495661_0245979_13_846 263
55 3300047445 Ga0495677_0079415 Ga0495677_0079415_41_892 263
56 3300005539 Ga0068853_100056344 Ga0068853_1000563443 264
57 3300031824 Ga0307413_10346740 Ga0307413_103467402 264
58 3300047322 Ga0495680_0114377 Ga0495680_0114377_1008_1916 264
59 3300005457 Ga0070662_100130984 Ga0070662_1001309842 266
60 3300025933 Ga0207706_10002701 Ga0207706_1000270118 266
61 3300026142 Ga0207698_10049266 Ga0207698_100492661 266
62 3300048906 Ga0496103_0026290 Ga0496103_0026290_749_1669 268
63 3300044658 Ga0466972_0000472 Ga0466972_0000472_3631_4539 269
64 3300044842 Ga0466957_0019740 Ga0466957_0019740_2112_3071 269
65 3300048905 Ga0496102_0018607 Ga0496102_0018607_3141_4061 269
66 3300048912 Ga0496109_0275088 Ga0496109_0275088_613_1539 269
67 3300006178 Ga0075367_10119355 Ga0075367_101193552 270
68 3300046616 Ga0495668_0053322 Ga0495668_0053322_676_1569 270
69 3300050493 nmdc:mga0k408_23089_c1 nmdc:mga0k408_23089_c1_301_1161 270
70 3300025273 Ga0209673_1013029 Ga0209673_10130292 271
71 3300025295 Ga0209564_1000003 Ga0209564_100000372 271
72 iso_pu_bacteria 2643221645 2644249180 271
73 iso_pu_bacteria 2643221664 2644355892 271
74 3300003759 Ga0055525_1000053 Ga0055525_100005317 272
75 3300003771 Ga0055526_1001590 Ga0055526_100159010 272
76 3300006195 Ga0075366_10008235 Ga0075366_100082352 272
77 3300025230 Ga0209563_100014 Ga0209563_100014681 272
78 3300050493 nmdc:mga0k408_40455_c1 nmdc:mga0k408_40455_c1_899_1804 272
79 3300050493 nmdc:mga0k408_639_c1 nmdc:mga0k408_639_c1_16703_17611 272
80 3300003775 Ga0055524_1000310 Ga0055524_100031044 273
81 3300003794 Ga0055531_10002922 Ga0055531_100029225 273
82 3300012497 Ga0157319_1000003 Ga0157319_100000390 273
83 3300014326 Ga0157380_10300365 Ga0157380_103003652 273
84 3300025299 Ga0209256_1000150 Ga0209256_100015045 273
85 3300025304 Ga0209257_1000318 Ga0209257_100031850 273
86 3300046660 Ga0495625_0002718 Ga0495625_0002718_16104_17069 273
87 3300005335 Ga0070666_10216573 Ga0070666_102165731 274
88 3300005343 Ga0070687_100172304 Ga0070687_1001723041 274
89 3300005367 Ga0070667_100239763 Ga0070667_1002397632 274
90 3300005459 Ga0068867_100061328 Ga0068867_1000613283 274
91 3300005543 Ga0070672_100052997 Ga0070672_1000529972 274
92 3300005616 Ga0068852_100061555 Ga0068852_1000615552 274
93 3300005842 Ga0068858_100067116 Ga0068858_1000671164 274
94 3300005843 Ga0068860_100021643 Ga0068860_1000216437 274
95 3300013306 Ga0163162_10196908 Ga0163162_101969082 274
96 3300013308 Ga0157375_10402742 Ga0157375_104027422 274
97 3300025256 Ga0209759_1009391 Ga0209759_10093913 274
98 3300025903 Ga0207680_10210072 Ga0207680_102100722 274
99 3300025940 Ga0207691_10066221 Ga0207691_100662212 274
100 3300025941 Ga0207711_10078035 Ga0207711_100780351 274
101 3300025986 Ga0207658_10376513 Ga0207658_103765131 274
102 3300026041 Ga0207639_10140918 Ga0207639_101409182 274
103 3300026142 Ga0207698_10044191 Ga0207698_100441914 274
104 3300046454 Ga0495592_0160334 Ga0495592_0160334_214_1086 274
105 3300046491 Ga0495584_0065331 Ga0495584_0065331_927_1820 274
106 3300046506 Ga0495583_0013030 Ga0495583_0013030_2289_3230 274
107 3300046507 Ga0495606_0044259 Ga0495606_0044259_622_1503 274
108 3300048905 Ga0496102_0000077 Ga0496102_0000077_133186_134094 274
109 3300053148 Ga0500590_007156 Ga0500590_007156_1032_1904 274
110 3300003322 rootL2_10062783 rootL2_100627833 275
111 3300005455 Ga0070663_100000131 Ga0070663_1000001312 275
112 3300005471 Ga0070698_100157406 Ga0070698_1001574063 275
113 3300005545 Ga0070695_100383640 Ga0070695_1003836401 275
114 3300006195 Ga0075366_10069207 Ga0075366_100692073 275
115 3300021361 Ga0213872_10000021 Ga0213872_1000002122 275
116 3300026067 Ga0207678_10000500 Ga0207678_100005001 275
117 3300039447 Ga0436361_0354255 Ga0436361_0354255_223761_224624 275
118 3300042012 Ga0439455_0041351 Ga0439455_0041351_291_1160 275
119 3300042121 Ga0450919_005657 Ga0450919_005657_518_1414 275
120 3300042435 Ga0439434_0020570 Ga0439434_0020570_906_1802 275
121 3300042531 Ga0450918_000299 Ga0450918_000299_2725_3621 275
122 3300042876 Ga0451577_0001771 Ga0451577_0001771_14835_15743 275
123 3300044656 Ga0466969_0012645 Ga0466969_0012645_3160_4101 275
124 3300044683 Ga0466965_0001879 Ga0466965_0001879_1139_2080 275
125 3300044719 Ga0466971_0033069 Ga0466971_0033069_917_1858 275
126 3300044765 Ga0466970_0017681 Ga0466970_0017681_2649_3590 275
127 3300044842 Ga0466957_0024754 Ga0466957_0024754_1804_2745 275
128 3300045049 Ga0466959_0026274 Ga0466959_0026274_1223_2164 275
129 3300045836 Ga0466958_0313039 Ga0466958_0313039_56_997 275
130 3300046506 Ga0495583_0000318 Ga0495583_0000318_53092_53985 275
131 3300046524 Ga0495648_0023039 Ga0495648_0023039_898_1806 275
132 iso_pu_bacteria 2643221644 2644248353 275
133 3300006038 Ga0075365_10087121 Ga0075365_100871212 276
134 3300006177 Ga0075362_10028078 Ga0075362_100280783 276
135 3300006178 Ga0075367_10002423 Ga0075367_100024236 276
136 3300006186 Ga0075369_10004683 Ga0075369_100046834 276
137 3300006353 Ga0075370_10053721 Ga0075370_100537213 276
138 3300006946 Ga0079104_1000294 Ga0079104_100029425 276
139 3300027111 Ga0209281_1000423 Ga0209281_100042329 276
140 3300039447 Ga0436361_1070932 Ga0436361_1070932_3225_4151 276
141 3300046522 Ga0495643_0085656 Ga0495643_0085656_105_1022 276
142 3300046525 Ga0495663_0006800 Ga0495663_0006800_559_1461 276
143 3300046615 Ga0495656_0083674 Ga0495656_0083674_447_1349 276
144 3300046664 Ga0495659_0041396 Ga0495659_0041396_578_1495 276
145 3300046674 Ga0495588_0040764 Ga0495588_0040764_1340_2257 276
146 3300046675 Ga0495657_0239327 Ga0495657_0239327_29_910 276
147 3300048090 Ga0495615_0002241 Ga0495615_0002241_288_1190 276
148 3300050489 nmdc:mga03683_6812_c1 nmdc:mga03683_6812_c1_1861_2751 276
149 3300050491 nmdc:mga00v17_99051_c1 nmdc:mga00v17_99051_c1_909_1799 276
150 3300050492 nmdc:mga0yw44_17751_c1 nmdc:mga0yw44_17751_c1_458_1348 276
151 3300050493 nmdc:mga0k408_26854_c1 nmdc:mga0k408_26854_c1_1152_2042 276
152 3300050494 nmdc:mga06z11_12042_c1 nmdc:mga06z11_12042_c1_1309_2199 276
153 3300050516 nmdc:mga0sz30_38075_c1 nmdc:mga0sz30_38075_c1_349_1239 276
154 iso_pu_bacteria 2738541277 2738722962 276
155 iso_pu_bacteria 2738543019 2739283533 276
156 3300005844 Ga0068862_100110247 Ga0068862_1001102472 277
157 3300025298 Ga0209050_1007394 Ga0209050_10073942 277
158 3300026089 Ga0207648_10206489 Ga0207648_102064892 277
159 3300046453 Ga0495627_006791 Ga0495627_006791_60_989 277
160 iso_pu_bacteria 2738541280 2738740608 277
161 iso_pu_bacteria 2738541300 2738844930 277
162 iso_pu_bacteria 2738543018 2739277345 277
163 iso_pu_bacteria 2738543030 2739346388 277
164 3300003323 rootH1_10099691 rootH1_100996912 278
165 3300031239 Ga0265328_10071574 Ga0265328_100715742 278
166 3300031250 Ga0265331_10001748 Ga0265331_1000174814 278
167 3300031251 Ga0265327_10000407 Ga0265327_1000040739 278
168 3300037471 Ga0395905_0042900 Ga0395905_0042900_3257_4162 278
169 3300046691 Ga0495670_0039787 Ga0495670_0039787_1044_2009 278
170 3300053156 Ga0500622_0020625 Ga0500622_0020625_294_1259 278
171 3300003323 rootH1_10015942 rootH1_100159428 279
172 3300003794 Ga0055531_10003132 Ga0055531_100031325 279
173 3300006353 Ga0075370_10127648 Ga0075370_101276483 279
174 3300006944 Ga0099823_1003210 Ga0099823_100321010 279
175 3300021361 Ga0213872_10126472 Ga0213872_101264722 279
176 3300025242 Ga0209258_105576 Ga0209258_1055762 279
177 3300025298 Ga0209050_1002907 Ga0209050_10029079 279
178 3300025299 Ga0209256_1000344 Ga0209256_100034444 279
179 3300025303 Ga0209051_1000386 Ga0209051_100038637 279
180 3300025304 Ga0209257_1000399 Ga0209257_100039929 279
181 3300027296 Ga0209389_1007866 Ga0209389_10078666 279
182 3300048927 Ga0496124_0017208 Ga0496124_0017208_444_1352 279
183 3300050493 nmdc:mga0k408_7743_c1 nmdc:mga0k408_7743_c1_4385_5317 279
184 3300005467 Ga0070706_100076703 Ga0070706_1000767033 280
185 3300005719 Ga0068861_100121470 Ga0068861_1001214701 280
186 3300005844 Ga0068862_100009708 Ga0068862_1000097083 280
187 3300028380 Ga0268265_10028851 Ga0268265_100288513 280
188 3300028794 Ga0307515_10000030 Ga0307515_10000030105 280
189 3300044683 Ga0466965_0089440 Ga0466965_0089440_321_1220 280
190 3300046507 Ga0495606_0036330 Ga0495606_0036330_1841_2761 280
191 3300046507 Ga0495606_0125610 Ga0495606_0125610_14_925 280
192 3300046530 Ga0495654_0012640 Ga0495654_0012640_1775_2686 280
193 3300046542 Ga0495597_0050552 Ga0495597_0050552_379_1290 280
194 3300046660 Ga0495625_0003794 Ga0495625_0003794_2479_3390 280
195 3300046664 Ga0495659_0000007 Ga0495659_0000007_63302_64213 280
196 3300046692 Ga0495671_0000089 Ga0495671_0000089_56461_57372 280
197 3300046810 Ga0495660_0000569 Ga0495660_0000569_9027_9947 280
198 3300046810 Ga0495660_0060595 Ga0495660_0060595_545_1456 280
199 3300047320 Ga0495672_0002162 Ga0495672_0002162_17137_18048 280
200 3300047472 Ga0495686_0007826 Ga0495686_0007826_1507_2427 280
201 3300047673 Ga0495593_0086660 Ga0495593_0086660_548_1474 280
202 iso_pu_bacteria 2831864461 2831866822 280
203 3300005262 Ga0065165_1000220 Ga0065165_100022010 281
204 3300006195 Ga0075366_10017467 Ga0075366_100174672 281
205 3300009148 Ga0105243_10092437 Ga0105243_100924372 281
206 3300014326 Ga0157380_10373623 Ga0157380_103736231 281
207 3300031649 Ga0307514_10000330 Ga0307514_1000033091 281
208 3300031649 Ga0307514_10038352 Ga0307514_100383525 281
209 3300035171 Ga0373946_0029993 Ga0373946_0029993_136_1059 281
210 3300035692 Ga0373935_0163467 Ga0373935_0163467_558_1481 281
211 3300037068 Ga0373925_0309674 Ga0373925_0309674_138_1040 281
212 3300041452 Ga0451793_1226599 Ga0451793_1226599_261_1187 281
213 3300041491 Ga0451833_0106143 Ga0451833_0106143_90_1016 281
214 3300041498 Ga0451841_0520278 Ga0451841_0520278_266_1192 281
215 3300041509 Ga0451843_1242208 Ga0451843_1242208_372_1298 281
216 3300044684 Ga0466966_0000454 Ga0466966_0000454_12468_13409 281
217 3300044712 Ga0453684_0009992 Ga0453684_0009992_7102_7992 281
218 3300046512 Ga0495610_0064218 Ga0495610_0064218_272_1198 281
219 3300046519 Ga0495632_0041990 Ga0495632_0041990_247_1173 281
220 3300046526 Ga0495666_0099395 Ga0495666_0099395_78_980 281
221 3300046535 Ga0495586_0017741 Ga0495586_0017741_1666_2568 281
222 3300046660 Ga0495625_0002034 Ga0495625_0002034_17924_18850 281
223 3300046660 Ga0495625_0194632 Ga0495625_0194632_347_1273 281
224 3300047443 Ga0495687_064950 Ga0495687_064950_502_1377 281
225 3300050493 nmdc:mga0k408_49669_c1 nmdc:mga0k408_49669_c1_837_1742 281
226 iso_pu_bacteria 2643221556 2643797085 281
227 iso_pu_bacteria 2643221660 2644341264 281
228 iso_pu_bacteria 2643221684 2644469811 281
229 iso_pu_bacteria 8047673197 8047676629 281
230 3300005564 Ga0070664_100072533 Ga0070664_1000725331 282
231 3300006178 Ga0075367_10193941 Ga0075367_101939412 282
232 3300014968 Ga0157379_10241863 Ga0157379_102418632 282
233 3300025298 Ga0209050_1000529 Ga0209050_100052954 282
234 3300025945 Ga0207679_10089646 Ga0207679_100896462 282
235 3300027876 Ga0209974_10011964 Ga0209974_100119642 282
236 3300031239 Ga0265328_10034260 Ga0265328_100342603 282
237 3300031251 Ga0265327_10000143 Ga0265327_1000014358 282
238 3300037068 Ga0373925_0001650 Ga0373925_0001650_4550_5455 282
239 3300037471 Ga0395905_0184217 Ga0395905_0184217_794_1702 282
240 3300044656 Ga0466969_0000017 Ga0466969_0000017_51720_52637 282
241 3300044684 Ga0466966_0013120 Ga0466966_0013120_1807_2724 282
242 3300046530 Ga0495654_0000668 Ga0495654_0000668_23494_24393 282
243 3300050507 nmdc:mga05p37_224370_c1 nmdc:mga05p37_224370_c1_1181_2086 282
244 iso_pu_bacteria 2857547612 2857551617 282
245 iso_pu_bacteria 2886848708 2886851516 282
246 iso_pu_bacteria 2932410948 2932416532 282
247 iso_pu_bacteria 2932416698 2932417068 282
248 3300002987 JGI25159J45721_1001772 JGI25159J45721_10017725 283
249 3300003215 JGI25153J46596_10001052 JGI25153J46596_100010529 283
250 3300003771 Ga0055526_1001902 Ga0055526_100190213 283
251 3300003773 Ga0055537_1000139 Ga0055537_100013913 283
252 3300003784 Ga0055534_1000942 Ga0055534_100094213 283
253 3300003790 Ga0055528_1000703 Ga0055528_100070310 283
254 3300004625 Ga0055543_1007311 Ga0055543_10073112 283
255 3300005262 Ga0065165_1000590 Ga0065165_100059033 283
256 3300005330 Ga0070690_100117169 Ga0070690_1001171692 283
257 3300005340 Ga0070689_100032310 Ga0070689_1000323103 283
258 3300006195 Ga0075366_10063612 Ga0075366_100636123 283
259 3300009148 Ga0105243_10006332 Ga0105243_100063324 283
260 3300021361 Ga0213872_10000007 Ga0213872_1000000791 283
261 3300025263 Ga0209565_1000055 Ga0209565_1000055177 283
262 3300025273 Ga0209673_1000040 Ga0209673_1000040177 283
263 3300025284 Ga0209130_1000195 Ga0209130_100019527 283
264 3300025291 Ga0209675_1000052 Ga0209675_100005213 283
265 3300025295 Ga0209564_1000121 Ga0209564_100012172 283
266 3300025297 Ga0209758_1000045 Ga0209758_1000045173 283
267 3300025299 Ga0209256_1000100 Ga0209256_100010013 283
268 3300025936 Ga0207670_10412196 Ga0207670_104121962 283
269 3300028794 Ga0307515_10081051 Ga0307515_100810516 283
270 3300039447 Ga0436361_0163583 Ga0436361_0163583_141695_142648 283
271 3300042876 Ga0451577_0061411 Ga0451577_0061411_2262_3191 283
272 3300044693 Ga0466961_0221226 Ga0466961_0221226_248_1141 283
273 3300044694 Ga0466963_0073887 Ga0466963_0073887_888_1823 283
274 3300046491 Ga0495584_0043820 Ga0495584_0043820_134_1015 283
275 3300046501 Ga0495607_0030964 Ga0495607_0030964_1690_2571 283
276 3300046506 Ga0495583_0013304 Ga0495583_0013304_276_1157 283
277 3300046513 Ga0495616_0013555 Ga0495616_0013555_1717_2598 283
278 3300046513 Ga0495616_0106189 Ga0495616_0106189_14_916 283
279 3300046522 Ga0495643_0000567 Ga0495643_0000567_37312_38205 283
280 3300046525 Ga0495663_0072673 Ga0495663_0072673_60_941 283
281 3300046528 Ga0495642_0005384 Ga0495642_0005384_1246_2127 283
282 3300046538 Ga0495609_0000486 Ga0495609_0000486_22235_23116 283
283 3300046616 Ga0495668_0000035 Ga0495668_0000035_27289_28188 283
284 3300046616 Ga0495668_0001462 Ga0495668_0001462_3647_4528 283
285 3300046660 Ga0495625_0001970 Ga0495625_0001970_19086_19967 283
286 3300046664 Ga0495659_0001196 Ga0495659_0001196_442_1323 283
287 3300046694 Ga0495649_0080528 Ga0495649_0080528_817_1698 283
288 3300047318 Ga0495636_0034577 Ga0495636_0034577_944_1825 283
289 3300047446 Ga0495679_010347 Ga0495679_010347_2456_3337 283
290 3300047470 Ga0495681_0001257 Ga0495681_0001257_3206_4087 283
291 3300047472 Ga0495686_0000879 Ga0495686_0000879_18351_19250 283
292 3300048091 Ga0495626_0011650 Ga0495626_0011650_202_1095 283
293 3300048925 Ga0496122_0053333 Ga0496122_0053333_1558_2451 283
294 3300048926 Ga0496123_0009868 Ga0496123_0009868_3224_4117 283
295 3300049822 Ga0501035_0020112 Ga0501035_0020112_1593_2516 283
296 3300053117 Ga0500593_000267 Ga0500593_000267_1425_2360 283
297 3300003320 rootH2_10018082 rootH2_100180827 284
298 3300003322 rootL2_10001457 rootL2_1000145763 284
299 3300003323 rootH1_10020465 rootH1_100204652 284
300 3300005262 Ga0065165_1001052 Ga0065165_10010526 284
301 3300005329 Ga0070683_100005154 Ga0070683_1000051549 284
302 3300005344 Ga0070661_100047409 Ga0070661_1000474094 284
303 3300005355 Ga0070671_100158775 Ga0070671_1001587751 284
304 3300005366 Ga0070659_100019281 Ga0070659_1000192812 284
305 3300005535 Ga0070684_100006125 Ga0070684_1000061255 284
306 3300005539 Ga0068853_100019086 Ga0068853_1000190867 284
307 3300005547 Ga0070693_100009342 Ga0070693_1000093425 284
308 3300005564 Ga0070664_100227099 Ga0070664_1002270992 284
309 3300005577 Ga0068857_100016044 Ga0068857_1000160444 284
310 3300005614 Ga0068856_100221497 Ga0068856_1002214972 284
311 3300005616 Ga0068852_100082393 Ga0068852_1000823932 284
312 3300005834 Ga0068851_10219863 Ga0068851_102198632 284
313 3300005841 Ga0068863_100200097 Ga0068863_1002000973 284
314 3300005842 Ga0068858_100405678 Ga0068858_1004056782 284
315 3300005843 Ga0068860_100475079 Ga0068860_1004750792 284
316 3300006846 Ga0075430_100013700 Ga0075430_1000137002 284
317 3300006880 Ga0075429_100002011 Ga0075429_1000020115 284
318 3300009093 Ga0105240_10293943 Ga0105240_102939431 284
319 3300009093 Ga0105240_10385291 Ga0105240_103852912 284
320 3300013105 Ga0157369_10042581 Ga0157369_100425812 284
321 3300013296 Ga0157374_10073653 Ga0157374_100736533 284
322 3300013307 Ga0157372_10029653 Ga0157372_100296535 284
323 3300014968 Ga0157379_10159338 Ga0157379_101593383 284
324 3300025231 Ga0207427_100611 Ga0207427_10061118 284
325 3300025273 Ga0209673_1026656 Ga0209673_10266562 284
326 3300025909 Ga0207705_10055974 Ga0207705_100559742 284
327 3300025913 Ga0207695_10165403 Ga0207695_101654033 284
328 3300025919 Ga0207657_10095706 Ga0207657_100957064 284
329 3300025940 Ga0207691_10069752 Ga0207691_100697521 284
330 3300025945 Ga0207679_10179261 Ga0207679_101792613 284
331 3300026023 Ga0207677_10447058 Ga0207677_104470581 284
332 3300026116 Ga0207674_10024335 Ga0207674_100243356 284
333 3300028381 Ga0268264_10369181 Ga0268264_103691812 284
334 3300031730 Ga0307516_10000677 Ga0307516_1000067727 284
335 3300036401 Ga0373937_0390033 Ga0373937_0390033_321_1235 284
336 3300039437 Ga0436365_1857266 Ga0436365_1857266_1314_2228 284
337 3300046452 Ga0495617_000001 Ga0495617_000001_96014_96910 284
338 3300046453 Ga0495627_000035 Ga0495627_000035_132616_133512 284
339 3300046460 Ga0495638_0027065 Ga0495638_0027065_730_1638 284
340 3300046460 Ga0495638_0173660 Ga0495638_0173660_101_1054 284
341 3300046474 Ga0495605_0000173 Ga0495605_0000173_50494_51390 284
342 3300046474 Ga0495605_0021091 Ga0495605_0021091_931_1839 284
343 3300046474 Ga0495605_0072912 Ga0495605_0072912_550_1446 284
344 3300046491 Ga0495584_0000476 Ga0495584_0000476_22113_23045 284
345 3300046491 Ga0495584_0036188 Ga0495584_0036188_333_1256 284
346 3300046492 Ga0495585_0137863 Ga0495585_0137863_318_1214 284
347 3300046499 Ga0495594_0038400 Ga0495594_0038400_298_1206 284
348 3300046500 Ga0495596_0000269 Ga0495596_0000269_20660_21583 284
349 3300046500 Ga0495596_0001261 Ga0495596_0001261_8664_9572 284
350 3300046500 Ga0495596_0004074 Ga0495596_0004074_1180_2109 284
351 3300046500 Ga0495596_0004356 Ga0495596_0004356_2065_2961 284
352 3300046500 Ga0495596_0004374 Ga0495596_0004374_5428_6345 284
353 3300046500 Ga0495596_0023514 Ga0495596_0023514_260_1168 284
354 3300046506 Ga0495583_0000266 Ga0495583_0000266_67246_68169 284
355 3300046506 Ga0495583_0004482 Ga0495583_0004482_7233_8150 284
356 3300046506 Ga0495583_0012841 Ga0495583_0012841_2191_3099 284
357 3300046506 Ga0495583_0015225 Ga0495583_0015225_2273_3202 284
358 3300046506 Ga0495583_0106535 Ga0495583_0106535_103_1020 284
359 3300046507 Ga0495606_0059265 Ga0495606_0059265_928_1857 284
360 3300046513 Ga0495616_0000037 Ga0495616_0000037_15629_16525 284
361 3300046513 Ga0495616_0001334 Ga0495616_0001334_6800_7729 284
362 3300046518 Ga0495631_0001676 Ga0495631_0001676_1377_2273 284
363 3300046518 Ga0495631_0005281 Ga0495631_0005281_1400_2329 284
364 3300046518 Ga0495631_0006938 Ga0495631_0006938_4369_5265 284
365 3300046518 Ga0495631_0045508 Ga0495631_0045508_510_1406 284
366 3300046519 Ga0495632_0000119 Ga0495632_0000119_12652_13575 284
367 3300046519 Ga0495632_0000126 Ga0495632_0000126_25559_26455 284
368 3300046519 Ga0495632_0006812 Ga0495632_0006812_2677_3630 284
369 3300046524 Ga0495648_0000138 Ga0495648_0000138_16900_17796 284
370 3300046524 Ga0495648_0040159 Ga0495648_0040159_576_1484 284
371 3300046528 Ga0495642_0000009 Ga0495642_0000009_94353_95249 284
372 3300046528 Ga0495642_0000069 Ga0495642_0000069_39654_40550 284
373 3300046528 Ga0495642_0006396 Ga0495642_0006396_2413_3336 284
374 3300046538 Ga0495609_0007848 Ga0495609_0007848_748_1644 284
375 3300046538 Ga0495609_0017809 Ga0495609_0017809_261_1169 284
376 3300046558 Ga0495633_0048808 Ga0495633_0048808_61_957 284
377 3300046615 Ga0495656_0006795 Ga0495656_0006795_2048_2944 284
378 3300046616 Ga0495668_0000800 Ga0495668_0000800_18345_19241 284
379 3300046616 Ga0495668_0020512 Ga0495668_0020512_405_1322 284
380 3300046616 Ga0495668_0027111 Ga0495668_0027111_2246_3154 284
381 3300046616 Ga0495668_0031486 Ga0495668_0031486_1971_2894 284
382 3300046616 Ga0495668_0044464 Ga0495668_0044464_11_940 284
383 3300046648 Ga0495611_0001110 Ga0495611_0001110_5219_6127 284
384 3300046648 Ga0495611_0009857 Ga0495611_0009857_1956_2852 284
385 3300046648 Ga0495611_0045048 Ga0495611_0045048_403_1299 284
386 3300046660 Ga0495625_0058662 Ga0495625_0058662_1320_2216 284
387 3300046660 Ga0495625_0162895 Ga0495625_0162895_23_952 284
388 3300046665 Ga0495661_0009241 Ga0495661_0009241_257_1180 284
389 3300046665 Ga0495661_0030930 Ga0495661_0030930_593_1489 284
390 3300046665 Ga0495661_0083165 Ga0495661_0083165_284_1180 284
391 3300046679 Ga0495623_0061342 Ga0495623_0061342_222_1127 284
392 3300046684 Ga0495669_0000094 Ga0495669_0000094_16647_17543 284
393 3300046684 Ga0495669_0001761 Ga0495669_0001761_6352_7260 284
394 3300046691 Ga0495670_0020963 Ga0495670_0020963_1357_2253 284
395 3300046691 Ga0495670_0024900 Ga0495670_0024900_792_1715 284
396 3300046692 Ga0495671_0000047 Ga0495671_0000047_94547_95443 284
397 3300046692 Ga0495671_0000715 Ga0495671_0000715_9874_10797 284
398 3300046692 Ga0495671_0001120 Ga0495671_0001120_17485_18408 284
399 3300046694 Ga0495649_0003092 Ga0495649_0003092_6951_7871 284
400 3300046694 Ga0495649_0004491 Ga0495649_0004491_6511_7464 284
401 3300046794 Ga0495589_0000939 Ga0495589_0000939_9584_10480 284
402 3300046794 Ga0495589_0066332 Ga0495589_0066332_431_1339 284
403 3300046810 Ga0495660_0003343 Ga0495660_0003343_1928_2851 284
404 3300046810 Ga0495660_0007769 Ga0495660_0007769_3979_4887 284
405 3300046810 Ga0495660_0026793 Ga0495660_0026793_592_1545 284
406 3300046810 Ga0495660_0043054 Ga0495660_0043054_894_1790 284
407 3300047320 Ga0495672_0024035 Ga0495672_0024035_1553_2461 284
408 3300047323 Ga0495683_0081990 Ga0495683_0081990_606_1535 284
409 3300047443 Ga0495687_000728 Ga0495687_000728_23010_23927 284
410 3300047445 Ga0495677_0005961 Ga0495677_0005961_1220_2116 284
411 3300047445 Ga0495677_0009707 Ga0495677_0009707_854_1762 284
412 3300047446 Ga0495679_009721 Ga0495679_009721_158_1066 284
413 3300047446 Ga0495679_017478 Ga0495679_017478_1497_2393 284
414 3300047470 Ga0495681_0000067 Ga0495681_0000067_83783_84706 284
415 3300047470 Ga0495681_0002358 Ga0495681_0002358_1694_2623 284
416 3300047470 Ga0495681_0026651 Ga0495681_0026651_387_1316 284
417 3300047472 Ga0495686_0000015 Ga0495686_0000015_442413_443321 284
418 3300048091 Ga0495626_0006154 Ga0495626_0006154_4552_5460 284
419 3300048091 Ga0495626_0006695 Ga0495626_0006695_614_1522 284
420 3300048091 Ga0495626_0018023 Ga0495626_0018023_2216_3124 284
421 3300048091 Ga0495626_0022343 Ga0495626_0022343_43_972 284
422 3300048091 Ga0495626_0024076 Ga0495626_0024076_1503_2426 284
423 3300048927 Ga0496124_0199895 Ga0496124_0199895_118_1023 284
424 3300049459 Ga0495678_000122 Ga0495678_000122_1016_1945 284
425 3300049459 Ga0495678_000140 Ga0495678_000140_66945_67868 284
426 3300049459 Ga0495678_013402 Ga0495678_013402_686_1594 284
427 3300049460 Ga0495682_0000645 Ga0495682_0000645_13141_14070 284
428 3300049460 Ga0495682_0005882 Ga0495682_0005882_359_1267 284
429 3300049585 Ga0501069_0016771 Ga0501069_0016771_2458_3462 284
430 3300049586 Ga0501070_0006049 Ga0501070_0006049_6791_7795 284
431 3300049589 Ga0501073_0004816 Ga0501073_0004816_3676_4680 284
432 3300049590 Ga0501074_0009715 Ga0501074_0009715_2524_3528 284
433 3300049741 Ga0501079_0037924 Ga0501079_0037924_2335_3339 284
434 3300049742 Ga0501080_0029064 Ga0501080_0029064_2905_3909 284
435 3300049744 Ga0501083_0006267 Ga0501083_0006267_3474_4478 284
436 3300049822 Ga0501035_0179098 Ga0501035_0179098_780_1784 284
437 3300049823 Ga0501044_0058899 Ga0501044_0058899_2460_3464 284
438 3300050508 nmdc:mga09592_27696_c1 nmdc:mga09592_27696_c1_1828_2730 284
439 3300050509 nmdc:mga0qj67_12358_c1 nmdc:mga0qj67_12358_c1_3286_4188 284
440 3300053134 Ga0500658_0007750 Ga0500658_0007750_1509_2462 284
441 3300054114 Ga0501084_0010239 Ga0501084_0010239_3362_4366 284
442 3300003322 rootL2_10024434 rootL2_100244344 285
443 3300003322 rootL2_10046301 rootL2_100463014 285
444 3300003759 Ga0055525_1000006 Ga0055525_100000627 285
445 3300005262 Ga0065165_1050188 Ga0065165_10501881 285
446 3300005327 Ga0070658_10131552 Ga0070658_101315523 285
447 3300005339 Ga0070660_100100087 Ga0070660_1001000871 285
448 3300005563 Ga0068855_100105646 Ga0068855_1001056463 285
449 3300005564 Ga0070664_100172592 Ga0070664_1001725922 285
450 3300005564 Ga0070664_100232867 Ga0070664_1002328672 285
451 3300006195 Ga0075366_10150380 Ga0075366_101503802 285
452 3300006237 Ga0097621_100059890 Ga0097621_1000598903 285
453 3300009093 Ga0105240_10326796 Ga0105240_103267962 285
454 3300009174 Ga0105241_10004946 Ga0105241_100049464 285
455 3300009545 Ga0105237_10206071 Ga0105237_102060713 285
456 3300013100 Ga0157373_10169567 Ga0157373_101695672 285
457 3300013307 Ga0157372_10822322 Ga0157372_108223221 285
458 3300015261 Ga0182006_1000129 Ga0182006_100012933 285
459 3300025230 Ga0209563_100022 Ga0209563_10002226 285
460 3300025253 Ga0209677_102651 Ga0209677_1026514 285
461 3300025909 Ga0207705_10076694 Ga0207705_100766943 285
462 3300025911 Ga0207654_10003469 Ga0207654_100034693 285
463 3300025919 Ga0207657_10285550 Ga0207657_102855502 285
464 3300025933 Ga0207706_10132114 Ga0207706_101321143 285
465 3300025949 Ga0207667_10121278 Ga0207667_101212783 285
466 3300025986 Ga0207658_10028962 Ga0207658_100289621 285
467 3300026067 Ga0207678_10170660 Ga0207678_101706602 285
468 3300026142 Ga0207698_10186857 Ga0207698_101868572 285
469 3300035691 Ga0373931_0043075 Ga0373931_0043075_644_1555 285
470 3300037312 Ga0395899_0022687 Ga0395899_0022687_3125_4027 285
471 3300037312 Ga0395899_0027162 Ga0395899_0027162_1999_2901 285
472 3300037312 Ga0395899_0066414 Ga0395899_0066414_1497_2396 285
473 3300037418 Ga0395900_0008081 Ga0395900_0008081_6959_7861 285
474 3300037418 Ga0395900_0019362 Ga0395900_0019362_4407_5309 285
475 3300037418 Ga0395900_0021938 Ga0395900_0021938_2555_3454 285
476 3300037418 Ga0395900_0025270 Ga0395900_0025270_4095_4997 285
477 3300037418 Ga0395900_0103129 Ga0395900_0103129_61_963 285
478 3300037418 Ga0395900_0434367 Ga0395900_0434367_120_1019 285
479 3300037466 Ga0395898_0012097 Ga0395898_0012097_6468_7370 285
480 3300037471 Ga0395905_0042976 Ga0395905_0042976_1869_2771 285
481 3300037471 Ga0395905_0070807 Ga0395905_0070807_68_967 285
482 3300037471 Ga0395905_0168013 Ga0395905_0168013_634_1536 285
483 3300038443 Ga0395901_0000103 Ga0395901_0000103_23486_24388 285
484 3300038443 Ga0395901_0006663 Ga0395901_0006663_5865_6767 285
485 3300038443 Ga0395901_0087498 Ga0395901_0087498_1310_2209 285
486 3300038443 Ga0395901_0291755 Ga0395901_0291755_495_1394 285
487 3300038443 Ga0395901_0520509 Ga0395901_0520509_180_1082 285
488 3300041997 Ga0439431_0030756 Ga0439431_0030756_284_1279 285
489 3300042005 Ga0439448_0057029 Ga0439448_0057029_354_1253 285
490 3300042007 Ga0439449_0009892 Ga0439449_0009892_499_1398 285
491 3300042008 Ga0439450_006282 Ga0439450_006282_165_1064 285
492 3300042139 Ga0450904_002018 Ga0450904_002018_1261_2190 285
493 3300042876 Ga0451577_0003232 Ga0451577_0003232_16792_17715 285
494 3300044656 Ga0466969_0053541 Ga0466969_0053541_670_1572 285
495 3300044683 Ga0466965_0032205 Ga0466965_0032205_689_1591 285
496 3300044684 Ga0466966_0019891 Ga0466966_0019891_86_985 285
497 3300044684 Ga0466966_0098683 Ga0466966_0098683_440_1342 285
498 3300044684 Ga0466966_0136715 Ga0466966_0136715_287_1189 285
499 3300044693 Ga0466961_0165391 Ga0466961_0165391_395_1297 285
500 3300044694 Ga0466963_0062824 Ga0466963_0062824_177_1079 285
501 3300044706 Ga0466964_0006890 Ga0466964_0006890_2383_3285 285
502 3300044706 Ga0466964_0008771 Ga0466964_0008771_103_1005 285
503 3300044842 Ga0466957_0000012 Ga0466957_0000012_6784_7686 285
504 3300044842 Ga0466957_0003624 Ga0466957_0003624_5962_6870 285
505 3300045049 Ga0466959_0021594 Ga0466959_0021594_3549_4451 285
506 3300045049 Ga0466959_0050434 Ga0466959_0050434_160_1062 285
507 3300045049 Ga0466959_0055486 Ga0466959_0055486_1773_2672 285
508 3300045049 Ga0466959_0262490 Ga0466959_0262490_199_1098 285
509 3300045836 Ga0466958_0017369 Ga0466958_0017369_1123_2025 285
510 3300045976 Ga0466967_0011429 Ga0466967_0011429_4520_5422 285
511 3300045976 Ga0466967_0023782 Ga0466967_0023782_739_1641 285
512 3300046452 Ga0495617_042516 Ga0495617_042516_252_1160 285
513 3300046457 Ga0495590_0000829 Ga0495590_0000829_3661_4587 285
514 3300046457 Ga0495590_0029076 Ga0495590_0029076_704_1603 285
515 3300046472 Ga0495580_0055947 Ga0495580_0055947_50_967 285
516 3300046473 Ga0495582_0009564 Ga0495582_0009564_3768_4685 285
517 3300046474 Ga0495605_0000039 Ga0495605_0000039_187748_188647 285
518 3300046474 Ga0495605_0004874 Ga0495605_0004874_3595_4512 285
519 3300046474 Ga0495605_0029882 Ga0495605_0029882_1804_2721 285
520 3300046491 Ga0495584_0000890 Ga0495584_0000890_2535_3452 285
521 3300046491 Ga0495584_0001772 Ga0495584_0001772_6501_7400 285
522 3300046492 Ga0495585_0005156 Ga0495585_0005156_5985_6893 285
523 3300046499 Ga0495594_0036988 Ga0495594_0036988_399_1316 285
524 3300046500 Ga0495596_0006717 Ga0495596_0006717_999_1916 285
525 3300046501 Ga0495607_0004567 Ga0495607_0004567_3240_4139 285
526 3300046501 Ga0495607_0010751 Ga0495607_0010751_1955_2854 285
527 3300046506 Ga0495583_0000341 Ga0495583_0000341_27419_28357 285
528 3300046506 Ga0495583_0000372 Ga0495583_0000372_32045_32962 285
529 3300046507 Ga0495606_0009759 Ga0495606_0009759_2254_3153 285
530 3300046513 Ga0495616_0014825 Ga0495616_0014825_2145_3044 285
531 3300046517 Ga0495630_0032744 Ga0495630_0032744_1591_2508 285
532 3300046518 Ga0495631_0018214 Ga0495631_0018214_1372_2289 285
533 3300046519 Ga0495632_0000375 Ga0495632_0000375_27286_28185 285
534 3300046519 Ga0495632_0008489 Ga0495632_0008489_4161_5078 285
535 3300046522 Ga0495643_0000247 Ga0495643_0000247_74777_75715 285
536 3300046522 Ga0495643_0002950 Ga0495643_0002950_2918_3817 285
537 3300046522 Ga0495643_0007380 Ga0495643_0007380_3234_4145 285
538 3300046522 Ga0495643_0032176 Ga0495643_0032176_1904_2803 285
539 3300046523 Ga0495644_0072205 Ga0495644_0072205_282_1199 285
540 3300046524 Ga0495648_0017008 Ga0495648_0017008_1061_1960 285
541 3300046526 Ga0495666_0007333 Ga0495666_0007333_3807_4724 285
542 3300046528 Ga0495642_0000779 Ga0495642_0000779_10220_11119 285
543 3300046528 Ga0495642_0012064 Ga0495642_0012064_1966_2883 285
544 3300046535 Ga0495586_0154398 Ga0495586_0154398_271_1188 285
545 3300046538 Ga0495609_0018939 Ga0495609_0018939_1800_2708 285
546 3300046558 Ga0495633_0001734 Ga0495633_0001734_11594_12541 285
547 3300046615 Ga0495656_0024835 Ga0495656_0024835_856_1773 285
548 3300046616 Ga0495668_0132518 Ga0495668_0132518_252_1169 285
549 3300046616 Ga0495668_0145448 Ga0495668_0145448_282_1199 285
550 3300046642 Ga0495634_0021142 Ga0495634_0021142_1102_2019 285
551 3300046648 Ga0495611_0013522 Ga0495611_0013522_57_974 285
552 3300046665 Ga0495661_0000461 Ga0495661_0000461_14605_15513 285
553 3300046665 Ga0495661_0000560 Ga0495661_0000560_6776_7675 285
554 3300046665 Ga0495661_0002737 Ga0495661_0002737_1226_2125 285
555 3300046665 Ga0495661_0087985 Ga0495661_0087985_674_1573 285
556 3300046665 Ga0495661_0143138 Ga0495661_0143138_57_965 285
557 3300046674 Ga0495588_0000059 Ga0495588_0000059_176415_177314 285
558 3300046679 Ga0495623_0021707 Ga0495623_0021707_2961_3878 285
559 3300046694 Ga0495649_0015623 Ga0495649_0015623_2368_3279 285
560 3300046694 Ga0495649_0042146 Ga0495649_0042146_939_1856 285
561 3300046794 Ga0495589_0001197 Ga0495589_0001197_7448_8347 285
562 3300046794 Ga0495589_0001894 Ga0495589_0001894_99_1016 285
563 3300046810 Ga0495660_0000880 Ga0495660_0000880_9664_10563 285
564 3300046810 Ga0495660_0007209 Ga0495660_0007209_195_1112 285
565 3300046810 Ga0495660_0022112 Ga0495660_0022112_98_1000 285
566 3300047317 Ga0495604_0014524 Ga0495604_0014524_1267_2184 285
567 3300047320 Ga0495672_0003171 Ga0495672_0003171_307_1206 285
568 3300047323 Ga0495683_0015232 Ga0495683_0015232_2824_3741 285
569 3300047323 Ga0495683_0029094 Ga0495683_0029094_205_1104 285
570 3300047443 Ga0495687_000646 Ga0495687_000646_2910_3809 285
571 3300047443 Ga0495687_000943 Ga0495687_000943_22558_23457 285
572 3300047443 Ga0495687_033256 Ga0495687_033256_761_1660 285
573 3300047444 Ga0495675_0005147 Ga0495675_0005147_6091_7008 285
574 3300047445 Ga0495677_0000104 Ga0495677_0000104_6150_7067 285
575 3300047445 Ga0495677_0001887 Ga0495677_0001887_5619_6518 285
576 3300047445 Ga0495677_0003127 Ga0495677_0003127_969_1868 285
577 3300047446 Ga0495679_005923 Ga0495679_005923_29_946 285
578 3300047470 Ga0495681_0001717 Ga0495681_0001717_5700_6617 285
579 3300048091 Ga0495626_0000058 Ga0495626_0000058_74265_75164 285
580 3300048091 Ga0495626_0003238 Ga0495626_0003238_4548_5483 285
581 3300048091 Ga0495626_0006233 Ga0495626_0006233_400_1317 285
582 3300048091 Ga0495626_0034381 Ga0495626_0034381_696_1613 285
583 3300048091 Ga0495626_0036620 Ga0495626_0036620_69_986 285
584 3300048091 Ga0495626_0042005 Ga0495626_0042005_1025_1936 285
585 3300048905 Ga0496102_0267969 Ga0496102_0267969_693_1595 285
586 3300048912 Ga0496109_0007671 Ga0496109_0007671_5923_6831 285
587 3300048916 Ga0496113_0005467 Ga0496113_0005467_21_929 285
588 3300048924 Ga0496121_0087245 Ga0496121_0087245_183_1082 285
589 3300048925 Ga0496122_0000299 Ga0496122_0000299_79873_80781 285
590 3300048925 Ga0496122_0000898 Ga0496122_0000898_39194_40141 285
591 3300048926 Ga0496123_0000959 Ga0496123_0000959_28981_29889 285
592 3300048926 Ga0496123_0003657 Ga0496123_0003657_1457_2404 285
593 3300048927 Ga0496124_0017158 Ga0496124_0017158_5060_5959 285
594 3300048927 Ga0496124_0050112 Ga0496124_0050112_813_1739 285
595 3300048927 Ga0496124_0057375 Ga0496124_0057375_1300_2199 285
596 3300048928 Ga0496125_0000520 Ga0496125_0000520_55207_56115 285
597 3300048929 Ga0496126_0361791 Ga0496126_0361791_123_1022 285
598 3300049459 Ga0495678_004136 Ga0495678_004136_4819_5736 285
599 3300049460 Ga0495682_0006654 Ga0495682_0006654_2958_3905 285
600 3300049581 Ga0501047_0220534 Ga0501047_0220534_579_1481 285
601 3300049662 Ga0501222_005869 Ga0501222_005869_14_913 285
602 3300049822 Ga0501035_0015080 Ga0501035_0015080_3852_4754 285
603 3300049823 Ga0501044_0063301 Ga0501044_0063301_2258_3160 285
604 3300061719 Ga0466962_0133975 Ga0466962_0133975_58_960 285
605 3300003775 Ga0055524_1000469 Ga0055524_10004694 286
606 3300003791 Ga0055530_10000630 Ga0055530_100006306 286
607 3300003792 Ga0055540_1000173 Ga0055540_100017324 286
608 3300005334 Ga0068869_100074025 Ga0068869_1000740252 286
609 3300005355 Ga0070671_100062310 Ga0070671_1000623103 286
610 3300005366 Ga0070659_100321657 Ga0070659_1003216572 286
611 3300005457 Ga0070662_100051059 Ga0070662_1000510593 286
612 3300005459 Ga0068867_100304076 Ga0068867_1003040762 286
613 3300005539 Ga0068853_100033545 Ga0068853_1000335454 286
614 3300005577 Ga0068857_100031088 Ga0068857_1000310882 286
615 3300005578 Ga0068854_100121084 Ga0068854_1001210843 286
616 3300006048 Ga0075363_100056933 Ga0075363_1000569331 286
617 3300006051 Ga0075364_10031906 Ga0075364_100319064 286
618 3300006177 Ga0075362_10040933 Ga0075362_100409332 286
619 3300006178 Ga0075367_10015968 Ga0075367_100159682 286
620 3300006186 Ga0075369_10002395 Ga0075369_100023952 286
621 3300006195 Ga0075366_10003369 Ga0075366_100033698 286
622 3300006195 Ga0075366_10243336 Ga0075366_102433362 286
623 3300006353 Ga0075370_10001022 Ga0075370_100010225 286
624 3300006353 Ga0075370_10062768 Ga0075370_100627682 286
625 3300006358 Ga0068871_100248951 Ga0068871_1002489512 286
626 3300009093 Ga0105240_10009086 Ga0105240_100090863 286
627 3300009093 Ga0105240_10309258 Ga0105240_103092583 286
628 3300009098 Ga0105245_10207921 Ga0105245_102079212 286
629 3300009148 Ga0105243_10145981 Ga0105243_101459813 286
630 3300010375 Ga0105239_10063734 Ga0105239_100637344 286
631 3300013296 Ga0157374_10073775 Ga0157374_100737751 286
632 3300025298 Ga0209050_1000916 Ga0209050_100091611 286
633 3300025299 Ga0209256_1000036 Ga0209256_1000036335 286
634 3300025303 Ga0209051_1000379 Ga0209051_100037930 286
635 3300025304 Ga0209257_1000141 Ga0209257_1000141124 286
636 3300025913 Ga0207695_10042210 Ga0207695_100422104 286
637 3300025914 Ga0207671_10076846 Ga0207671_100768463 286
638 3300025926 Ga0207659_10139509 Ga0207659_101395092 286
639 3300025927 Ga0207687_10224417 Ga0207687_102244172 286
640 3300025933 Ga0207706_10031551 Ga0207706_100315514 286
641 3300025960 Ga0207651_10085215 Ga0207651_100852152 286
642 3300025986 Ga0207658_10142446 Ga0207658_101424462 286
643 3300025986 Ga0207658_10278192 Ga0207658_102781922 286
644 3300026067 Ga0207678_10022183 Ga0207678_100221835 286
645 3300026116 Ga0207674_10016404 Ga0207674_100164045 286
646 3300031507 Ga0307509_10001361 Ga0307509_100013614 286
647 3300031548 Ga0307408_100149218 Ga0307408_1001492183 286
648 3300031649 Ga0307514_10048470 Ga0307514_100484704 286
649 3300033180 Ga0307510_10042584 Ga0307510_100425843 286
650 3300044656 Ga0466969_0002974 Ga0466969_0002974_188_1165 286
651 3300044683 Ga0466965_0012379 Ga0466965_0012379_2659_3636 286
652 3300044684 Ga0466966_0007015 Ga0466966_0007015_5559_6536 286
653 3300044693 Ga0466961_0000623 Ga0466961_0000623_3906_4883 286
654 3300045049 Ga0466959_0000504 Ga0466959_0000504_15845_16822 286
655 3300046454 Ga0495592_0000495 Ga0495592_0000495_17426_18346 286
656 3300046513 Ga0495616_0000335 Ga0495616_0000335_32164_33105 286
657 3300046517 Ga0495630_0026460 Ga0495630_0026460_2087_3001 286
658 3300046542 Ga0495597_0009698 Ga0495597_0009698_1208_2128 286
659 3300046557 Ga0495622_0064984 Ga0495622_0064984_350_1264 286
660 3300047320 Ga0495672_0186580 Ga0495672_0186580_35_949 286
661 3300047321 Ga0495676_0015875 Ga0495676_0015875_5187_6101 286
662 3300047443 Ga0495687_000292 Ga0495687_000292_55432_56352 286
663 3300048917 Ga0496114_0028986 Ga0496114_0028986_2200_3120 286
664 3300050491 nmdc:mga00v17_59262_c1 nmdc:mga00v17_59262_c1_1030_1950 286
665 3300050493 nmdc:mga0k408_10619_c1 nmdc:mga0k408_10619_c1_3495_4415 286
666 3300050493 nmdc:mga0k408_96282_c1 nmdc:mga0k408_96282_c1_637_1560 286
667 3300050496 nmdc:mga07m45_94776_c1 nmdc:mga07m45_94776_c1_752_1675 286
668 3300050516 nmdc:mga0sz30_15062_c1 nmdc:mga0sz30_15062_c1_1561_2481 286
669 3300033180 Ga0307510_10001484 Ga0307510_1000148418 287
670 3300003792 Ga0055540_1032310 Ga0055540_10323102 288
671 3300025303 Ga0209051_1002249 Ga0209051_10022499 288
672 3300039447 Ga0436361_0480843 Ga0436361_0480843_4871_5791 289
673 3300034820 Ga0373959_0008059 Ga0373959_0008059_120_1049 292
674 3300002705 JGI25156J39149_1000149 JGI25156J39149_100014915 294
675 3300002738 JGI25154J39366_1003663 JGI25154J39366_10036632 294
676 3300002741 JGI25157J39369_1000192 JGI25157J39369_100019215 294
677 3300003323 rootH1_10013779 rootH1_100137792 294
678 3300005535 Ga0070684_100076143 Ga0070684_1000761433 294
679 3300005539 Ga0068853_100314873 Ga0068853_1003148731 294
680 3300005563 Ga0068855_100125016 Ga0068855_1001250161 294
681 3300005577 Ga0068857_100010026 Ga0068857_1000100262 294
682 3300005578 Ga0068854_100027116 Ga0068854_1000271165 294
683 3300005614 Ga0068856_100002916 Ga0068856_10000291611 294
684 3300009174 Ga0105241_10131066 Ga0105241_101310662 294
685 3300009545 Ga0105237_10291089 Ga0105237_102910892 294
686 3300013105 Ga0157369_10355325 Ga0157369_103553252 294
687 3300013307 Ga0157372_10045465 Ga0157372_100454653 294
688 3300025242 Ga0209258_100941 Ga0209258_1009417 294
689 3300025246 Ga0209646_1000258 Ga0209646_100025815 294
690 3300025250 Ga0209026_1000011 Ga0209026_1000011443 294
691 3300025253 Ga0209677_100633 Ga0209677_10063320 294
692 3300025256 Ga0209759_1000034 Ga0209759_100003433 294
693 3300025911 Ga0207654_10121201 Ga0207654_101212012 294
694 3300025914 Ga0207671_10036606 Ga0207671_100366062 294
695 3300025919 Ga0207657_10025339 Ga0207657_100253395 294
696 3300025924 Ga0207694_10051260 Ga0207694_100512602 294
697 3300025949 Ga0207667_10260974 Ga0207667_102609742 294
698 3300025981 Ga0207640_10006820 Ga0207640_100068207 294
699 3300026041 Ga0207639_10247393 Ga0207639_102473932 294
700 3300026078 Ga0207702_10002432 Ga0207702_1000243211 294
701 3300026116 Ga0207674_10313003 Ga0207674_103130032 294
702 3300035086 Ga0373934_0031007 Ga0373934_0031007_448_1386 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09916

DUF2145

Uncharacterized protein conserved in bacteria (DUF2145)

53

257

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zqi-assembly1.cif.gz_A alginate lyase algat5 from polysaccharide lyase family 7 0.6712 251 291
6zvz-assembly2.cif.gz_B connectase mj0548 from methanocaldococcus jannaschii 0.6514 255 291
4zqv-assembly1.cif.gz_A cdii immunity protein from yersinia kristensenii 0.6098 254 290
8p5d-assembly1.cif.gz_LM0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.5916 60 114
2zab-assembly1.cif.gz_A crystal structure of family 7 alginate lyase a1-ii' y284f in cmplex with product (ggg) 0.5881 233 291
ID Description Score Start End Superfamily
af_B0S7S0_1030_1200_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8363 255 293 2.60.120.200
af_A0A5S9MNN1_63_201_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7938 256 293 3.80.10.10
af_F1QPX5_1022_1195_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7928 255 294 2.60.120.200
5ik8A02 Mainly Beta;Sandwich;Jelly Rolls; 0.7811 255 293 2.60.120.200
af_A1ZA87_621_795_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7641 252 294 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A2S0MJI5-F1-model_v4 DUF2145 domain-containing protein 0.9731 25 293
AF-A0A521ZX68-F1-model_v4 DUF2145 domain-containing protein 0.972 31 292
AF-A0A1I2PYI2-F1-model_v4 DUF2145 domain-containing protein 0.968 30 293
AF-A0A354IXN4-F1-model_v4 DUF2145 domain-containing protein 0.9638 30 293
AF-A0A431JRI7-F1-model_v4 DUF2145 domain-containing protein 0.9635 31 292

Feature Viewer

pLDDT pTM Quality
85.68 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map