F476242
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 326 | 683 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0016771|Ga0501069_0016771_2458_3462 |
| Length | 334 |
| Sequence | LKSRFLLLGAALWCCAQGADASSAASRFCDAAAPMSARQEDRLLRFAAIVRQELDKSGETVALVARSGVDLGRFGLRYSHAGVSLKASGNTPWSVRQLYYACDEQRPRLYDQGLSGFLFGTGDPDAGYVSIVLLNGADAAALEHAAQDTALALRLLAASYSANAYPFSVSYQNCNQWVAELLAAAWGSLDDAPDLRERAQGWLLKSGYEPTAVDVGSHWLMALAPFVPFMHFDDHPPDDAYALRVRTSLPRAIEAFVHKRLPAAVRIEMCHDGGKAVIHRGWQPIAQGCRPRDGDRVVDLDGRFARSEAPTSSPPPSTDPRRDRCRRCRTALAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 3 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 4 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 5 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 6 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 7 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 8 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 9 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 10 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 11 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 14 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 15 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 16 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 17 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 18 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 177 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 193 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 194 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 195 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 196 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 199 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 200 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 201 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 202 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 321 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 326 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.29 |
| Metatranscriptomes | 0 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.53 |
| Nodule | 0.71 |
| Rhizoplane | 1.28 |
| Rhizosphere | 74.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000149 | 3300002705 | Bacteria | 51819 |
| 2 | JGI25154J39366_1003663 | 3300002738 | Bacteria | 3111 |
| 3 | JGI25157J39369_1000192 | 3300002741 | Bacteria | 51783 |
| 4 | JGI25159J45721_1001772 | 3300002987 | Bacteria | 8671 |
| 5 | JGI25153J46596_10001052 | 3300003215 | Bacteria | 16838 |
| 6 | rootH1_10033226 | 3300003316 | Bacteria | 5688 |
| 7 | rootH2_10018082 | 3300003320 | Bacteria | 11753 |
| 8 | rootL2_10001457 | 3300003322 | Bacteria | 117785 |
| 9 | rootL2_10024434 | 3300003322 | Bacteria | 5116 |
| 10 | rootL2_10046301 | 3300003322 | Bacteria | 4628 |
| 11 | rootL2_10062783 | 3300003322 | Bacteria | 3025 |
| 12 | rootL2_10077657 | 3300003322 | Bacteria | 5306 |
| 13 | rootH1_10013779 | 3300003323 | Bacteria | 5444 |
| 14 | rootH1_10015942 | 3300003323 | Bacteria | 14163 |
| 15 | rootH1_10020465 | 3300003323 | Bacteria | 4161 |
| 16 | rootH1_10099691 | 3300003323 | Bacteria | 3074 |
| 17 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 18 | Ga0055525_1000053 | 3300003759 | Bacteria | 218067 |
| 19 | Ga0055526_1001590 | 3300003771 | Bacteria | 15942 |
| 20 | Ga0055526_1001902 | 3300003771 | Bacteria | 14469 |
| 21 | Ga0055537_1000139 | 3300003773 | Bacteria | 54248 |
| 22 | Ga0055524_1000310 | 3300003775 | Bacteria | 46341 |
| 23 | Ga0055524_1000469 | 3300003775 | Bacteria | 32369 |
| 24 | Ga0055534_1000942 | 3300003784 | Bacteria | 12974 |
| 25 | Ga0055528_1000703 | 3300003790 | Bacteria | 23724 |
| 26 | Ga0055530_10000630 | 3300003791 | Bacteria | 30400 |
| 27 | Ga0055540_1000173 | 3300003792 | Bacteria | 63434 |
| 28 | Ga0055540_1032310 | 3300003792 | Bacteria | 1195 |
| 29 | Ga0055531_10002922 | 3300003794 | Bacteria | 11126 |
| 30 | Ga0055531_10003132 | 3300003794 | Bacteria | 10666 |
| 31 | Ga0055543_1007311 | 3300004625 | Bacteria | 2568 |
| 32 | Ga0065165_1000220 | 3300005262 | Bacteria | 100027 |
| 33 | Ga0065165_1000590 | 3300005262 | Bacteria | 53214 |
| 34 | Ga0065165_1001052 | 3300005262 | Bacteria | 33179 |
| 35 | Ga0065165_1050188 | 3300005262 | Bacteria | 1189 |
| 36 | Ga0065712_10001949 | 3300005290 | Bacteria | 5275 |
| 37 | Ga0065707_10088331 | 3300005295 | Bacteria | 4690 |
| 38 | Ga0070658_10131552 | 3300005327 | Bacteria | 2085 |
| 39 | Ga0070683_100005154 | 3300005329 | Bacteria | 10869 |
| 40 | Ga0070690_100117169 | 3300005330 | Bacteria | 1784 |
| 41 | Ga0068869_100074025 | 3300005334 | Bacteria | 2527 |
| 42 | Ga0070666_10216573 | 3300005335 | Bacteria | 1350 |
| 43 | Ga0070660_100100087 | 3300005339 | Bacteria | 2295 |
| 44 | Ga0070689_100032310 | 3300005340 | Bacteria | 3980 |
| 45 | Ga0070687_100172304 | 3300005343 | Bacteria | 1289 |
| 46 | Ga0070661_100047409 | 3300005344 | Bacteria | 3144 |
| 47 | Ga0070668_100117523 | 3300005347 | Bacteria | 2122 |
| 48 | Ga0070675_100083588 | 3300005354 | Bacteria | 2665 |
| 49 | Ga0070671_100062310 | 3300005355 | Bacteria | 3106 |
| 50 | Ga0070671_100158775 | 3300005355 | Bacteria | 1911 |
| 51 | Ga0070659_100019281 | 3300005366 | Bacteria | 5165 |
| 52 | Ga0070659_100321657 | 3300005366 | Bacteria | 1293 |
| 53 | Ga0070667_100128572 | 3300005367 | Bacteria | 2210 |
| 54 | Ga0070667_100239763 | 3300005367 | Bacteria | 1619 |
| 55 | Ga0070700_100122044 | 3300005441 | Bacteria | 1747 |
| 56 | Ga0070663_100000131 | 3300005455 | Bacteria | 35664 |
| 57 | Ga0070678_100014409 | 3300005456 | Bacteria | 4989 |
| 58 | Ga0070678_100237995 | 3300005456 | Bacteria | 1521 |
| 59 | Ga0070662_100051059 | 3300005457 | Bacteria | 2985 |
| 60 | Ga0070662_100130984 | 3300005457 | Bacteria | 1933 |
| 61 | Ga0068867_100061328 | 3300005459 | Bacteria | 2792 |
| 62 | Ga0068867_100068947 | 3300005459 | Bacteria | 2640 |
| 63 | Ga0068867_100304076 | 3300005459 | Bacteria | 1316 |
| 64 | Ga0070706_100076703 | 3300005467 | Bacteria | 3093 |
| 65 | Ga0070698_100157406 | 3300005471 | Bacteria | 2217 |
| 66 | Ga0070684_100006125 | 3300005535 | Bacteria | 9269 |
| 67 | Ga0070684_100076143 | 3300005535 | Bacteria | 2961 |
| 68 | Ga0068853_100019086 | 3300005539 | Bacteria | 5680 |
| 69 | Ga0068853_100033545 | 3300005539 | Bacteria | 4356 |
| 70 | Ga0068853_100056344 | 3300005539 | Bacteria | 3389 |
| 71 | Ga0068853_100314873 | 3300005539 | Unclassified | 1450 |
| 72 | Ga0070672_100052997 | 3300005543 | Bacteria | 3170 |
| 73 | Ga0070695_100383640 | 3300005545 | Bacteria | 1061 |
| 74 | Ga0070693_100009342 | 3300005547 | Bacteria | 4874 |
| 75 | Ga0068855_100052990 | 3300005563 | Bacteria | 4774 |
| 76 | Ga0068855_100105646 | 3300005563 | Bacteria | 3237 |
| 77 | Ga0068855_100125016 | 3300005563 | Bacteria | 2941 |
| 78 | Ga0070664_100072533 | 3300005564 | Bacteria | 2953 |
| 79 | Ga0070664_100172592 | 3300005564 | Bacteria | 1918 |
| 80 | Ga0070664_100227099 | 3300005564 | Bacteria | 1672 |
| 81 | Ga0070664_100232867 | 3300005564 | Bacteria | 1651 |
| 82 | Ga0068857_100010026 | 3300005577 | Bacteria | 8227 |
| 83 | Ga0068857_100016044 | 3300005577 | Bacteria | 6562 |
| 84 | Ga0068857_100031088 | 3300005577 | Bacteria | 4718 |
| 85 | Ga0068854_100027116 | 3300005578 | Bacteria | 3946 |
| 86 | Ga0068854_100121084 | 3300005578 | Bacteria | 1986 |
| 87 | Ga0068856_100002916 | 3300005614 | Bacteria | 17515 |
| 88 | Ga0068856_100221497 | 3300005614 | Bacteria | 1907 |
| 89 | Ga0068852_100061555 | 3300005616 | Bacteria | 3262 |
| 90 | Ga0068852_100082393 | 3300005616 | Bacteria | 2858 |
| 91 | Ga0068852_100118752 | 3300005616 | Bacteria | 2417 |
| 92 | Ga0068866_10020218 | 3300005718 | Bacteria | 3047 |
| 93 | Ga0068861_100001974 | 3300005719 | Bacteria | 13233 |
| 94 | Ga0068861_100121470 | 3300005719 | Bacteria | 2108 |
| 95 | Ga0068851_10219863 | 3300005834 | Bacteria | 1067 |
| 96 | Ga0068863_100200097 | 3300005841 | Bacteria | 1921 |
| 97 | Ga0068858_100042928 | 3300005842 | Bacteria | 4193 |
| 98 | Ga0068858_100067116 | 3300005842 | Bacteria | 3322 |
| 99 | Ga0068858_100405678 | 3300005842 | Bacteria | 1310 |
| 100 | Ga0068860_100008753 | 3300005843 | Bacteria | 10079 |
| 101 | Ga0068860_100021643 | 3300005843 | Bacteria | 6225 |
| 102 | Ga0068860_100475079 | 3300005843 | Bacteria | 1245 |
| 103 | Ga0068862_100007344 | 3300005844 | Bacteria | 9154 |
| 104 | Ga0068862_100009708 | 3300005844 | Bacteria | 7955 |
| 105 | Ga0068862_100110247 | 3300005844 | Bacteria | 2415 |
| 106 | Ga0075365_10087121 | 3300006038 | Bacteria | 2123 |
| 107 | Ga0075363_100056933 | 3300006048 | Bacteria | 2097 |
| 108 | Ga0075364_10031906 | 3300006051 | Bacteria | 3384 |
| 109 | Ga0075362_10028078 | 3300006177 | Bacteria | 2414 |
| 110 | Ga0075362_10040933 | 3300006177 | Bacteria | 2041 |
| 111 | Ga0075367_10002423 | 3300006178 | Bacteria | 8519 |
| 112 | Ga0075367_10015968 | 3300006178 | Bacteria | 4093 |
| 113 | Ga0075367_10119355 | 3300006178 | Bacteria | 1624 |
| 114 | Ga0075367_10193941 | 3300006178 | Bacteria | 1268 |
| 115 | Ga0075367_10242445 | 3300006178 | Bacteria | 1130 |
| 116 | Ga0075369_10002395 | 3300006186 | Bacteria | 6682 |
| 117 | Ga0075369_10004683 | 3300006186 | Bacteria | 5074 |
| 118 | Ga0075366_10003369 | 3300006195 | Bacteria | 8416 |
| 119 | Ga0075366_10008235 | 3300006195 | Bacteria | 5786 |
| 120 | Ga0075366_10009182 | 3300006195 | Bacteria | 5514 |
| 121 | Ga0075366_10017467 | 3300006195 | Bacteria | 4128 |
| 122 | Ga0075366_10063612 | 3300006195 | Bacteria | 2193 |
| 123 | Ga0075366_10069207 | 3300006195 | Bacteria | 2101 |
| 124 | Ga0075366_10150380 | 3300006195 | Bacteria | 1410 |
| 125 | Ga0075366_10243336 | 3300006195 | Bacteria | 1097 |
| 126 | Ga0097621_100059890 | 3300006237 | Bacteria | 3119 |
| 127 | Ga0075370_10001022 | 3300006353 | Bacteria | 11620 |
| 128 | Ga0075370_10053721 | 3300006353 | Bacteria | 2286 |
| 129 | Ga0075370_10062768 | 3300006353 | Bacteria | 2117 |
| 130 | Ga0075370_10127648 | 3300006353 | Bacteria | 1483 |
| 131 | Ga0068871_100248951 | 3300006358 | Bacteria | 1547 |
| 132 | Ga0075430_100013700 | 3300006846 | Bacteria | 6913 |
| 133 | Ga0075429_100002011 | 3300006880 | Bacteria | 16902 |
| 134 | Ga0068865_100000764 | 3300006881 | Bacteria | 18049 |
| 135 | Ga0099823_1003210 | 3300006944 | Bacteria | 15335 |
| 136 | Ga0079104_1000294 | 3300006946 | Bacteria | 63150 |
| 137 | Ga0105240_10009086 | 3300009093 | Bacteria | 14109 |
| 138 | Ga0105240_10293943 | 3300009093 | Bacteria | 1861 |
| 139 | Ga0105240_10309258 | 3300009093 | Bacteria | 1805 |
| 140 | Ga0105240_10326796 | 3300009093 | Bacteria | 1746 |
| 141 | Ga0105240_10385291 | 3300009093 | Bacteria | 1582 |
| 142 | Ga0105245_10207921 | 3300009098 | Bacteria | 1882 |
| 143 | Ga0105243_10006332 | 3300009148 | Bacteria | 9143 |
| 144 | Ga0105243_10038177 | 3300009148 | Bacteria | 3739 |
| 145 | Ga0105243_10092437 | 3300009148 | Bacteria | 2494 |
| 146 | Ga0105243_10145981 | 3300009148 | Bacteria | 2024 |
| 147 | Ga0105241_10004946 | 3300009174 | Bacteria | 9829 |
| 148 | Ga0105241_10131066 | 3300009174 | Unclassified | 2030 |
| 149 | Ga0105237_10206071 | 3300009545 | Bacteria | 1967 |
| 150 | Ga0105237_10291089 | 3300009545 | Bacteria | 1636 |
| 151 | Ga0105249_10004244 | 3300009553 | Bacteria | 12397 |
| 152 | Ga0105239_10063734 | 3300010375 | Bacteria | 4046 |
| 153 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 154 | Ga0157373_10169567 | 3300013100 | Bacteria | 1536 |
| 155 | Ga0157370_10039074 | 3300013104 | Bacteria | 4587 |
| 156 | Ga0157369_10042581 | 3300013105 | Bacteria | 4952 |
| 157 | Ga0157369_10355325 | 3300013105 | Unclassified | 1522 |
| 158 | Ga0157374_10073653 | 3300013296 | Bacteria | 3223 |
| 159 | Ga0157374_10073775 | 3300013296 | Bacteria | 3221 |
| 160 | Ga0157378_10044552 | 3300013297 | Bacteria | 3940 |
| 161 | Ga0163162_10196908 | 3300013306 | Bacteria | 2144 |
| 162 | Ga0157372_10029653 | 3300013307 | Bacteria | 5976 |
| 163 | Ga0157372_10045465 | 3300013307 | Bacteria | 4871 |
| 164 | Ga0157372_10822322 | 3300013307 | Bacteria | 1079 |
| 165 | Ga0157375_10020187 | 3300013308 | Bacteria | 6080 |
| 166 | Ga0157375_10402742 | 3300013308 | Bacteria | 1535 |
| 167 | Ga0157380_10054801 | 3300014326 | Bacteria | 3166 |
| 168 | Ga0157380_10300365 | 3300014326 | Bacteria | 1479 |
| 169 | Ga0157380_10373623 | 3300014326 | Bacteria | 1343 |
| 170 | Ga0157379_10159338 | 3300014968 | Bacteria | 2037 |
| 171 | Ga0157379_10241863 | 3300014968 | Bacteria | 1637 |
| 172 | Ga0182006_1000129 | 3300015261 | Bacteria | 81237 |
| 173 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 174 | Ga0213872_10000021 | 3300021361 | Bacteria | 158749 |
| 175 | Ga0213872_10126472 | 3300021361 | Bacteria | 1128 |
| 176 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 177 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 178 | Ga0207427_100611 | 3300025231 | Bacteria | 17760 |
| 179 | Ga0209258_100941 | 3300025242 | Bacteria | 14133 |
| 180 | Ga0209258_105576 | 3300025242 | Bacteria | 2106 |
| 181 | Ga0209646_1000258 | 3300025246 | Bacteria | 51783 |
| 182 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 183 | Ga0209677_100633 | 3300025253 | Bacteria | 18825 |
| 184 | Ga0209677_102651 | 3300025253 | Bacteria | 6491 |
| 185 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 186 | Ga0209759_1009391 | 3300025256 | Bacteria | 2959 |
| 187 | Ga0209565_1000055 | 3300025263 | Bacteria | 201184 |
| 188 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 189 | Ga0209673_1013029 | 3300025273 | Bacteria | 3308 |
| 190 | Ga0209673_1026656 | 3300025273 | Bacteria | 1893 |
| 191 | Ga0209130_1000195 | 3300025284 | Bacteria | 83371 |
| 192 | Ga0209675_1000052 | 3300025291 | Bacteria | 201332 |
| 193 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 194 | Ga0209564_1000121 | 3300025295 | Bacteria | 204081 |
| 195 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 196 | Ga0209050_1000529 | 3300025298 | Bacteria | 63410 |
| 197 | Ga0209050_1000916 | 3300025298 | Bacteria | 38869 |
| 198 | Ga0209050_1002907 | 3300025298 | Bacteria | 13459 |
| 199 | Ga0209050_1007394 | 3300025298 | Bacteria | 6172 |
| 200 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 201 | Ga0209256_1000100 | 3300025299 | Bacteria | 201246 |
| 202 | Ga0209256_1000150 | 3300025299 | Bacteria | 146086 |
| 203 | Ga0209256_1000344 | 3300025299 | Bacteria | 75635 |
| 204 | Ga0209051_1000379 | 3300025303 | Bacteria | 63486 |
| 205 | Ga0209051_1000386 | 3300025303 | Bacteria | 62211 |
| 206 | Ga0209051_1002249 | 3300025303 | Bacteria | 14189 |
| 207 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 208 | Ga0209257_1000318 | 3300025304 | Bacteria | 101186 |
| 209 | Ga0209257_1000399 | 3300025304 | Bacteria | 85231 |
| 210 | Ga0207680_10210072 | 3300025903 | Bacteria | 1330 |
| 211 | Ga0207705_10055974 | 3300025909 | Bacteria | 2843 |
| 212 | Ga0207705_10076694 | 3300025909 | Bacteria | 2430 |
| 213 | Ga0207684_10127538 | 3300025910 | Bacteria | 2184 |
| 214 | Ga0207654_10003469 | 3300025911 | Bacteria | 7972 |
| 215 | Ga0207654_10121201 | 3300025911 | Bacteria | 1642 |
| 216 | Ga0207695_10019287 | 3300025913 | Bacteria | 7853 |
| 217 | Ga0207695_10042210 | 3300025913 | Bacteria | 4875 |
| 218 | Ga0207695_10165403 | 3300025913 | Bacteria | 2141 |
| 219 | Ga0207671_10036606 | 3300025914 | Bacteria | 3640 |
| 220 | Ga0207671_10076846 | 3300025914 | Bacteria | 2499 |
| 221 | Ga0207657_10025339 | 3300025919 | Bacteria | 5470 |
| 222 | Ga0207657_10095706 | 3300025919 | Bacteria | 2470 |
| 223 | Ga0207657_10285550 | 3300025919 | Bacteria | 1309 |
| 224 | Ga0207694_10051260 | 3300025924 | Bacteria | 3199 |
| 225 | Ga0207659_10068065 | 3300025926 | Bacteria | 2589 |
| 226 | Ga0207659_10139509 | 3300025926 | Bacteria | 1880 |
| 227 | Ga0207687_10224417 | 3300025927 | Bacteria | 1481 |
| 228 | Ga0207706_10002701 | 3300025933 | Bacteria | 17286 |
| 229 | Ga0207706_10031551 | 3300025933 | Bacteria | 4720 |
| 230 | Ga0207706_10132114 | 3300025933 | Bacteria | 2196 |
| 231 | Ga0207670_10412196 | 3300025936 | Bacteria | 1082 |
| 232 | Ga0207691_10066221 | 3300025940 | Bacteria | 3269 |
| 233 | Ga0207691_10069752 | 3300025940 | Bacteria | 3175 |
| 234 | Ga0207711_10078035 | 3300025941 | Bacteria | 2888 |
| 235 | Ga0207679_10089646 | 3300025945 | Bacteria | 2375 |
| 236 | Ga0207679_10179261 | 3300025945 | Bacteria | 1751 |
| 237 | Ga0207667_10121278 | 3300025949 | Bacteria | 2694 |
| 238 | Ga0207667_10260974 | 3300025949 | Unclassified | 1772 |
| 239 | Ga0207651_10085215 | 3300025960 | Bacteria | 2292 |
| 240 | Ga0207640_10006820 | 3300025981 | Bacteria | 6281 |
| 241 | Ga0207658_10028962 | 3300025986 | Bacteria | 3905 |
| 242 | Ga0207658_10142446 | 3300025986 | Bacteria | 1942 |
| 243 | Ga0207658_10278192 | 3300025986 | Bacteria | 1434 |
| 244 | Ga0207658_10376513 | 3300025986 | Bacteria | 1242 |
| 245 | Ga0207677_10209810 | 3300026023 | Bacteria | 1554 |
| 246 | Ga0207677_10447058 | 3300026023 | Bacteria | 1107 |
| 247 | Ga0207639_10140918 | 3300026041 | Bacteria | 2008 |
| 248 | Ga0207639_10247393 | 3300026041 | Unclassified | 1553 |
| 249 | Ga0207678_10000500 | 3300026067 | Bacteria | 35694 |
| 250 | Ga0207678_10022183 | 3300026067 | Bacteria | 5564 |
| 251 | Ga0207678_10170660 | 3300026067 | Bacteria | 1857 |
| 252 | Ga0207702_10002432 | 3300026078 | Bacteria | 17664 |
| 253 | Ga0207648_10206489 | 3300026089 | Bacteria | 1743 |
| 254 | Ga0207674_10016404 | 3300026116 | Bacteria | 8109 |
| 255 | Ga0207674_10024335 | 3300026116 | Bacteria | 6473 |
| 256 | Ga0207674_10313003 | 3300026116 | Bacteria | 1519 |
| 257 | Ga0207698_10003370 | 3300026142 | Bacteria | 9625 |
| 258 | Ga0207698_10044191 | 3300026142 | Bacteria | 3345 |
| 259 | Ga0207698_10049266 | 3300026142 | Bacteria | 3205 |
| 260 | Ga0207698_10186857 | 3300026142 | Bacteria | 1841 |
| 261 | Ga0209281_1000423 | 3300027111 | Bacteria | 63126 |
| 262 | Ga0209389_1007866 | 3300027296 | Bacteria | 9433 |
| 263 | Ga0209974_10011964 | 3300027876 | Bacteria | 2907 |
| 264 | Ga0268265_10028851 | 3300028380 | Bacteria | 3977 |
| 265 | Ga0268264_10369181 | 3300028381 | Bacteria | 1371 |
| 266 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 267 | Ga0307515_10000494 | 3300028794 | Bacteria | 94354 |
| 268 | Ga0307515_10006133 | 3300028794 | Bacteria | 24177 |
| 269 | Ga0307515_10009239 | 3300028794 | Bacteria | 19087 |
| 270 | Ga0307515_10081051 | 3300028794 | Bacteria | 4221 |
| 271 | Ga0307512_10075120 | 3300030522 | Bacteria | 2475 |
| 272 | Ga0265328_10034260 | 3300031239 | Bacteria | 1880 |
| 273 | Ga0265328_10071574 | 3300031239 | Bacteria | 1274 |
| 274 | Ga0265331_10001748 | 3300031250 | Bacteria | 15614 |
| 275 | Ga0265327_10000143 | 3300031251 | Bacteria | 156870 |
| 276 | Ga0265327_10000407 | 3300031251 | Bacteria | 79425 |
| 277 | Ga0307513_10019112 | 3300031456 | Bacteria | 8166 |
| 278 | Ga0307513_10031815 | 3300031456 | Bacteria | 5965 |
| 279 | Ga0307513_10436228 | 3300031456 | Bacteria | 1037 |
| 280 | Ga0307509_10001361 | 3300031507 | Bacteria | 41386 |
| 281 | Ga0307509_10072227 | 3300031507 | Bacteria | 3596 |
| 282 | Ga0307509_10152689 | 3300031507 | Bacteria | 2221 |
| 283 | Ga0307408_100149218 | 3300031548 | Unclassified | 1844 |
| 284 | Ga0307508_10000096 | 3300031616 | Bacteria | 103730 |
| 285 | Ga0307514_10000330 | 3300031649 | Bacteria | 113231 |
| 286 | Ga0307514_10038352 | 3300031649 | Bacteria | 3789 |
| 287 | Ga0307514_10048470 | 3300031649 | Bacteria | 3309 |
| 288 | Ga0307516_10000677 | 3300031730 | Bacteria | 46191 |
| 289 | Ga0307516_10014241 | 3300031730 | Bacteria | 8424 |
| 290 | Ga0307413_10346740 | 3300031824 | Bacteria | 1144 |
| 291 | Ga0307416_100035688 | 3300032002 | Bacteria | 3801 |
| 292 | Ga0307510_10001484 | 3300033180 | Bacteria | 25882 |
| 293 | Ga0307510_10042584 | 3300033180 | Bacteria | 4946 |
| 294 | Ga0373959_0008059 | 3300034820 | Bacteria | 1783 |
| 295 | Ga0373934_0031007 | 3300035086 | Bacteria | 2092 |
| 296 | Ga0373946_0029993 | 3300035171 | Unclassified | 2169 |
| 297 | Ga0373931_0043075 | 3300035691 | Bacteria | 2375 |
| 298 | Ga0373935_0163467 | 3300035692 | Unclassified | 1519 |
| 299 | Ga0373937_0390033 | 3300036401 | Bacteria | 1321 |
| 300 | Ga0373925_0001650 | 3300037068 | Bacteria | 18812 |
| 301 | Ga0373925_0309674 | 3300037068 | Bacteria | 1276 |
| 302 | Ga0395899_0022687 | 3300037312 | Bacteria | 4754 |
| 303 | Ga0395899_0027162 | 3300037312 | Bacteria | 4317 |
| 304 | Ga0395899_0066414 | 3300037312 | Bacteria | 2648 |
| 305 | Ga0395900_0008081 | 3300037418 | Bacteria | 10830 |
| 306 | Ga0395900_0019362 | 3300037418 | Bacteria | 6943 |
| 307 | Ga0395900_0021938 | 3300037418 | Bacteria | 6528 |
| 308 | Ga0395900_0025270 | 3300037418 | Bacteria | 6080 |
| 309 | Ga0395900_0103129 | 3300037418 | Bacteria | 2930 |
| 310 | Ga0395900_0434367 | 3300037418 | Bacteria | 1271 |
| 311 | Ga0395898_0012097 | 3300037466 | Bacteria | 8937 |
| 312 | Ga0395905_0042900 | 3300037471 | Bacteria | 4244 |
| 313 | Ga0395905_0042976 | 3300037471 | Bacteria | 4240 |
| 314 | Ga0395905_0070807 | 3300037471 | Bacteria | 3268 |
| 315 | Ga0395905_0168013 | 3300037471 | Bacteria | 2061 |
| 316 | Ga0395905_0184217 | 3300037471 | Bacteria | 1960 |
| 317 | Ga0395901_0000103 | 3300038443 | Bacteria | 115060 |
| 318 | Ga0395901_0006663 | 3300038443 | Bacteria | 11673 |
| 319 | Ga0395901_0087498 | 3300038443 | Bacteria | 3257 |
| 320 | Ga0395901_0291755 | 3300038443 | Bacteria | 1692 |
| 321 | Ga0395901_0520509 | 3300038443 | Bacteria | 1208 |
| 322 | Ga0436365_1857266 | 3300039437 | Bacteria | 3268 |
| 323 | Ga0436361_0163583 | 3300039447 | Bacteria | 173204 |
| 324 | Ga0436361_0354255 | 3300039447 | Bacteria | 247479 |
| 325 | Ga0436361_0480843 | 3300039447 | Bacteria | 6796 |
| 326 | Ga0436361_1070932 | 3300039447 | Bacteria | 4602 |
| 327 | Ga0451793_1226599 | 3300041452 | Bacteria | 1657 |
| 328 | Ga0451833_0106143 | 3300041491 | Bacteria | 2235 |
| 329 | Ga0451839_0327417 | 3300041496 | Bacteria | 924 |
| 330 | Ga0451841_0520278 | 3300041498 | Bacteria | 1774 |
| 331 | Ga0451843_1242208 | 3300041509 | Bacteria | 2430 |
| 332 | Ga0439431_0030756 | 3300041997 | Bacteria | 1331 |
| 333 | Ga0439448_0057029 | 3300042005 | Bacteria | 1286 |
| 334 | Ga0439449_0009892 | 3300042007 | Bacteria | 3606 |
| 335 | Ga0439450_006282 | 3300042008 | Bacteria | 2133 |
| 336 | Ga0439455_0041351 | 3300042012 | Bacteria | 1181 |
| 337 | Ga0450919_005657 | 3300042121 | Bacteria | 1495 |
| 338 | Ga0450904_002018 | 3300042139 | Bacteria | 2571 |
| 339 | Ga0439434_0020570 | 3300042435 | Bacteria | 1982 |
| 340 | Ga0450918_000299 | 3300042531 | Bacteria | 11138 |
| 341 | Ga0451577_0001771 | 3300042876 | Bacteria | 27782 |
| 342 | Ga0451577_0003232 | 3300042876 | Bacteria | 18320 |
| 343 | Ga0451577_0061411 | 3300042876 | Bacteria | 3351 |
| 344 | Ga0466969_0000017 | 3300044656 | Bacteria | 103792 |
| 345 | Ga0466969_0002974 | 3300044656 | Bacteria | 9044 |
| 346 | Ga0466969_0012645 | 3300044656 | Bacteria | 4447 |
| 347 | Ga0466969_0053541 | 3300044656 | Bacteria | 1979 |
| 348 | Ga0466972_0000472 | 3300044658 | Bacteria | 20400 |
| 349 | Ga0466965_0001879 | 3300044683 | Bacteria | 8749 |
| 350 | Ga0466965_0012379 | 3300044683 | Bacteria | 4011 |
| 351 | Ga0466965_0032205 | 3300044683 | Bacteria | 2560 |
| 352 | Ga0466965_0089440 | 3300044683 | Bacteria | 1565 |
| 353 | Ga0466966_0000454 | 3300044684 | Bacteria | 26412 |
| 354 | Ga0466966_0007015 | 3300044684 | Bacteria | 7461 |
| 355 | Ga0466966_0013120 | 3300044684 | Bacteria | 5486 |
| 356 | Ga0466966_0019891 | 3300044684 | Bacteria | 4415 |
| 357 | Ga0466966_0098683 | 3300044684 | Bacteria | 1808 |
| 358 | Ga0466966_0136715 | 3300044684 | Bacteria | 1498 |
| 359 | Ga0466961_0000623 | 3300044693 | Bacteria | 22167 |
| 360 | Ga0466961_0165391 | 3300044693 | Bacteria | 1377 |
| 361 | Ga0466961_0221226 | 3300044693 | Bacteria | 1167 |
| 362 | Ga0466963_0062824 | 3300044694 | Bacteria | 2484 |
| 363 | Ga0466963_0073887 | 3300044694 | Bacteria | 2299 |
| 364 | Ga0466964_0006890 | 3300044706 | Bacteria | 4243 |
| 365 | Ga0466964_0008771 | 3300044706 | Bacteria | 3801 |
| 366 | Ga0453684_0009992 | 3300044712 | Bacteria | 16357 |
| 367 | Ga0466971_0033069 | 3300044719 | Bacteria | 2317 |
| 368 | Ga0466970_0017681 | 3300044765 | Bacteria | 3685 |
| 369 | Ga0466957_0000012 | 3300044842 | Bacteria | 72537 |
| 370 | Ga0466957_0003624 | 3300044842 | Bacteria | 8511 |
| 371 | Ga0466957_0019740 | 3300044842 | Bacteria | 3966 |
| 372 | Ga0466957_0024754 | 3300044842 | Bacteria | 3554 |
| 373 | Ga0466959_0000504 | 3300045049 | Bacteria | 22669 |
| 374 | Ga0466959_0021594 | 3300045049 | Bacteria | 4750 |
| 375 | Ga0466959_0026274 | 3300045049 | Bacteria | 4315 |
| 376 | Ga0466959_0050434 | 3300045049 | Bacteria | 3055 |
| 377 | Ga0466959_0055486 | 3300045049 | Bacteria | 2892 |
| 378 | Ga0466959_0262490 | 3300045049 | Bacteria | 1188 |
| 379 | Ga0466958_0017369 | 3300045836 | Bacteria | 4157 |
| 380 | Ga0466958_0313039 | 3300045836 | Bacteria | 1008 |
| 381 | Ga0466967_0011429 | 3300045976 | Bacteria | 6722 |
| 382 | Ga0466967_0023782 | 3300045976 | Bacteria | 5026 |
| 383 | Ga0495617_000001 | 3300046452 | Bacteria | 877032 |
| 384 | Ga0495617_042516 | 3300046452 | Bacteria | 1519 |
| 385 | Ga0495627_000035 | 3300046453 | Bacteria | 213698 |
| 386 | Ga0495627_006791 | 3300046453 | Bacteria | 4453 |
| 387 | Ga0495592_0000495 | 3300046454 | Bacteria | 28713 |
| 388 | Ga0495592_0160334 | 3300046454 | Bacteria | 1548 |
| 389 | Ga0495590_0000829 | 3300046457 | Bacteria | 14000 |
| 390 | Ga0495590_0029076 | 3300046457 | Bacteria | 1938 |
| 391 | Ga0495638_0027065 | 3300046460 | Bacteria | 3714 |
| 392 | Ga0495638_0173660 | 3300046460 | Bacteria | 1235 |
| 393 | Ga0495653_0075781 | 3300046463 | Bacteria | 2502 |
| 394 | Ga0495580_0055947 | 3300046472 | Bacteria | 2778 |
| 395 | Ga0495582_0009564 | 3300046473 | Bacteria | 5338 |
| 396 | Ga0495605_0000039 | 3300046474 | Bacteria | 196802 |
| 397 | Ga0495605_0000173 | 3300046474 | Bacteria | 81369 |
| 398 | Ga0495605_0004874 | 3300046474 | Bacteria | 7843 |
| 399 | Ga0495605_0021091 | 3300046474 | Bacteria | 3455 |
| 400 | Ga0495605_0029882 | 3300046474 | Bacteria | 2798 |
| 401 | Ga0495605_0072912 | 3300046474 | Bacteria | 1618 |
| 402 | Ga0495584_0000476 | 3300046491 | Bacteria | 27527 |
| 403 | Ga0495584_0000890 | 3300046491 | Bacteria | 19181 |
| 404 | Ga0495584_0001772 | 3300046491 | Bacteria | 12564 |
| 405 | Ga0495584_0036188 | 3300046491 | Bacteria | 2494 |
| 406 | Ga0495584_0043820 | 3300046491 | Bacteria | 2258 |
| 407 | Ga0495584_0065331 | 3300046491 | Bacteria | 1830 |
| 408 | Ga0495585_0005156 | 3300046492 | Bacteria | 8296 |
| 409 | Ga0495585_0137863 | 3300046492 | Bacteria | 1279 |
| 410 | Ga0495594_0036988 | 3300046499 | Bacteria | 2663 |
| 411 | Ga0495594_0038400 | 3300046499 | Bacteria | 2614 |
| 412 | Ga0495596_0000269 | 3300046500 | Bacteria | 34417 |
| 413 | Ga0495596_0001084 | 3300046500 | Bacteria | 16113 |
| 414 | Ga0495596_0001261 | 3300046500 | Bacteria | 14662 |
| 415 | Ga0495596_0004074 | 3300046500 | Bacteria | 7195 |
| 416 | Ga0495596_0004356 | 3300046500 | Bacteria | 6919 |
| 417 | Ga0495596_0004374 | 3300046500 | Bacteria | 6899 |
| 418 | Ga0495596_0006717 | 3300046500 | Bacteria | 5265 |
| 419 | Ga0495596_0023514 | 3300046500 | Bacteria | 2499 |
| 420 | Ga0495607_0004567 | 3300046501 | Bacteria | 10152 |
| 421 | Ga0495607_0010751 | 3300046501 | Bacteria | 6129 |
| 422 | Ga0495607_0030964 | 3300046501 | Bacteria | 3278 |
| 423 | Ga0495583_0000266 | 3300046506 | Bacteria | 85810 |
| 424 | Ga0495583_0000318 | 3300046506 | Bacteria | 76178 |
| 425 | Ga0495583_0000341 | 3300046506 | Bacteria | 73548 |
| 426 | Ga0495583_0000372 | 3300046506 | Bacteria | 69750 |
| 427 | Ga0495583_0004482 | 3300046506 | Bacteria | 9978 |
| 428 | Ga0495583_0012841 | 3300046506 | Bacteria | 4712 |
| 429 | Ga0495583_0013030 | 3300046506 | Bacteria | 4665 |
| 430 | Ga0495583_0013304 | 3300046506 | Bacteria | 4597 |
| 431 | Ga0495583_0015225 | 3300046506 | Bacteria | 4193 |
| 432 | Ga0495583_0106535 | 3300046506 | Bacteria | 1191 |
| 433 | Ga0495606_0009759 | 3300046507 | Bacteria | 8072 |
| 434 | Ga0495606_0036330 | 3300046507 | Bacteria | 3356 |
| 435 | Ga0495606_0044259 | 3300046507 | Bacteria | 2962 |
| 436 | Ga0495606_0059265 | 3300046507 | Bacteria | 2456 |
| 437 | Ga0495606_0125610 | 3300046507 | Bacteria | 1530 |
| 438 | Ga0495610_0064218 | 3300046512 | Bacteria | 1736 |
| 439 | Ga0495616_0000037 | 3300046513 | Bacteria | 123624 |
| 440 | Ga0495616_0000335 | 3300046513 | Bacteria | 37189 |
| 441 | Ga0495616_0001334 | 3300046513 | Bacteria | 17245 |
| 442 | Ga0495616_0013555 | 3300046513 | Bacteria | 4593 |
| 443 | Ga0495616_0014825 | 3300046513 | Bacteria | 4350 |
| 444 | Ga0495616_0106189 | 3300046513 | Bacteria | 1310 |
| 445 | Ga0495630_0026460 | 3300046517 | Bacteria | 4295 |
| 446 | Ga0495630_0032744 | 3300046517 | Bacteria | 3875 |
| 447 | Ga0495631_0001676 | 3300046518 | Bacteria | 13178 |
| 448 | Ga0495631_0005281 | 3300046518 | Bacteria | 6786 |
| 449 | Ga0495631_0006938 | 3300046518 | Bacteria | 5803 |
| 450 | Ga0495631_0018214 | 3300046518 | Bacteria | 3309 |
| 451 | Ga0495631_0045508 | 3300046518 | Bacteria | 1932 |
| 452 | Ga0495632_0000119 | 3300046519 | Bacteria | 81170 |
| 453 | Ga0495632_0000126 | 3300046519 | Bacteria | 77591 |
| 454 | Ga0495632_0000375 | 3300046519 | Bacteria | 42575 |
| 455 | Ga0495632_0006812 | 3300046519 | Bacteria | 7292 |
| 456 | Ga0495632_0008489 | 3300046519 | Bacteria | 6296 |
| 457 | Ga0495632_0041990 | 3300046519 | Bacteria | 2294 |
| 458 | Ga0495643_0000247 | 3300046522 | Bacteria | 79969 |
| 459 | Ga0495643_0000567 | 3300046522 | Bacteria | 45722 |
| 460 | Ga0495643_0002950 | 3300046522 | Bacteria | 12886 |
| 461 | Ga0495643_0007380 | 3300046522 | Bacteria | 7102 |
| 462 | Ga0495643_0032176 | 3300046522 | Bacteria | 2913 |
| 463 | Ga0495643_0085656 | 3300046522 | Bacteria | 1633 |
| 464 | Ga0495644_0072205 | 3300046523 | Bacteria | 1297 |
| 465 | Ga0495648_0000138 | 3300046524 | Bacteria | 86438 |
| 466 | Ga0495648_0017008 | 3300046524 | Bacteria | 5219 |
| 467 | Ga0495648_0023039 | 3300046524 | Bacteria | 4272 |
| 468 | Ga0495648_0040159 | 3300046524 | Bacteria | 2970 |
| 469 | Ga0495663_0006800 | 3300046525 | Bacteria | 3154 |
| 470 | Ga0495663_0072673 | 3300046525 | Unclassified | 1097 |
| 471 | Ga0495666_0007333 | 3300046526 | Bacteria | 5528 |
| 472 | Ga0495666_0099395 | 3300046526 | Bacteria | 1371 |
| 473 | Ga0495642_0000009 | 3300046528 | Bacteria | 152645 |
| 474 | Ga0495642_0000069 | 3300046528 | Bacteria | 61616 |
| 475 | Ga0495642_0000779 | 3300046528 | Bacteria | 15514 |
| 476 | Ga0495642_0005384 | 3300046528 | Bacteria | 4910 |
| 477 | Ga0495642_0006396 | 3300046528 | Bacteria | 4517 |
| 478 | Ga0495642_0012064 | 3300046528 | Bacteria | 3330 |
| 479 | Ga0495654_0000668 | 3300046530 | Bacteria | 27040 |
| 480 | Ga0495654_0012640 | 3300046530 | Bacteria | 4533 |
| 481 | Ga0495586_0017741 | 3300046535 | Bacteria | 3787 |
| 482 | Ga0495586_0154398 | 3300046535 | Bacteria | 1292 |
| 483 | Ga0495609_0000486 | 3300046538 | Bacteria | 31853 |
| 484 | Ga0495609_0007848 | 3300046538 | Bacteria | 5280 |
| 485 | Ga0495609_0017809 | 3300046538 | Bacteria | 3296 |
| 486 | Ga0495609_0018939 | 3300046538 | Bacteria | 3188 |
| 487 | Ga0495621_0051631 | 3300046539 | Bacteria | 1472 |
| 488 | Ga0495597_0009698 | 3300046542 | Bacteria | 4744 |
| 489 | Ga0495597_0050552 | 3300046542 | Bacteria | 1834 |
| 490 | Ga0495622_0064984 | 3300046557 | Bacteria | 1687 |
| 491 | Ga0495633_0001734 | 3300046558 | Bacteria | 16299 |
| 492 | Ga0495633_0048808 | 3300046558 | Bacteria | 1998 |
| 493 | Ga0495656_0006795 | 3300046615 | Bacteria | 4022 |
| 494 | Ga0495656_0024835 | 3300046615 | Bacteria | 2371 |
| 495 | Ga0495656_0083674 | 3300046615 | Bacteria | 1445 |
| 496 | Ga0495668_0000035 | 3300046616 | Bacteria | 240241 |
| 497 | Ga0495668_0000800 | 3300046616 | Bacteria | 36258 |
| 498 | Ga0495668_0001462 | 3300046616 | Bacteria | 22723 |
| 499 | Ga0495668_0020512 | 3300046616 | Bacteria | 3802 |
| 500 | Ga0495668_0027111 | 3300046616 | Bacteria | 3246 |
| 501 | Ga0495668_0031486 | 3300046616 | Bacteria | 2989 |
| 502 | Ga0495668_0044464 | 3300046616 | Bacteria | 2468 |
| 503 | Ga0495668_0053322 | 3300046616 | Bacteria | 2236 |
| 504 | Ga0495668_0132518 | 3300046616 | Bacteria | 1364 |
| 505 | Ga0495668_0145448 | 3300046616 | Bacteria | 1297 |
| 506 | Ga0495634_0021142 | 3300046642 | Bacteria | 4604 |
| 507 | Ga0495611_0001110 | 3300046648 | Bacteria | 14172 |
| 508 | Ga0495611_0009857 | 3300046648 | Bacteria | 4041 |
| 509 | Ga0495611_0013522 | 3300046648 | Bacteria | 3476 |
| 510 | Ga0495611_0045048 | 3300046648 | Bacteria | 1975 |
| 511 | Ga0495625_0001970 | 3300046660 | Bacteria | 23171 |
| 512 | Ga0495625_0002034 | 3300046660 | Bacteria | 22774 |
| 513 | Ga0495625_0002718 | 3300046660 | Bacteria | 18765 |
| 514 | Ga0495625_0003794 | 3300046660 | Bacteria | 14641 |
| 515 | Ga0495625_0058662 | 3300046660 | Bacteria | 2734 |
| 516 | Ga0495625_0162895 | 3300046660 | Bacteria | 1493 |
| 517 | Ga0495625_0194632 | 3300046660 | Bacteria | 1341 |
| 518 | Ga0495659_0000007 | 3300046664 | Bacteria | 105393 |
| 519 | Ga0495659_0001196 | 3300046664 | Bacteria | 9010 |
| 520 | Ga0495659_0041396 | 3300046664 | Bacteria | 1645 |
| 521 | Ga0495661_0000461 | 3300046665 | Bacteria | 43183 |
| 522 | Ga0495661_0000560 | 3300046665 | Bacteria | 38438 |
| 523 | Ga0495661_0002737 | 3300046665 | Bacteria | 13416 |
| 524 | Ga0495661_0009241 | 3300046665 | Bacteria | 6774 |
| 525 | Ga0495661_0030930 | 3300046665 | Bacteria | 3403 |
| 526 | Ga0495661_0083165 | 3300046665 | Bacteria | 1841 |
| 527 | Ga0495661_0087985 | 3300046665 | Bacteria | 1774 |
| 528 | Ga0495661_0143138 | 3300046665 | Bacteria | 1298 |
| 529 | Ga0495661_0245979 | 3300046665 | Bacteria | 915 |
| 530 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 531 | Ga0495588_0040764 | 3300046674 | Bacteria | 2369 |
| 532 | Ga0495657_0239327 | 3300046675 | Bacteria | 1096 |
| 533 | Ga0495623_0021707 | 3300046679 | Bacteria | 4146 |
| 534 | Ga0495623_0061342 | 3300046679 | Bacteria | 2359 |
| 535 | Ga0495658_0256722 | 3300046683 | Unclassified | 1100 |
| 536 | Ga0495669_0000094 | 3300046684 | Bacteria | 57198 |
| 537 | Ga0495669_0001761 | 3300046684 | Bacteria | 8838 |
| 538 | Ga0495670_0020963 | 3300046691 | Bacteria | 3222 |
| 539 | Ga0495670_0024900 | 3300046691 | Bacteria | 2958 |
| 540 | Ga0495670_0039787 | 3300046691 | Bacteria | 2345 |
| 541 | Ga0495671_0000047 | 3300046692 | Bacteria | 156459 |
| 542 | Ga0495671_0000089 | 3300046692 | Bacteria | 85775 |
| 543 | Ga0495671_0000715 | 3300046692 | Bacteria | 23970 |
| 544 | Ga0495671_0001120 | 3300046692 | Bacteria | 18493 |
| 545 | Ga0495649_0003092 | 3300046694 | Bacteria | 11388 |
| 546 | Ga0495649_0004491 | 3300046694 | Bacteria | 9105 |
| 547 | Ga0495649_0015623 | 3300046694 | Bacteria | 4316 |
| 548 | Ga0495649_0042146 | 3300046694 | Bacteria | 2494 |
| 549 | Ga0495649_0080528 | 3300046694 | Unclassified | 1741 |
| 550 | Ga0495649_0230341 | 3300046694 | Bacteria | 956 |
| 551 | Ga0495589_0000939 | 3300046794 | Bacteria | 17872 |
| 552 | Ga0495589_0001197 | 3300046794 | Bacteria | 15477 |
| 553 | Ga0495589_0001894 | 3300046794 | Bacteria | 11859 |
| 554 | Ga0495589_0066332 | 3300046794 | Bacteria | 1767 |
| 555 | Ga0495660_0000569 | 3300046810 | Bacteria | 29833 |
| 556 | Ga0495660_0000880 | 3300046810 | Bacteria | 22197 |
| 557 | Ga0495660_0003343 | 3300046810 | Bacteria | 9948 |
| 558 | Ga0495660_0007209 | 3300046810 | Bacteria | 6544 |
| 559 | Ga0495660_0007769 | 3300046810 | Bacteria | 6301 |
| 560 | Ga0495660_0022112 | 3300046810 | Bacteria | 3634 |
| 561 | Ga0495660_0026793 | 3300046810 | Bacteria | 3264 |
| 562 | Ga0495660_0043054 | 3300046810 | Bacteria | 2492 |
| 563 | Ga0495660_0060595 | 3300046810 | Bacteria | 2032 |
| 564 | Ga0495604_0014524 | 3300047317 | Bacteria | 6281 |
| 565 | Ga0495636_0034577 | 3300047318 | Bacteria | 2080 |
| 566 | Ga0495672_0002162 | 3300047320 | Bacteria | 18339 |
| 567 | Ga0495672_0003171 | 3300047320 | Bacteria | 14299 |
| 568 | Ga0495672_0024035 | 3300047320 | Bacteria | 3933 |
| 569 | Ga0495672_0186580 | 3300047320 | Bacteria | 1046 |
| 570 | Ga0495676_0015875 | 3300047321 | Bacteria | 6693 |
| 571 | Ga0495680_0114377 | 3300047322 | Bacteria | 1997 |
| 572 | Ga0495683_0015232 | 3300047323 | Bacteria | 4003 |
| 573 | Ga0495683_0029094 | 3300047323 | Bacteria | 2824 |
| 574 | Ga0495683_0081990 | 3300047323 | Bacteria | 1572 |
| 575 | Ga0495687_000292 | 3300047443 | Bacteria | 65859 |
| 576 | Ga0495687_000646 | 3300047443 | Bacteria | 40020 |
| 577 | Ga0495687_000728 | 3300047443 | Bacteria | 36269 |
| 578 | Ga0495687_000943 | 3300047443 | Bacteria | 30021 |
| 579 | Ga0495687_033256 | 3300047443 | Bacteria | 2341 |
| 580 | Ga0495687_064950 | 3300047443 | Bacteria | 1488 |
| 581 | Ga0495675_0005147 | 3300047444 | Bacteria | 7957 |
| 582 | Ga0495677_0000104 | 3300047445 | Bacteria | 41829 |
| 583 | Ga0495677_0001887 | 3300047445 | Bacteria | 8373 |
| 584 | Ga0495677_0003127 | 3300047445 | Bacteria | 6453 |
| 585 | Ga0495677_0005961 | 3300047445 | Bacteria | 4614 |
| 586 | Ga0495677_0009707 | 3300047445 | Bacteria | 3548 |
| 587 | Ga0495677_0079415 | 3300047445 | Bacteria | 1228 |
| 588 | Ga0495679_005923 | 3300047446 | Bacteria | 5354 |
| 589 | Ga0495679_009721 | 3300047446 | Bacteria | 3827 |
| 590 | Ga0495679_010347 | 3300047446 | Bacteria | 3666 |
| 591 | Ga0495679_017478 | 3300047446 | Bacteria | 2565 |
| 592 | Ga0495681_0000054 | 3300047470 | Bacteria | 106578 |
| 593 | Ga0495681_0000067 | 3300047470 | Bacteria | 97630 |
| 594 | Ga0495681_0001257 | 3300047470 | Bacteria | 19244 |
| 595 | Ga0495681_0001717 | 3300047470 | Bacteria | 16200 |
| 596 | Ga0495681_0002358 | 3300047470 | Bacteria | 13557 |
| 597 | Ga0495681_0026651 | 3300047470 | Bacteria | 3003 |
| 598 | Ga0495686_0000015 | 3300047472 | Bacteria | 471703 |
| 599 | Ga0495686_0000879 | 3300047472 | Bacteria | 38312 |
| 600 | Ga0495686_0007826 | 3300047472 | Bacteria | 7948 |
| 601 | Ga0495593_0086660 | 3300047673 | Bacteria | 1615 |
| 602 | Ga0495615_0002241 | 3300048090 | Bacteria | 3068 |
| 603 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 604 | Ga0495626_0000058 | 3300048091 | Bacteria | 147007 |
| 605 | Ga0495626_0003238 | 3300048091 | Bacteria | 10535 |
| 606 | Ga0495626_0006154 | 3300048091 | Bacteria | 6870 |
| 607 | Ga0495626_0006233 | 3300048091 | Bacteria | 6812 |
| 608 | Ga0495626_0006695 | 3300048091 | Bacteria | 6528 |
| 609 | Ga0495626_0011650 | 3300048091 | Bacteria | 4641 |
| 610 | Ga0495626_0018023 | 3300048091 | Bacteria | 3556 |
| 611 | Ga0495626_0022343 | 3300048091 | Bacteria | 3126 |
| 612 | Ga0495626_0024076 | 3300048091 | Bacteria | 2988 |
| 613 | Ga0495626_0034381 | 3300048091 | Bacteria | 2424 |
| 614 | Ga0495626_0036620 | 3300048091 | Bacteria | 2336 |
| 615 | Ga0495626_0042005 | 3300048091 | Bacteria | 2149 |
| 616 | Ga0496102_0000077 | 3300048905 | Bacteria | 142501 |
| 617 | Ga0496102_0018607 | 3300048905 | Bacteria | 6108 |
| 618 | Ga0496102_0267969 | 3300048905 | Bacteria | 1610 |
| 619 | Ga0496103_0026290 | 3300048906 | Bacteria | 3523 |
| 620 | Ga0496109_0007671 | 3300048912 | Bacteria | 9149 |
| 621 | Ga0496109_0275088 | 3300048912 | Bacteria | 1587 |
| 622 | Ga0496113_0005467 | 3300048916 | Bacteria | 7928 |
| 623 | Ga0496114_0028986 | 3300048917 | Bacteria | 4547 |
| 624 | Ga0496121_0087245 | 3300048924 | Bacteria | 2450 |
| 625 | Ga0496122_0000299 | 3300048925 | Bacteria | 109780 |
| 626 | Ga0496122_0000898 | 3300048925 | Bacteria | 55008 |
| 627 | Ga0496122_0053333 | 3300048925 | Bacteria | 3049 |
| 628 | Ga0496123_0000959 | 3300048926 | Bacteria | 44656 |
| 629 | Ga0496123_0003657 | 3300048926 | Bacteria | 16986 |
| 630 | Ga0496123_0009868 | 3300048926 | Bacteria | 8523 |
| 631 | Ga0496124_0017158 | 3300048927 | Bacteria | 6841 |
| 632 | Ga0496124_0017208 | 3300048927 | Bacteria | 6824 |
| 633 | Ga0496124_0050112 | 3300048927 | Bacteria | 3559 |
| 634 | Ga0496124_0057375 | 3300048927 | Bacteria | 3281 |
| 635 | Ga0496124_0199895 | 3300048927 | Bacteria | 1521 |
| 636 | Ga0496125_0000520 | 3300048928 | Bacteria | 66776 |
| 637 | Ga0496126_0361791 | 3300048929 | Bacteria | 1185 |
| 638 | Ga0495678_000122 | 3300049459 | Bacteria | 91100 |
| 639 | Ga0495678_000140 | 3300049459 | Bacteria | 86985 |
| 640 | Ga0495678_004136 | 3300049459 | Bacteria | 8578 |
| 641 | Ga0495678_013402 | 3300049459 | Bacteria | 3852 |
| 642 | Ga0495682_0000645 | 3300049460 | Bacteria | 23294 |
| 643 | Ga0495682_0005882 | 3300049460 | Bacteria | 5035 |
| 644 | Ga0495682_0006654 | 3300049460 | Bacteria | 4670 |
| 645 | Ga0501047_0220534 | 3300049581 | Bacteria | 1753 |
| 646 | Ga0501069_0016771 | 3300049585 | Bacteria | 3935 |
| 647 | Ga0501070_0006049 | 3300049586 | Bacteria | 10307 |
| 648 | Ga0501073_0004816 | 3300049589 | Bacteria | 10128 |
| 649 | Ga0501074_0009715 | 3300049590 | Bacteria | 6987 |
| 650 | Ga0501222_005869 | 3300049662 | Bacteria | 1652 |
| 651 | Ga0501079_0037924 | 3300049741 | Bacteria | 3716 |
| 652 | Ga0501080_0029064 | 3300049742 | Bacteria | 5145 |
| 653 | Ga0501083_0006267 | 3300049744 | Bacteria | 8441 |
| 654 | Ga0501035_0015080 | 3300049822 | Bacteria | 7130 |
| 655 | Ga0501035_0020112 | 3300049822 | Bacteria | 6132 |
| 656 | Ga0501035_0179098 | 3300049822 | Bacteria | 1827 |
| 657 | Ga0501044_0058899 | 3300049823 | Bacteria | 3937 |
| 658 | Ga0501044_0063301 | 3300049823 | Bacteria | 3780 |
| 659 | nmdc:mga03683_6812_c1 | 3300050489 | Bacteria | 3933 |
| 660 | nmdc:mga00v17_59262_c1 | 3300050491 | Bacteria | 2348 |
| 661 | nmdc:mga00v17_99051_c1 | 3300050491 | Bacteria | 1838 |
| 662 | nmdc:mga0yw44_17751_c1 | 3300050492 | Bacteria | 3880 |
| 663 | nmdc:mga0k408_10619_c1 | 3300050493 | Bacteria | 4986 |
| 664 | nmdc:mga0k408_23089_c1 | 3300050493 | Bacteria | 3506 |
| 665 | nmdc:mga0k408_26854_c1 | 3300050493 | Bacteria | 3266 |
| 666 | nmdc:mga0k408_40455_c1 | 3300050493 | Unclassified | 2682 |
| 667 | nmdc:mga0k408_49669_c1 | 3300050493 | Bacteria | 2428 |
| 668 | nmdc:mga0k408_639_c1 | 3300050493 | Bacteria | 19312 |
| 669 | nmdc:mga0k408_7743_c1 | 3300050493 | Bacteria | 5743 |
| 670 | nmdc:mga0k408_96282_c1 | 3300050493 | Bacteria | 1742 |
| 671 | nmdc:mga06z11_12042_c1 | 3300050494 | Bacteria | 3750 |
| 672 | nmdc:mga07m45_94776_c1 | 3300050496 | Bacteria | 1712 |
| 673 | nmdc:mga05p37_224370_c1 | 3300050507 | Bacteria | 2266 |
| 674 | nmdc:mga09592_27696_c1 | 3300050508 | Bacteria | 4705 |
| 675 | nmdc:mga0qj67_12358_c1 | 3300050509 | Bacteria | 6431 |
| 676 | nmdc:mga0sz30_15062_c1 | 3300050516 | Bacteria | 3052 |
| 677 | nmdc:mga0sz30_38075_c1 | 3300050516 | Bacteria | 2015 |
| 678 | Ga0500593_000267 | 3300053117 | Bacteria | 21261 |
| 679 | Ga0500658_0007750 | 3300053134 | Bacteria | 3966 |
| 680 | Ga0500590_007156 | 3300053148 | Bacteria | 5490 |
| 681 | Ga0500622_0020625 | 3300053156 | Bacteria | 3500 |
| 682 | Ga0501084_0010239 | 3300054114 | Bacteria | 7758 |
| 683 | Ga0466962_0133975 | 3300061719 | Bacteria | 1198 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003316 | rootH1_10033226 | rootH1_100332263 | 246 |
| 2 | 3300047470 | Ga0495681_0000054 | Ga0495681_0000054_81451_82365 | 248 |
| 3 | 3300005295 | Ga0065707_10088331 | Ga0065707_100883313 | 253 |
| 4 | 3300005347 | Ga0070668_100117523 | Ga0070668_1001175232 | 253 |
| 5 | 3300005367 | Ga0070667_100128572 | Ga0070667_1001285723 | 253 |
| 6 | 3300005441 | Ga0070700_100122044 | Ga0070700_1001220443 | 253 |
| 7 | 3300005456 | Ga0070678_100237995 | Ga0070678_1002379952 | 253 |
| 8 | 3300005459 | Ga0068867_100068947 | Ga0068867_1000689473 | 253 |
| 9 | 3300005616 | Ga0068852_100118752 | Ga0068852_1001187522 | 253 |
| 10 | 3300005718 | Ga0068866_10020218 | Ga0068866_100202184 | 253 |
| 11 | 3300005719 | Ga0068861_100001974 | Ga0068861_1000019746 | 253 |
| 12 | 3300005842 | Ga0068858_100042928 | Ga0068858_1000429284 | 253 |
| 13 | 3300005843 | Ga0068860_100008753 | Ga0068860_1000087538 | 253 |
| 14 | 3300005844 | Ga0068862_100007344 | Ga0068862_1000073448 | 253 |
| 15 | 3300006195 | Ga0075366_10009182 | Ga0075366_100091827 | 253 |
| 16 | 3300006881 | Ga0068865_100000764 | Ga0068865_10000076410 | 253 |
| 17 | 3300009148 | Ga0105243_10038177 | Ga0105243_100381773 | 253 |
| 18 | 3300009553 | Ga0105249_10004244 | Ga0105249_100042448 | 253 |
| 19 | 3300013297 | Ga0157378_10044552 | Ga0157378_100445523 | 253 |
| 20 | 3300013308 | Ga0157375_10020187 | Ga0157375_100201872 | 253 |
| 21 | 3300014326 | Ga0157380_10054801 | Ga0157380_100548012 | 253 |
| 22 | 3300031456 | Ga0307513_10436228 | Ga0307513_104362281 | 253 |
| 23 | iso_pu_bacteria | 2585428062 | 2587756672 | 254 |
| 24 | 3300005290 | Ga0065712_10001949 | Ga0065712_100019497 | 255 |
| 25 | 3300005354 | Ga0070675_100083588 | Ga0070675_1000835884 | 255 |
| 26 | 3300005563 | Ga0068855_100052990 | Ga0068855_1000529905 | 255 |
| 27 | 3300013104 | Ga0157370_10039074 | Ga0157370_100390743 | 255 |
| 28 | 3300025913 | Ga0207695_10019287 | Ga0207695_100192876 | 255 |
| 29 | 3300025926 | Ga0207659_10068065 | Ga0207659_100680652 | 255 |
| 30 | 3300026023 | Ga0207677_10209810 | Ga0207677_102098102 | 255 |
| 31 | 3300026142 | Ga0207698_10003370 | Ga0207698_1000337010 | 255 |
| 32 | 3300046539 | Ga0495621_0051631 | Ga0495621_0051631_274_1122 | 255 |
| 33 | 3300046463 | Ga0495653_0075781 | Ga0495653_0075781_11_865 | 257 |
| 34 | 3300006178 | Ga0075367_10242445 | Ga0075367_102424451 | 258 |
| 35 | 3300028794 | Ga0307515_10000494 | Ga0307515_1000049425 | 258 |
| 36 | 3300028794 | Ga0307515_10006133 | Ga0307515_1000613316 | 258 |
| 37 | 3300028794 | Ga0307515_10009239 | Ga0307515_1000923916 | 258 |
| 38 | 3300030522 | Ga0307512_10075120 | Ga0307512_100751203 | 258 |
| 39 | 3300031456 | Ga0307513_10019112 | Ga0307513_100191125 | 258 |
| 40 | 3300031456 | Ga0307513_10031815 | Ga0307513_100318158 | 258 |
| 41 | 3300031507 | Ga0307509_10072227 | Ga0307509_100722274 | 258 |
| 42 | 3300031616 | Ga0307508_10000096 | Ga0307508_1000009634 | 258 |
| 43 | 3300031730 | Ga0307516_10014241 | Ga0307516_100142416 | 258 |
| 44 | 3300041496 | Ga0451839_0327417 | Ga0451839_0327417_60_893 | 258 |
| 45 | 3300046694 | Ga0495649_0230341 | Ga0495649_0230341_35_850 | 259 |
| 46 | 3300005456 | Ga0070678_100014409 | Ga0070678_1000144094 | 260 |
| 47 | 3300048091 | Ga0495626_0000004 | Ga0495626_0000004_64074_65027 | 260 |
| 48 | 3300025910 | Ga0207684_10127538 | Ga0207684_101275382 | 261 |
| 49 | 3300003322 | rootL2_10077657 | rootL2_100776574 | 262 |
| 50 | 3300031507 | Ga0307509_10152689 | Ga0307509_101526892 | 262 |
| 51 | 3300032002 | Ga0307416_100035688 | Ga0307416_1000356882 | 262 |
| 52 | 3300046683 | Ga0495658_0256722 | Ga0495658_0256722_33_863 | 262 |
| 53 | 3300046500 | Ga0495596_0001084 | Ga0495596_0001084_15221_16066 | 263 |
| 54 | 3300046665 | Ga0495661_0245979 | Ga0495661_0245979_13_846 | 263 |
| 55 | 3300047445 | Ga0495677_0079415 | Ga0495677_0079415_41_892 | 263 |
| 56 | 3300005539 | Ga0068853_100056344 | Ga0068853_1000563443 | 264 |
| 57 | 3300031824 | Ga0307413_10346740 | Ga0307413_103467402 | 264 |
| 58 | 3300047322 | Ga0495680_0114377 | Ga0495680_0114377_1008_1916 | 264 |
| 59 | 3300005457 | Ga0070662_100130984 | Ga0070662_1001309842 | 266 |
| 60 | 3300025933 | Ga0207706_10002701 | Ga0207706_1000270118 | 266 |
| 61 | 3300026142 | Ga0207698_10049266 | Ga0207698_100492661 | 266 |
| 62 | 3300048906 | Ga0496103_0026290 | Ga0496103_0026290_749_1669 | 268 |
| 63 | 3300044658 | Ga0466972_0000472 | Ga0466972_0000472_3631_4539 | 269 |
| 64 | 3300044842 | Ga0466957_0019740 | Ga0466957_0019740_2112_3071 | 269 |
| 65 | 3300048905 | Ga0496102_0018607 | Ga0496102_0018607_3141_4061 | 269 |
| 66 | 3300048912 | Ga0496109_0275088 | Ga0496109_0275088_613_1539 | 269 |
| 67 | 3300006178 | Ga0075367_10119355 | Ga0075367_101193552 | 270 |
| 68 | 3300046616 | Ga0495668_0053322 | Ga0495668_0053322_676_1569 | 270 |
| 69 | 3300050493 | nmdc:mga0k408_23089_c1 | nmdc:mga0k408_23089_c1_301_1161 | 270 |
| 70 | 3300025273 | Ga0209673_1013029 | Ga0209673_10130292 | 271 |
| 71 | 3300025295 | Ga0209564_1000003 | Ga0209564_100000372 | 271 |
| 72 | iso_pu_bacteria | 2643221645 | 2644249180 | 271 |
| 73 | iso_pu_bacteria | 2643221664 | 2644355892 | 271 |
| 74 | 3300003759 | Ga0055525_1000053 | Ga0055525_100005317 | 272 |
| 75 | 3300003771 | Ga0055526_1001590 | Ga0055526_100159010 | 272 |
| 76 | 3300006195 | Ga0075366_10008235 | Ga0075366_100082352 | 272 |
| 77 | 3300025230 | Ga0209563_100014 | Ga0209563_100014681 | 272 |
| 78 | 3300050493 | nmdc:mga0k408_40455_c1 | nmdc:mga0k408_40455_c1_899_1804 | 272 |
| 79 | 3300050493 | nmdc:mga0k408_639_c1 | nmdc:mga0k408_639_c1_16703_17611 | 272 |
| 80 | 3300003775 | Ga0055524_1000310 | Ga0055524_100031044 | 273 |
| 81 | 3300003794 | Ga0055531_10002922 | Ga0055531_100029225 | 273 |
| 82 | 3300012497 | Ga0157319_1000003 | Ga0157319_100000390 | 273 |
| 83 | 3300014326 | Ga0157380_10300365 | Ga0157380_103003652 | 273 |
| 84 | 3300025299 | Ga0209256_1000150 | Ga0209256_100015045 | 273 |
| 85 | 3300025304 | Ga0209257_1000318 | Ga0209257_100031850 | 273 |
| 86 | 3300046660 | Ga0495625_0002718 | Ga0495625_0002718_16104_17069 | 273 |
| 87 | 3300005335 | Ga0070666_10216573 | Ga0070666_102165731 | 274 |
| 88 | 3300005343 | Ga0070687_100172304 | Ga0070687_1001723041 | 274 |
| 89 | 3300005367 | Ga0070667_100239763 | Ga0070667_1002397632 | 274 |
| 90 | 3300005459 | Ga0068867_100061328 | Ga0068867_1000613283 | 274 |
| 91 | 3300005543 | Ga0070672_100052997 | Ga0070672_1000529972 | 274 |
| 92 | 3300005616 | Ga0068852_100061555 | Ga0068852_1000615552 | 274 |
| 93 | 3300005842 | Ga0068858_100067116 | Ga0068858_1000671164 | 274 |
| 94 | 3300005843 | Ga0068860_100021643 | Ga0068860_1000216437 | 274 |
| 95 | 3300013306 | Ga0163162_10196908 | Ga0163162_101969082 | 274 |
| 96 | 3300013308 | Ga0157375_10402742 | Ga0157375_104027422 | 274 |
| 97 | 3300025256 | Ga0209759_1009391 | Ga0209759_10093913 | 274 |
| 98 | 3300025903 | Ga0207680_10210072 | Ga0207680_102100722 | 274 |
| 99 | 3300025940 | Ga0207691_10066221 | Ga0207691_100662212 | 274 |
| 100 | 3300025941 | Ga0207711_10078035 | Ga0207711_100780351 | 274 |
| 101 | 3300025986 | Ga0207658_10376513 | Ga0207658_103765131 | 274 |
| 102 | 3300026041 | Ga0207639_10140918 | Ga0207639_101409182 | 274 |
| 103 | 3300026142 | Ga0207698_10044191 | Ga0207698_100441914 | 274 |
| 104 | 3300046454 | Ga0495592_0160334 | Ga0495592_0160334_214_1086 | 274 |
| 105 | 3300046491 | Ga0495584_0065331 | Ga0495584_0065331_927_1820 | 274 |
| 106 | 3300046506 | Ga0495583_0013030 | Ga0495583_0013030_2289_3230 | 274 |
| 107 | 3300046507 | Ga0495606_0044259 | Ga0495606_0044259_622_1503 | 274 |
| 108 | 3300048905 | Ga0496102_0000077 | Ga0496102_0000077_133186_134094 | 274 |
| 109 | 3300053148 | Ga0500590_007156 | Ga0500590_007156_1032_1904 | 274 |
| 110 | 3300003322 | rootL2_10062783 | rootL2_100627833 | 275 |
| 111 | 3300005455 | Ga0070663_100000131 | Ga0070663_1000001312 | 275 |
| 112 | 3300005471 | Ga0070698_100157406 | Ga0070698_1001574063 | 275 |
| 113 | 3300005545 | Ga0070695_100383640 | Ga0070695_1003836401 | 275 |
| 114 | 3300006195 | Ga0075366_10069207 | Ga0075366_100692073 | 275 |
| 115 | 3300021361 | Ga0213872_10000021 | Ga0213872_1000002122 | 275 |
| 116 | 3300026067 | Ga0207678_10000500 | Ga0207678_100005001 | 275 |
| 117 | 3300039447 | Ga0436361_0354255 | Ga0436361_0354255_223761_224624 | 275 |
| 118 | 3300042012 | Ga0439455_0041351 | Ga0439455_0041351_291_1160 | 275 |
| 119 | 3300042121 | Ga0450919_005657 | Ga0450919_005657_518_1414 | 275 |
| 120 | 3300042435 | Ga0439434_0020570 | Ga0439434_0020570_906_1802 | 275 |
| 121 | 3300042531 | Ga0450918_000299 | Ga0450918_000299_2725_3621 | 275 |
| 122 | 3300042876 | Ga0451577_0001771 | Ga0451577_0001771_14835_15743 | 275 |
| 123 | 3300044656 | Ga0466969_0012645 | Ga0466969_0012645_3160_4101 | 275 |
| 124 | 3300044683 | Ga0466965_0001879 | Ga0466965_0001879_1139_2080 | 275 |
| 125 | 3300044719 | Ga0466971_0033069 | Ga0466971_0033069_917_1858 | 275 |
| 126 | 3300044765 | Ga0466970_0017681 | Ga0466970_0017681_2649_3590 | 275 |
| 127 | 3300044842 | Ga0466957_0024754 | Ga0466957_0024754_1804_2745 | 275 |
| 128 | 3300045049 | Ga0466959_0026274 | Ga0466959_0026274_1223_2164 | 275 |
| 129 | 3300045836 | Ga0466958_0313039 | Ga0466958_0313039_56_997 | 275 |
| 130 | 3300046506 | Ga0495583_0000318 | Ga0495583_0000318_53092_53985 | 275 |
| 131 | 3300046524 | Ga0495648_0023039 | Ga0495648_0023039_898_1806 | 275 |
| 132 | iso_pu_bacteria | 2643221644 | 2644248353 | 275 |
| 133 | 3300006038 | Ga0075365_10087121 | Ga0075365_100871212 | 276 |
| 134 | 3300006177 | Ga0075362_10028078 | Ga0075362_100280783 | 276 |
| 135 | 3300006178 | Ga0075367_10002423 | Ga0075367_100024236 | 276 |
| 136 | 3300006186 | Ga0075369_10004683 | Ga0075369_100046834 | 276 |
| 137 | 3300006353 | Ga0075370_10053721 | Ga0075370_100537213 | 276 |
| 138 | 3300006946 | Ga0079104_1000294 | Ga0079104_100029425 | 276 |
| 139 | 3300027111 | Ga0209281_1000423 | Ga0209281_100042329 | 276 |
| 140 | 3300039447 | Ga0436361_1070932 | Ga0436361_1070932_3225_4151 | 276 |
| 141 | 3300046522 | Ga0495643_0085656 | Ga0495643_0085656_105_1022 | 276 |
| 142 | 3300046525 | Ga0495663_0006800 | Ga0495663_0006800_559_1461 | 276 |
| 143 | 3300046615 | Ga0495656_0083674 | Ga0495656_0083674_447_1349 | 276 |
| 144 | 3300046664 | Ga0495659_0041396 | Ga0495659_0041396_578_1495 | 276 |
| 145 | 3300046674 | Ga0495588_0040764 | Ga0495588_0040764_1340_2257 | 276 |
| 146 | 3300046675 | Ga0495657_0239327 | Ga0495657_0239327_29_910 | 276 |
| 147 | 3300048090 | Ga0495615_0002241 | Ga0495615_0002241_288_1190 | 276 |
| 148 | 3300050489 | nmdc:mga03683_6812_c1 | nmdc:mga03683_6812_c1_1861_2751 | 276 |
| 149 | 3300050491 | nmdc:mga00v17_99051_c1 | nmdc:mga00v17_99051_c1_909_1799 | 276 |
| 150 | 3300050492 | nmdc:mga0yw44_17751_c1 | nmdc:mga0yw44_17751_c1_458_1348 | 276 |
| 151 | 3300050493 | nmdc:mga0k408_26854_c1 | nmdc:mga0k408_26854_c1_1152_2042 | 276 |
| 152 | 3300050494 | nmdc:mga06z11_12042_c1 | nmdc:mga06z11_12042_c1_1309_2199 | 276 |
| 153 | 3300050516 | nmdc:mga0sz30_38075_c1 | nmdc:mga0sz30_38075_c1_349_1239 | 276 |
| 154 | iso_pu_bacteria | 2738541277 | 2738722962 | 276 |
| 155 | iso_pu_bacteria | 2738543019 | 2739283533 | 276 |
| 156 | 3300005844 | Ga0068862_100110247 | Ga0068862_1001102472 | 277 |
| 157 | 3300025298 | Ga0209050_1007394 | Ga0209050_10073942 | 277 |
| 158 | 3300026089 | Ga0207648_10206489 | Ga0207648_102064892 | 277 |
| 159 | 3300046453 | Ga0495627_006791 | Ga0495627_006791_60_989 | 277 |
| 160 | iso_pu_bacteria | 2738541280 | 2738740608 | 277 |
| 161 | iso_pu_bacteria | 2738541300 | 2738844930 | 277 |
| 162 | iso_pu_bacteria | 2738543018 | 2739277345 | 277 |
| 163 | iso_pu_bacteria | 2738543030 | 2739346388 | 277 |
| 164 | 3300003323 | rootH1_10099691 | rootH1_100996912 | 278 |
| 165 | 3300031239 | Ga0265328_10071574 | Ga0265328_100715742 | 278 |
| 166 | 3300031250 | Ga0265331_10001748 | Ga0265331_1000174814 | 278 |
| 167 | 3300031251 | Ga0265327_10000407 | Ga0265327_1000040739 | 278 |
| 168 | 3300037471 | Ga0395905_0042900 | Ga0395905_0042900_3257_4162 | 278 |
| 169 | 3300046691 | Ga0495670_0039787 | Ga0495670_0039787_1044_2009 | 278 |
| 170 | 3300053156 | Ga0500622_0020625 | Ga0500622_0020625_294_1259 | 278 |
| 171 | 3300003323 | rootH1_10015942 | rootH1_100159428 | 279 |
| 172 | 3300003794 | Ga0055531_10003132 | Ga0055531_100031325 | 279 |
| 173 | 3300006353 | Ga0075370_10127648 | Ga0075370_101276483 | 279 |
| 174 | 3300006944 | Ga0099823_1003210 | Ga0099823_100321010 | 279 |
| 175 | 3300021361 | Ga0213872_10126472 | Ga0213872_101264722 | 279 |
| 176 | 3300025242 | Ga0209258_105576 | Ga0209258_1055762 | 279 |
| 177 | 3300025298 | Ga0209050_1002907 | Ga0209050_10029079 | 279 |
| 178 | 3300025299 | Ga0209256_1000344 | Ga0209256_100034444 | 279 |
| 179 | 3300025303 | Ga0209051_1000386 | Ga0209051_100038637 | 279 |
| 180 | 3300025304 | Ga0209257_1000399 | Ga0209257_100039929 | 279 |
| 181 | 3300027296 | Ga0209389_1007866 | Ga0209389_10078666 | 279 |
| 182 | 3300048927 | Ga0496124_0017208 | Ga0496124_0017208_444_1352 | 279 |
| 183 | 3300050493 | nmdc:mga0k408_7743_c1 | nmdc:mga0k408_7743_c1_4385_5317 | 279 |
| 184 | 3300005467 | Ga0070706_100076703 | Ga0070706_1000767033 | 280 |
| 185 | 3300005719 | Ga0068861_100121470 | Ga0068861_1001214701 | 280 |
| 186 | 3300005844 | Ga0068862_100009708 | Ga0068862_1000097083 | 280 |
| 187 | 3300028380 | Ga0268265_10028851 | Ga0268265_100288513 | 280 |
| 188 | 3300028794 | Ga0307515_10000030 | Ga0307515_10000030105 | 280 |
| 189 | 3300044683 | Ga0466965_0089440 | Ga0466965_0089440_321_1220 | 280 |
| 190 | 3300046507 | Ga0495606_0036330 | Ga0495606_0036330_1841_2761 | 280 |
| 191 | 3300046507 | Ga0495606_0125610 | Ga0495606_0125610_14_925 | 280 |
| 192 | 3300046530 | Ga0495654_0012640 | Ga0495654_0012640_1775_2686 | 280 |
| 193 | 3300046542 | Ga0495597_0050552 | Ga0495597_0050552_379_1290 | 280 |
| 194 | 3300046660 | Ga0495625_0003794 | Ga0495625_0003794_2479_3390 | 280 |
| 195 | 3300046664 | Ga0495659_0000007 | Ga0495659_0000007_63302_64213 | 280 |
| 196 | 3300046692 | Ga0495671_0000089 | Ga0495671_0000089_56461_57372 | 280 |
| 197 | 3300046810 | Ga0495660_0000569 | Ga0495660_0000569_9027_9947 | 280 |
| 198 | 3300046810 | Ga0495660_0060595 | Ga0495660_0060595_545_1456 | 280 |
| 199 | 3300047320 | Ga0495672_0002162 | Ga0495672_0002162_17137_18048 | 280 |
| 200 | 3300047472 | Ga0495686_0007826 | Ga0495686_0007826_1507_2427 | 280 |
| 201 | 3300047673 | Ga0495593_0086660 | Ga0495593_0086660_548_1474 | 280 |
| 202 | iso_pu_bacteria | 2831864461 | 2831866822 | 280 |
| 203 | 3300005262 | Ga0065165_1000220 | Ga0065165_100022010 | 281 |
| 204 | 3300006195 | Ga0075366_10017467 | Ga0075366_100174672 | 281 |
| 205 | 3300009148 | Ga0105243_10092437 | Ga0105243_100924372 | 281 |
| 206 | 3300014326 | Ga0157380_10373623 | Ga0157380_103736231 | 281 |
| 207 | 3300031649 | Ga0307514_10000330 | Ga0307514_1000033091 | 281 |
| 208 | 3300031649 | Ga0307514_10038352 | Ga0307514_100383525 | 281 |
| 209 | 3300035171 | Ga0373946_0029993 | Ga0373946_0029993_136_1059 | 281 |
| 210 | 3300035692 | Ga0373935_0163467 | Ga0373935_0163467_558_1481 | 281 |
| 211 | 3300037068 | Ga0373925_0309674 | Ga0373925_0309674_138_1040 | 281 |
| 212 | 3300041452 | Ga0451793_1226599 | Ga0451793_1226599_261_1187 | 281 |
| 213 | 3300041491 | Ga0451833_0106143 | Ga0451833_0106143_90_1016 | 281 |
| 214 | 3300041498 | Ga0451841_0520278 | Ga0451841_0520278_266_1192 | 281 |
| 215 | 3300041509 | Ga0451843_1242208 | Ga0451843_1242208_372_1298 | 281 |
| 216 | 3300044684 | Ga0466966_0000454 | Ga0466966_0000454_12468_13409 | 281 |
| 217 | 3300044712 | Ga0453684_0009992 | Ga0453684_0009992_7102_7992 | 281 |
| 218 | 3300046512 | Ga0495610_0064218 | Ga0495610_0064218_272_1198 | 281 |
| 219 | 3300046519 | Ga0495632_0041990 | Ga0495632_0041990_247_1173 | 281 |
| 220 | 3300046526 | Ga0495666_0099395 | Ga0495666_0099395_78_980 | 281 |
| 221 | 3300046535 | Ga0495586_0017741 | Ga0495586_0017741_1666_2568 | 281 |
| 222 | 3300046660 | Ga0495625_0002034 | Ga0495625_0002034_17924_18850 | 281 |
| 223 | 3300046660 | Ga0495625_0194632 | Ga0495625_0194632_347_1273 | 281 |
| 224 | 3300047443 | Ga0495687_064950 | Ga0495687_064950_502_1377 | 281 |
| 225 | 3300050493 | nmdc:mga0k408_49669_c1 | nmdc:mga0k408_49669_c1_837_1742 | 281 |
| 226 | iso_pu_bacteria | 2643221556 | 2643797085 | 281 |
| 227 | iso_pu_bacteria | 2643221660 | 2644341264 | 281 |
| 228 | iso_pu_bacteria | 2643221684 | 2644469811 | 281 |
| 229 | iso_pu_bacteria | 8047673197 | 8047676629 | 281 |
| 230 | 3300005564 | Ga0070664_100072533 | Ga0070664_1000725331 | 282 |
| 231 | 3300006178 | Ga0075367_10193941 | Ga0075367_101939412 | 282 |
| 232 | 3300014968 | Ga0157379_10241863 | Ga0157379_102418632 | 282 |
| 233 | 3300025298 | Ga0209050_1000529 | Ga0209050_100052954 | 282 |
| 234 | 3300025945 | Ga0207679_10089646 | Ga0207679_100896462 | 282 |
| 235 | 3300027876 | Ga0209974_10011964 | Ga0209974_100119642 | 282 |
| 236 | 3300031239 | Ga0265328_10034260 | Ga0265328_100342603 | 282 |
| 237 | 3300031251 | Ga0265327_10000143 | Ga0265327_1000014358 | 282 |
| 238 | 3300037068 | Ga0373925_0001650 | Ga0373925_0001650_4550_5455 | 282 |
| 239 | 3300037471 | Ga0395905_0184217 | Ga0395905_0184217_794_1702 | 282 |
| 240 | 3300044656 | Ga0466969_0000017 | Ga0466969_0000017_51720_52637 | 282 |
| 241 | 3300044684 | Ga0466966_0013120 | Ga0466966_0013120_1807_2724 | 282 |
| 242 | 3300046530 | Ga0495654_0000668 | Ga0495654_0000668_23494_24393 | 282 |
| 243 | 3300050507 | nmdc:mga05p37_224370_c1 | nmdc:mga05p37_224370_c1_1181_2086 | 282 |
| 244 | iso_pu_bacteria | 2857547612 | 2857551617 | 282 |
| 245 | iso_pu_bacteria | 2886848708 | 2886851516 | 282 |
| 246 | iso_pu_bacteria | 2932410948 | 2932416532 | 282 |
| 247 | iso_pu_bacteria | 2932416698 | 2932417068 | 282 |
| 248 | 3300002987 | JGI25159J45721_1001772 | JGI25159J45721_10017725 | 283 |
| 249 | 3300003215 | JGI25153J46596_10001052 | JGI25153J46596_100010529 | 283 |
| 250 | 3300003771 | Ga0055526_1001902 | Ga0055526_100190213 | 283 |
| 251 | 3300003773 | Ga0055537_1000139 | Ga0055537_100013913 | 283 |
| 252 | 3300003784 | Ga0055534_1000942 | Ga0055534_100094213 | 283 |
| 253 | 3300003790 | Ga0055528_1000703 | Ga0055528_100070310 | 283 |
| 254 | 3300004625 | Ga0055543_1007311 | Ga0055543_10073112 | 283 |
| 255 | 3300005262 | Ga0065165_1000590 | Ga0065165_100059033 | 283 |
| 256 | 3300005330 | Ga0070690_100117169 | Ga0070690_1001171692 | 283 |
| 257 | 3300005340 | Ga0070689_100032310 | Ga0070689_1000323103 | 283 |
| 258 | 3300006195 | Ga0075366_10063612 | Ga0075366_100636123 | 283 |
| 259 | 3300009148 | Ga0105243_10006332 | Ga0105243_100063324 | 283 |
| 260 | 3300021361 | Ga0213872_10000007 | Ga0213872_1000000791 | 283 |
| 261 | 3300025263 | Ga0209565_1000055 | Ga0209565_1000055177 | 283 |
| 262 | 3300025273 | Ga0209673_1000040 | Ga0209673_1000040177 | 283 |
| 263 | 3300025284 | Ga0209130_1000195 | Ga0209130_100019527 | 283 |
| 264 | 3300025291 | Ga0209675_1000052 | Ga0209675_100005213 | 283 |
| 265 | 3300025295 | Ga0209564_1000121 | Ga0209564_100012172 | 283 |
| 266 | 3300025297 | Ga0209758_1000045 | Ga0209758_1000045173 | 283 |
| 267 | 3300025299 | Ga0209256_1000100 | Ga0209256_100010013 | 283 |
| 268 | 3300025936 | Ga0207670_10412196 | Ga0207670_104121962 | 283 |
| 269 | 3300028794 | Ga0307515_10081051 | Ga0307515_100810516 | 283 |
| 270 | 3300039447 | Ga0436361_0163583 | Ga0436361_0163583_141695_142648 | 283 |
| 271 | 3300042876 | Ga0451577_0061411 | Ga0451577_0061411_2262_3191 | 283 |
| 272 | 3300044693 | Ga0466961_0221226 | Ga0466961_0221226_248_1141 | 283 |
| 273 | 3300044694 | Ga0466963_0073887 | Ga0466963_0073887_888_1823 | 283 |
| 274 | 3300046491 | Ga0495584_0043820 | Ga0495584_0043820_134_1015 | 283 |
| 275 | 3300046501 | Ga0495607_0030964 | Ga0495607_0030964_1690_2571 | 283 |
| 276 | 3300046506 | Ga0495583_0013304 | Ga0495583_0013304_276_1157 | 283 |
| 277 | 3300046513 | Ga0495616_0013555 | Ga0495616_0013555_1717_2598 | 283 |
| 278 | 3300046513 | Ga0495616_0106189 | Ga0495616_0106189_14_916 | 283 |
| 279 | 3300046522 | Ga0495643_0000567 | Ga0495643_0000567_37312_38205 | 283 |
| 280 | 3300046525 | Ga0495663_0072673 | Ga0495663_0072673_60_941 | 283 |
| 281 | 3300046528 | Ga0495642_0005384 | Ga0495642_0005384_1246_2127 | 283 |
| 282 | 3300046538 | Ga0495609_0000486 | Ga0495609_0000486_22235_23116 | 283 |
| 283 | 3300046616 | Ga0495668_0000035 | Ga0495668_0000035_27289_28188 | 283 |
| 284 | 3300046616 | Ga0495668_0001462 | Ga0495668_0001462_3647_4528 | 283 |
| 285 | 3300046660 | Ga0495625_0001970 | Ga0495625_0001970_19086_19967 | 283 |
| 286 | 3300046664 | Ga0495659_0001196 | Ga0495659_0001196_442_1323 | 283 |
| 287 | 3300046694 | Ga0495649_0080528 | Ga0495649_0080528_817_1698 | 283 |
| 288 | 3300047318 | Ga0495636_0034577 | Ga0495636_0034577_944_1825 | 283 |
| 289 | 3300047446 | Ga0495679_010347 | Ga0495679_010347_2456_3337 | 283 |
| 290 | 3300047470 | Ga0495681_0001257 | Ga0495681_0001257_3206_4087 | 283 |
| 291 | 3300047472 | Ga0495686_0000879 | Ga0495686_0000879_18351_19250 | 283 |
| 292 | 3300048091 | Ga0495626_0011650 | Ga0495626_0011650_202_1095 | 283 |
| 293 | 3300048925 | Ga0496122_0053333 | Ga0496122_0053333_1558_2451 | 283 |
| 294 | 3300048926 | Ga0496123_0009868 | Ga0496123_0009868_3224_4117 | 283 |
| 295 | 3300049822 | Ga0501035_0020112 | Ga0501035_0020112_1593_2516 | 283 |
| 296 | 3300053117 | Ga0500593_000267 | Ga0500593_000267_1425_2360 | 283 |
| 297 | 3300003320 | rootH2_10018082 | rootH2_100180827 | 284 |
| 298 | 3300003322 | rootL2_10001457 | rootL2_1000145763 | 284 |
| 299 | 3300003323 | rootH1_10020465 | rootH1_100204652 | 284 |
| 300 | 3300005262 | Ga0065165_1001052 | Ga0065165_10010526 | 284 |
| 301 | 3300005329 | Ga0070683_100005154 | Ga0070683_1000051549 | 284 |
| 302 | 3300005344 | Ga0070661_100047409 | Ga0070661_1000474094 | 284 |
| 303 | 3300005355 | Ga0070671_100158775 | Ga0070671_1001587751 | 284 |
| 304 | 3300005366 | Ga0070659_100019281 | Ga0070659_1000192812 | 284 |
| 305 | 3300005535 | Ga0070684_100006125 | Ga0070684_1000061255 | 284 |
| 306 | 3300005539 | Ga0068853_100019086 | Ga0068853_1000190867 | 284 |
| 307 | 3300005547 | Ga0070693_100009342 | Ga0070693_1000093425 | 284 |
| 308 | 3300005564 | Ga0070664_100227099 | Ga0070664_1002270992 | 284 |
| 309 | 3300005577 | Ga0068857_100016044 | Ga0068857_1000160444 | 284 |
| 310 | 3300005614 | Ga0068856_100221497 | Ga0068856_1002214972 | 284 |
| 311 | 3300005616 | Ga0068852_100082393 | Ga0068852_1000823932 | 284 |
| 312 | 3300005834 | Ga0068851_10219863 | Ga0068851_102198632 | 284 |
| 313 | 3300005841 | Ga0068863_100200097 | Ga0068863_1002000973 | 284 |
| 314 | 3300005842 | Ga0068858_100405678 | Ga0068858_1004056782 | 284 |
| 315 | 3300005843 | Ga0068860_100475079 | Ga0068860_1004750792 | 284 |
| 316 | 3300006846 | Ga0075430_100013700 | Ga0075430_1000137002 | 284 |
| 317 | 3300006880 | Ga0075429_100002011 | Ga0075429_1000020115 | 284 |
| 318 | 3300009093 | Ga0105240_10293943 | Ga0105240_102939431 | 284 |
| 319 | 3300009093 | Ga0105240_10385291 | Ga0105240_103852912 | 284 |
| 320 | 3300013105 | Ga0157369_10042581 | Ga0157369_100425812 | 284 |
| 321 | 3300013296 | Ga0157374_10073653 | Ga0157374_100736533 | 284 |
| 322 | 3300013307 | Ga0157372_10029653 | Ga0157372_100296535 | 284 |
| 323 | 3300014968 | Ga0157379_10159338 | Ga0157379_101593383 | 284 |
| 324 | 3300025231 | Ga0207427_100611 | Ga0207427_10061118 | 284 |
| 325 | 3300025273 | Ga0209673_1026656 | Ga0209673_10266562 | 284 |
| 326 | 3300025909 | Ga0207705_10055974 | Ga0207705_100559742 | 284 |
| 327 | 3300025913 | Ga0207695_10165403 | Ga0207695_101654033 | 284 |
| 328 | 3300025919 | Ga0207657_10095706 | Ga0207657_100957064 | 284 |
| 329 | 3300025940 | Ga0207691_10069752 | Ga0207691_100697521 | 284 |
| 330 | 3300025945 | Ga0207679_10179261 | Ga0207679_101792613 | 284 |
| 331 | 3300026023 | Ga0207677_10447058 | Ga0207677_104470581 | 284 |
| 332 | 3300026116 | Ga0207674_10024335 | Ga0207674_100243356 | 284 |
| 333 | 3300028381 | Ga0268264_10369181 | Ga0268264_103691812 | 284 |
| 334 | 3300031730 | Ga0307516_10000677 | Ga0307516_1000067727 | 284 |
| 335 | 3300036401 | Ga0373937_0390033 | Ga0373937_0390033_321_1235 | 284 |
| 336 | 3300039437 | Ga0436365_1857266 | Ga0436365_1857266_1314_2228 | 284 |
| 337 | 3300046452 | Ga0495617_000001 | Ga0495617_000001_96014_96910 | 284 |
| 338 | 3300046453 | Ga0495627_000035 | Ga0495627_000035_132616_133512 | 284 |
| 339 | 3300046460 | Ga0495638_0027065 | Ga0495638_0027065_730_1638 | 284 |
| 340 | 3300046460 | Ga0495638_0173660 | Ga0495638_0173660_101_1054 | 284 |
| 341 | 3300046474 | Ga0495605_0000173 | Ga0495605_0000173_50494_51390 | 284 |
| 342 | 3300046474 | Ga0495605_0021091 | Ga0495605_0021091_931_1839 | 284 |
| 343 | 3300046474 | Ga0495605_0072912 | Ga0495605_0072912_550_1446 | 284 |
| 344 | 3300046491 | Ga0495584_0000476 | Ga0495584_0000476_22113_23045 | 284 |
| 345 | 3300046491 | Ga0495584_0036188 | Ga0495584_0036188_333_1256 | 284 |
| 346 | 3300046492 | Ga0495585_0137863 | Ga0495585_0137863_318_1214 | 284 |
| 347 | 3300046499 | Ga0495594_0038400 | Ga0495594_0038400_298_1206 | 284 |
| 348 | 3300046500 | Ga0495596_0000269 | Ga0495596_0000269_20660_21583 | 284 |
| 349 | 3300046500 | Ga0495596_0001261 | Ga0495596_0001261_8664_9572 | 284 |
| 350 | 3300046500 | Ga0495596_0004074 | Ga0495596_0004074_1180_2109 | 284 |
| 351 | 3300046500 | Ga0495596_0004356 | Ga0495596_0004356_2065_2961 | 284 |
| 352 | 3300046500 | Ga0495596_0004374 | Ga0495596_0004374_5428_6345 | 284 |
| 353 | 3300046500 | Ga0495596_0023514 | Ga0495596_0023514_260_1168 | 284 |
| 354 | 3300046506 | Ga0495583_0000266 | Ga0495583_0000266_67246_68169 | 284 |
| 355 | 3300046506 | Ga0495583_0004482 | Ga0495583_0004482_7233_8150 | 284 |
| 356 | 3300046506 | Ga0495583_0012841 | Ga0495583_0012841_2191_3099 | 284 |
| 357 | 3300046506 | Ga0495583_0015225 | Ga0495583_0015225_2273_3202 | 284 |
| 358 | 3300046506 | Ga0495583_0106535 | Ga0495583_0106535_103_1020 | 284 |
| 359 | 3300046507 | Ga0495606_0059265 | Ga0495606_0059265_928_1857 | 284 |
| 360 | 3300046513 | Ga0495616_0000037 | Ga0495616_0000037_15629_16525 | 284 |
| 361 | 3300046513 | Ga0495616_0001334 | Ga0495616_0001334_6800_7729 | 284 |
| 362 | 3300046518 | Ga0495631_0001676 | Ga0495631_0001676_1377_2273 | 284 |
| 363 | 3300046518 | Ga0495631_0005281 | Ga0495631_0005281_1400_2329 | 284 |
| 364 | 3300046518 | Ga0495631_0006938 | Ga0495631_0006938_4369_5265 | 284 |
| 365 | 3300046518 | Ga0495631_0045508 | Ga0495631_0045508_510_1406 | 284 |
| 366 | 3300046519 | Ga0495632_0000119 | Ga0495632_0000119_12652_13575 | 284 |
| 367 | 3300046519 | Ga0495632_0000126 | Ga0495632_0000126_25559_26455 | 284 |
| 368 | 3300046519 | Ga0495632_0006812 | Ga0495632_0006812_2677_3630 | 284 |
| 369 | 3300046524 | Ga0495648_0000138 | Ga0495648_0000138_16900_17796 | 284 |
| 370 | 3300046524 | Ga0495648_0040159 | Ga0495648_0040159_576_1484 | 284 |
| 371 | 3300046528 | Ga0495642_0000009 | Ga0495642_0000009_94353_95249 | 284 |
| 372 | 3300046528 | Ga0495642_0000069 | Ga0495642_0000069_39654_40550 | 284 |
| 373 | 3300046528 | Ga0495642_0006396 | Ga0495642_0006396_2413_3336 | 284 |
| 374 | 3300046538 | Ga0495609_0007848 | Ga0495609_0007848_748_1644 | 284 |
| 375 | 3300046538 | Ga0495609_0017809 | Ga0495609_0017809_261_1169 | 284 |
| 376 | 3300046558 | Ga0495633_0048808 | Ga0495633_0048808_61_957 | 284 |
| 377 | 3300046615 | Ga0495656_0006795 | Ga0495656_0006795_2048_2944 | 284 |
| 378 | 3300046616 | Ga0495668_0000800 | Ga0495668_0000800_18345_19241 | 284 |
| 379 | 3300046616 | Ga0495668_0020512 | Ga0495668_0020512_405_1322 | 284 |
| 380 | 3300046616 | Ga0495668_0027111 | Ga0495668_0027111_2246_3154 | 284 |
| 381 | 3300046616 | Ga0495668_0031486 | Ga0495668_0031486_1971_2894 | 284 |
| 382 | 3300046616 | Ga0495668_0044464 | Ga0495668_0044464_11_940 | 284 |
| 383 | 3300046648 | Ga0495611_0001110 | Ga0495611_0001110_5219_6127 | 284 |
| 384 | 3300046648 | Ga0495611_0009857 | Ga0495611_0009857_1956_2852 | 284 |
| 385 | 3300046648 | Ga0495611_0045048 | Ga0495611_0045048_403_1299 | 284 |
| 386 | 3300046660 | Ga0495625_0058662 | Ga0495625_0058662_1320_2216 | 284 |
| 387 | 3300046660 | Ga0495625_0162895 | Ga0495625_0162895_23_952 | 284 |
| 388 | 3300046665 | Ga0495661_0009241 | Ga0495661_0009241_257_1180 | 284 |
| 389 | 3300046665 | Ga0495661_0030930 | Ga0495661_0030930_593_1489 | 284 |
| 390 | 3300046665 | Ga0495661_0083165 | Ga0495661_0083165_284_1180 | 284 |
| 391 | 3300046679 | Ga0495623_0061342 | Ga0495623_0061342_222_1127 | 284 |
| 392 | 3300046684 | Ga0495669_0000094 | Ga0495669_0000094_16647_17543 | 284 |
| 393 | 3300046684 | Ga0495669_0001761 | Ga0495669_0001761_6352_7260 | 284 |
| 394 | 3300046691 | Ga0495670_0020963 | Ga0495670_0020963_1357_2253 | 284 |
| 395 | 3300046691 | Ga0495670_0024900 | Ga0495670_0024900_792_1715 | 284 |
| 396 | 3300046692 | Ga0495671_0000047 | Ga0495671_0000047_94547_95443 | 284 |
| 397 | 3300046692 | Ga0495671_0000715 | Ga0495671_0000715_9874_10797 | 284 |
| 398 | 3300046692 | Ga0495671_0001120 | Ga0495671_0001120_17485_18408 | 284 |
| 399 | 3300046694 | Ga0495649_0003092 | Ga0495649_0003092_6951_7871 | 284 |
| 400 | 3300046694 | Ga0495649_0004491 | Ga0495649_0004491_6511_7464 | 284 |
| 401 | 3300046794 | Ga0495589_0000939 | Ga0495589_0000939_9584_10480 | 284 |
| 402 | 3300046794 | Ga0495589_0066332 | Ga0495589_0066332_431_1339 | 284 |
| 403 | 3300046810 | Ga0495660_0003343 | Ga0495660_0003343_1928_2851 | 284 |
| 404 | 3300046810 | Ga0495660_0007769 | Ga0495660_0007769_3979_4887 | 284 |
| 405 | 3300046810 | Ga0495660_0026793 | Ga0495660_0026793_592_1545 | 284 |
| 406 | 3300046810 | Ga0495660_0043054 | Ga0495660_0043054_894_1790 | 284 |
| 407 | 3300047320 | Ga0495672_0024035 | Ga0495672_0024035_1553_2461 | 284 |
| 408 | 3300047323 | Ga0495683_0081990 | Ga0495683_0081990_606_1535 | 284 |
| 409 | 3300047443 | Ga0495687_000728 | Ga0495687_000728_23010_23927 | 284 |
| 410 | 3300047445 | Ga0495677_0005961 | Ga0495677_0005961_1220_2116 | 284 |
| 411 | 3300047445 | Ga0495677_0009707 | Ga0495677_0009707_854_1762 | 284 |
| 412 | 3300047446 | Ga0495679_009721 | Ga0495679_009721_158_1066 | 284 |
| 413 | 3300047446 | Ga0495679_017478 | Ga0495679_017478_1497_2393 | 284 |
| 414 | 3300047470 | Ga0495681_0000067 | Ga0495681_0000067_83783_84706 | 284 |
| 415 | 3300047470 | Ga0495681_0002358 | Ga0495681_0002358_1694_2623 | 284 |
| 416 | 3300047470 | Ga0495681_0026651 | Ga0495681_0026651_387_1316 | 284 |
| 417 | 3300047472 | Ga0495686_0000015 | Ga0495686_0000015_442413_443321 | 284 |
| 418 | 3300048091 | Ga0495626_0006154 | Ga0495626_0006154_4552_5460 | 284 |
| 419 | 3300048091 | Ga0495626_0006695 | Ga0495626_0006695_614_1522 | 284 |
| 420 | 3300048091 | Ga0495626_0018023 | Ga0495626_0018023_2216_3124 | 284 |
| 421 | 3300048091 | Ga0495626_0022343 | Ga0495626_0022343_43_972 | 284 |
| 422 | 3300048091 | Ga0495626_0024076 | Ga0495626_0024076_1503_2426 | 284 |
| 423 | 3300048927 | Ga0496124_0199895 | Ga0496124_0199895_118_1023 | 284 |
| 424 | 3300049459 | Ga0495678_000122 | Ga0495678_000122_1016_1945 | 284 |
| 425 | 3300049459 | Ga0495678_000140 | Ga0495678_000140_66945_67868 | 284 |
| 426 | 3300049459 | Ga0495678_013402 | Ga0495678_013402_686_1594 | 284 |
| 427 | 3300049460 | Ga0495682_0000645 | Ga0495682_0000645_13141_14070 | 284 |
| 428 | 3300049460 | Ga0495682_0005882 | Ga0495682_0005882_359_1267 | 284 |
| 429 | 3300049585 | Ga0501069_0016771 | Ga0501069_0016771_2458_3462 | 284 |
| 430 | 3300049586 | Ga0501070_0006049 | Ga0501070_0006049_6791_7795 | 284 |
| 431 | 3300049589 | Ga0501073_0004816 | Ga0501073_0004816_3676_4680 | 284 |
| 432 | 3300049590 | Ga0501074_0009715 | Ga0501074_0009715_2524_3528 | 284 |
| 433 | 3300049741 | Ga0501079_0037924 | Ga0501079_0037924_2335_3339 | 284 |
| 434 | 3300049742 | Ga0501080_0029064 | Ga0501080_0029064_2905_3909 | 284 |
| 435 | 3300049744 | Ga0501083_0006267 | Ga0501083_0006267_3474_4478 | 284 |
| 436 | 3300049822 | Ga0501035_0179098 | Ga0501035_0179098_780_1784 | 284 |
| 437 | 3300049823 | Ga0501044_0058899 | Ga0501044_0058899_2460_3464 | 284 |
| 438 | 3300050508 | nmdc:mga09592_27696_c1 | nmdc:mga09592_27696_c1_1828_2730 | 284 |
| 439 | 3300050509 | nmdc:mga0qj67_12358_c1 | nmdc:mga0qj67_12358_c1_3286_4188 | 284 |
| 440 | 3300053134 | Ga0500658_0007750 | Ga0500658_0007750_1509_2462 | 284 |
| 441 | 3300054114 | Ga0501084_0010239 | Ga0501084_0010239_3362_4366 | 284 |
| 442 | 3300003322 | rootL2_10024434 | rootL2_100244344 | 285 |
| 443 | 3300003322 | rootL2_10046301 | rootL2_100463014 | 285 |
| 444 | 3300003759 | Ga0055525_1000006 | Ga0055525_100000627 | 285 |
| 445 | 3300005262 | Ga0065165_1050188 | Ga0065165_10501881 | 285 |
| 446 | 3300005327 | Ga0070658_10131552 | Ga0070658_101315523 | 285 |
| 447 | 3300005339 | Ga0070660_100100087 | Ga0070660_1001000871 | 285 |
| 448 | 3300005563 | Ga0068855_100105646 | Ga0068855_1001056463 | 285 |
| 449 | 3300005564 | Ga0070664_100172592 | Ga0070664_1001725922 | 285 |
| 450 | 3300005564 | Ga0070664_100232867 | Ga0070664_1002328672 | 285 |
| 451 | 3300006195 | Ga0075366_10150380 | Ga0075366_101503802 | 285 |
| 452 | 3300006237 | Ga0097621_100059890 | Ga0097621_1000598903 | 285 |
| 453 | 3300009093 | Ga0105240_10326796 | Ga0105240_103267962 | 285 |
| 454 | 3300009174 | Ga0105241_10004946 | Ga0105241_100049464 | 285 |
| 455 | 3300009545 | Ga0105237_10206071 | Ga0105237_102060713 | 285 |
| 456 | 3300013100 | Ga0157373_10169567 | Ga0157373_101695672 | 285 |
| 457 | 3300013307 | Ga0157372_10822322 | Ga0157372_108223221 | 285 |
| 458 | 3300015261 | Ga0182006_1000129 | Ga0182006_100012933 | 285 |
| 459 | 3300025230 | Ga0209563_100022 | Ga0209563_10002226 | 285 |
| 460 | 3300025253 | Ga0209677_102651 | Ga0209677_1026514 | 285 |
| 461 | 3300025909 | Ga0207705_10076694 | Ga0207705_100766943 | 285 |
| 462 | 3300025911 | Ga0207654_10003469 | Ga0207654_100034693 | 285 |
| 463 | 3300025919 | Ga0207657_10285550 | Ga0207657_102855502 | 285 |
| 464 | 3300025933 | Ga0207706_10132114 | Ga0207706_101321143 | 285 |
| 465 | 3300025949 | Ga0207667_10121278 | Ga0207667_101212783 | 285 |
| 466 | 3300025986 | Ga0207658_10028962 | Ga0207658_100289621 | 285 |
| 467 | 3300026067 | Ga0207678_10170660 | Ga0207678_101706602 | 285 |
| 468 | 3300026142 | Ga0207698_10186857 | Ga0207698_101868572 | 285 |
| 469 | 3300035691 | Ga0373931_0043075 | Ga0373931_0043075_644_1555 | 285 |
| 470 | 3300037312 | Ga0395899_0022687 | Ga0395899_0022687_3125_4027 | 285 |
| 471 | 3300037312 | Ga0395899_0027162 | Ga0395899_0027162_1999_2901 | 285 |
| 472 | 3300037312 | Ga0395899_0066414 | Ga0395899_0066414_1497_2396 | 285 |
| 473 | 3300037418 | Ga0395900_0008081 | Ga0395900_0008081_6959_7861 | 285 |
| 474 | 3300037418 | Ga0395900_0019362 | Ga0395900_0019362_4407_5309 | 285 |
| 475 | 3300037418 | Ga0395900_0021938 | Ga0395900_0021938_2555_3454 | 285 |
| 476 | 3300037418 | Ga0395900_0025270 | Ga0395900_0025270_4095_4997 | 285 |
| 477 | 3300037418 | Ga0395900_0103129 | Ga0395900_0103129_61_963 | 285 |
| 478 | 3300037418 | Ga0395900_0434367 | Ga0395900_0434367_120_1019 | 285 |
| 479 | 3300037466 | Ga0395898_0012097 | Ga0395898_0012097_6468_7370 | 285 |
| 480 | 3300037471 | Ga0395905_0042976 | Ga0395905_0042976_1869_2771 | 285 |
| 481 | 3300037471 | Ga0395905_0070807 | Ga0395905_0070807_68_967 | 285 |
| 482 | 3300037471 | Ga0395905_0168013 | Ga0395905_0168013_634_1536 | 285 |
| 483 | 3300038443 | Ga0395901_0000103 | Ga0395901_0000103_23486_24388 | 285 |
| 484 | 3300038443 | Ga0395901_0006663 | Ga0395901_0006663_5865_6767 | 285 |
| 485 | 3300038443 | Ga0395901_0087498 | Ga0395901_0087498_1310_2209 | 285 |
| 486 | 3300038443 | Ga0395901_0291755 | Ga0395901_0291755_495_1394 | 285 |
| 487 | 3300038443 | Ga0395901_0520509 | Ga0395901_0520509_180_1082 | 285 |
| 488 | 3300041997 | Ga0439431_0030756 | Ga0439431_0030756_284_1279 | 285 |
| 489 | 3300042005 | Ga0439448_0057029 | Ga0439448_0057029_354_1253 | 285 |
| 490 | 3300042007 | Ga0439449_0009892 | Ga0439449_0009892_499_1398 | 285 |
| 491 | 3300042008 | Ga0439450_006282 | Ga0439450_006282_165_1064 | 285 |
| 492 | 3300042139 | Ga0450904_002018 | Ga0450904_002018_1261_2190 | 285 |
| 493 | 3300042876 | Ga0451577_0003232 | Ga0451577_0003232_16792_17715 | 285 |
| 494 | 3300044656 | Ga0466969_0053541 | Ga0466969_0053541_670_1572 | 285 |
| 495 | 3300044683 | Ga0466965_0032205 | Ga0466965_0032205_689_1591 | 285 |
| 496 | 3300044684 | Ga0466966_0019891 | Ga0466966_0019891_86_985 | 285 |
| 497 | 3300044684 | Ga0466966_0098683 | Ga0466966_0098683_440_1342 | 285 |
| 498 | 3300044684 | Ga0466966_0136715 | Ga0466966_0136715_287_1189 | 285 |
| 499 | 3300044693 | Ga0466961_0165391 | Ga0466961_0165391_395_1297 | 285 |
| 500 | 3300044694 | Ga0466963_0062824 | Ga0466963_0062824_177_1079 | 285 |
| 501 | 3300044706 | Ga0466964_0006890 | Ga0466964_0006890_2383_3285 | 285 |
| 502 | 3300044706 | Ga0466964_0008771 | Ga0466964_0008771_103_1005 | 285 |
| 503 | 3300044842 | Ga0466957_0000012 | Ga0466957_0000012_6784_7686 | 285 |
| 504 | 3300044842 | Ga0466957_0003624 | Ga0466957_0003624_5962_6870 | 285 |
| 505 | 3300045049 | Ga0466959_0021594 | Ga0466959_0021594_3549_4451 | 285 |
| 506 | 3300045049 | Ga0466959_0050434 | Ga0466959_0050434_160_1062 | 285 |
| 507 | 3300045049 | Ga0466959_0055486 | Ga0466959_0055486_1773_2672 | 285 |
| 508 | 3300045049 | Ga0466959_0262490 | Ga0466959_0262490_199_1098 | 285 |
| 509 | 3300045836 | Ga0466958_0017369 | Ga0466958_0017369_1123_2025 | 285 |
| 510 | 3300045976 | Ga0466967_0011429 | Ga0466967_0011429_4520_5422 | 285 |
| 511 | 3300045976 | Ga0466967_0023782 | Ga0466967_0023782_739_1641 | 285 |
| 512 | 3300046452 | Ga0495617_042516 | Ga0495617_042516_252_1160 | 285 |
| 513 | 3300046457 | Ga0495590_0000829 | Ga0495590_0000829_3661_4587 | 285 |
| 514 | 3300046457 | Ga0495590_0029076 | Ga0495590_0029076_704_1603 | 285 |
| 515 | 3300046472 | Ga0495580_0055947 | Ga0495580_0055947_50_967 | 285 |
| 516 | 3300046473 | Ga0495582_0009564 | Ga0495582_0009564_3768_4685 | 285 |
| 517 | 3300046474 | Ga0495605_0000039 | Ga0495605_0000039_187748_188647 | 285 |
| 518 | 3300046474 | Ga0495605_0004874 | Ga0495605_0004874_3595_4512 | 285 |
| 519 | 3300046474 | Ga0495605_0029882 | Ga0495605_0029882_1804_2721 | 285 |
| 520 | 3300046491 | Ga0495584_0000890 | Ga0495584_0000890_2535_3452 | 285 |
| 521 | 3300046491 | Ga0495584_0001772 | Ga0495584_0001772_6501_7400 | 285 |
| 522 | 3300046492 | Ga0495585_0005156 | Ga0495585_0005156_5985_6893 | 285 |
| 523 | 3300046499 | Ga0495594_0036988 | Ga0495594_0036988_399_1316 | 285 |
| 524 | 3300046500 | Ga0495596_0006717 | Ga0495596_0006717_999_1916 | 285 |
| 525 | 3300046501 | Ga0495607_0004567 | Ga0495607_0004567_3240_4139 | 285 |
| 526 | 3300046501 | Ga0495607_0010751 | Ga0495607_0010751_1955_2854 | 285 |
| 527 | 3300046506 | Ga0495583_0000341 | Ga0495583_0000341_27419_28357 | 285 |
| 528 | 3300046506 | Ga0495583_0000372 | Ga0495583_0000372_32045_32962 | 285 |
| 529 | 3300046507 | Ga0495606_0009759 | Ga0495606_0009759_2254_3153 | 285 |
| 530 | 3300046513 | Ga0495616_0014825 | Ga0495616_0014825_2145_3044 | 285 |
| 531 | 3300046517 | Ga0495630_0032744 | Ga0495630_0032744_1591_2508 | 285 |
| 532 | 3300046518 | Ga0495631_0018214 | Ga0495631_0018214_1372_2289 | 285 |
| 533 | 3300046519 | Ga0495632_0000375 | Ga0495632_0000375_27286_28185 | 285 |
| 534 | 3300046519 | Ga0495632_0008489 | Ga0495632_0008489_4161_5078 | 285 |
| 535 | 3300046522 | Ga0495643_0000247 | Ga0495643_0000247_74777_75715 | 285 |
| 536 | 3300046522 | Ga0495643_0002950 | Ga0495643_0002950_2918_3817 | 285 |
| 537 | 3300046522 | Ga0495643_0007380 | Ga0495643_0007380_3234_4145 | 285 |
| 538 | 3300046522 | Ga0495643_0032176 | Ga0495643_0032176_1904_2803 | 285 |
| 539 | 3300046523 | Ga0495644_0072205 | Ga0495644_0072205_282_1199 | 285 |
| 540 | 3300046524 | Ga0495648_0017008 | Ga0495648_0017008_1061_1960 | 285 |
| 541 | 3300046526 | Ga0495666_0007333 | Ga0495666_0007333_3807_4724 | 285 |
| 542 | 3300046528 | Ga0495642_0000779 | Ga0495642_0000779_10220_11119 | 285 |
| 543 | 3300046528 | Ga0495642_0012064 | Ga0495642_0012064_1966_2883 | 285 |
| 544 | 3300046535 | Ga0495586_0154398 | Ga0495586_0154398_271_1188 | 285 |
| 545 | 3300046538 | Ga0495609_0018939 | Ga0495609_0018939_1800_2708 | 285 |
| 546 | 3300046558 | Ga0495633_0001734 | Ga0495633_0001734_11594_12541 | 285 |
| 547 | 3300046615 | Ga0495656_0024835 | Ga0495656_0024835_856_1773 | 285 |
| 548 | 3300046616 | Ga0495668_0132518 | Ga0495668_0132518_252_1169 | 285 |
| 549 | 3300046616 | Ga0495668_0145448 | Ga0495668_0145448_282_1199 | 285 |
| 550 | 3300046642 | Ga0495634_0021142 | Ga0495634_0021142_1102_2019 | 285 |
| 551 | 3300046648 | Ga0495611_0013522 | Ga0495611_0013522_57_974 | 285 |
| 552 | 3300046665 | Ga0495661_0000461 | Ga0495661_0000461_14605_15513 | 285 |
| 553 | 3300046665 | Ga0495661_0000560 | Ga0495661_0000560_6776_7675 | 285 |
| 554 | 3300046665 | Ga0495661_0002737 | Ga0495661_0002737_1226_2125 | 285 |
| 555 | 3300046665 | Ga0495661_0087985 | Ga0495661_0087985_674_1573 | 285 |
| 556 | 3300046665 | Ga0495661_0143138 | Ga0495661_0143138_57_965 | 285 |
| 557 | 3300046674 | Ga0495588_0000059 | Ga0495588_0000059_176415_177314 | 285 |
| 558 | 3300046679 | Ga0495623_0021707 | Ga0495623_0021707_2961_3878 | 285 |
| 559 | 3300046694 | Ga0495649_0015623 | Ga0495649_0015623_2368_3279 | 285 |
| 560 | 3300046694 | Ga0495649_0042146 | Ga0495649_0042146_939_1856 | 285 |
| 561 | 3300046794 | Ga0495589_0001197 | Ga0495589_0001197_7448_8347 | 285 |
| 562 | 3300046794 | Ga0495589_0001894 | Ga0495589_0001894_99_1016 | 285 |
| 563 | 3300046810 | Ga0495660_0000880 | Ga0495660_0000880_9664_10563 | 285 |
| 564 | 3300046810 | Ga0495660_0007209 | Ga0495660_0007209_195_1112 | 285 |
| 565 | 3300046810 | Ga0495660_0022112 | Ga0495660_0022112_98_1000 | 285 |
| 566 | 3300047317 | Ga0495604_0014524 | Ga0495604_0014524_1267_2184 | 285 |
| 567 | 3300047320 | Ga0495672_0003171 | Ga0495672_0003171_307_1206 | 285 |
| 568 | 3300047323 | Ga0495683_0015232 | Ga0495683_0015232_2824_3741 | 285 |
| 569 | 3300047323 | Ga0495683_0029094 | Ga0495683_0029094_205_1104 | 285 |
| 570 | 3300047443 | Ga0495687_000646 | Ga0495687_000646_2910_3809 | 285 |
| 571 | 3300047443 | Ga0495687_000943 | Ga0495687_000943_22558_23457 | 285 |
| 572 | 3300047443 | Ga0495687_033256 | Ga0495687_033256_761_1660 | 285 |
| 573 | 3300047444 | Ga0495675_0005147 | Ga0495675_0005147_6091_7008 | 285 |
| 574 | 3300047445 | Ga0495677_0000104 | Ga0495677_0000104_6150_7067 | 285 |
| 575 | 3300047445 | Ga0495677_0001887 | Ga0495677_0001887_5619_6518 | 285 |
| 576 | 3300047445 | Ga0495677_0003127 | Ga0495677_0003127_969_1868 | 285 |
| 577 | 3300047446 | Ga0495679_005923 | Ga0495679_005923_29_946 | 285 |
| 578 | 3300047470 | Ga0495681_0001717 | Ga0495681_0001717_5700_6617 | 285 |
| 579 | 3300048091 | Ga0495626_0000058 | Ga0495626_0000058_74265_75164 | 285 |
| 580 | 3300048091 | Ga0495626_0003238 | Ga0495626_0003238_4548_5483 | 285 |
| 581 | 3300048091 | Ga0495626_0006233 | Ga0495626_0006233_400_1317 | 285 |
| 582 | 3300048091 | Ga0495626_0034381 | Ga0495626_0034381_696_1613 | 285 |
| 583 | 3300048091 | Ga0495626_0036620 | Ga0495626_0036620_69_986 | 285 |
| 584 | 3300048091 | Ga0495626_0042005 | Ga0495626_0042005_1025_1936 | 285 |
| 585 | 3300048905 | Ga0496102_0267969 | Ga0496102_0267969_693_1595 | 285 |
| 586 | 3300048912 | Ga0496109_0007671 | Ga0496109_0007671_5923_6831 | 285 |
| 587 | 3300048916 | Ga0496113_0005467 | Ga0496113_0005467_21_929 | 285 |
| 588 | 3300048924 | Ga0496121_0087245 | Ga0496121_0087245_183_1082 | 285 |
| 589 | 3300048925 | Ga0496122_0000299 | Ga0496122_0000299_79873_80781 | 285 |
| 590 | 3300048925 | Ga0496122_0000898 | Ga0496122_0000898_39194_40141 | 285 |
| 591 | 3300048926 | Ga0496123_0000959 | Ga0496123_0000959_28981_29889 | 285 |
| 592 | 3300048926 | Ga0496123_0003657 | Ga0496123_0003657_1457_2404 | 285 |
| 593 | 3300048927 | Ga0496124_0017158 | Ga0496124_0017158_5060_5959 | 285 |
| 594 | 3300048927 | Ga0496124_0050112 | Ga0496124_0050112_813_1739 | 285 |
| 595 | 3300048927 | Ga0496124_0057375 | Ga0496124_0057375_1300_2199 | 285 |
| 596 | 3300048928 | Ga0496125_0000520 | Ga0496125_0000520_55207_56115 | 285 |
| 597 | 3300048929 | Ga0496126_0361791 | Ga0496126_0361791_123_1022 | 285 |
| 598 | 3300049459 | Ga0495678_004136 | Ga0495678_004136_4819_5736 | 285 |
| 599 | 3300049460 | Ga0495682_0006654 | Ga0495682_0006654_2958_3905 | 285 |
| 600 | 3300049581 | Ga0501047_0220534 | Ga0501047_0220534_579_1481 | 285 |
| 601 | 3300049662 | Ga0501222_005869 | Ga0501222_005869_14_913 | 285 |
| 602 | 3300049822 | Ga0501035_0015080 | Ga0501035_0015080_3852_4754 | 285 |
| 603 | 3300049823 | Ga0501044_0063301 | Ga0501044_0063301_2258_3160 | 285 |
| 604 | 3300061719 | Ga0466962_0133975 | Ga0466962_0133975_58_960 | 285 |
| 605 | 3300003775 | Ga0055524_1000469 | Ga0055524_10004694 | 286 |
| 606 | 3300003791 | Ga0055530_10000630 | Ga0055530_100006306 | 286 |
| 607 | 3300003792 | Ga0055540_1000173 | Ga0055540_100017324 | 286 |
| 608 | 3300005334 | Ga0068869_100074025 | Ga0068869_1000740252 | 286 |
| 609 | 3300005355 | Ga0070671_100062310 | Ga0070671_1000623103 | 286 |
| 610 | 3300005366 | Ga0070659_100321657 | Ga0070659_1003216572 | 286 |
| 611 | 3300005457 | Ga0070662_100051059 | Ga0070662_1000510593 | 286 |
| 612 | 3300005459 | Ga0068867_100304076 | Ga0068867_1003040762 | 286 |
| 613 | 3300005539 | Ga0068853_100033545 | Ga0068853_1000335454 | 286 |
| 614 | 3300005577 | Ga0068857_100031088 | Ga0068857_1000310882 | 286 |
| 615 | 3300005578 | Ga0068854_100121084 | Ga0068854_1001210843 | 286 |
| 616 | 3300006048 | Ga0075363_100056933 | Ga0075363_1000569331 | 286 |
| 617 | 3300006051 | Ga0075364_10031906 | Ga0075364_100319064 | 286 |
| 618 | 3300006177 | Ga0075362_10040933 | Ga0075362_100409332 | 286 |
| 619 | 3300006178 | Ga0075367_10015968 | Ga0075367_100159682 | 286 |
| 620 | 3300006186 | Ga0075369_10002395 | Ga0075369_100023952 | 286 |
| 621 | 3300006195 | Ga0075366_10003369 | Ga0075366_100033698 | 286 |
| 622 | 3300006195 | Ga0075366_10243336 | Ga0075366_102433362 | 286 |
| 623 | 3300006353 | Ga0075370_10001022 | Ga0075370_100010225 | 286 |
| 624 | 3300006353 | Ga0075370_10062768 | Ga0075370_100627682 | 286 |
| 625 | 3300006358 | Ga0068871_100248951 | Ga0068871_1002489512 | 286 |
| 626 | 3300009093 | Ga0105240_10009086 | Ga0105240_100090863 | 286 |
| 627 | 3300009093 | Ga0105240_10309258 | Ga0105240_103092583 | 286 |
| 628 | 3300009098 | Ga0105245_10207921 | Ga0105245_102079212 | 286 |
| 629 | 3300009148 | Ga0105243_10145981 | Ga0105243_101459813 | 286 |
| 630 | 3300010375 | Ga0105239_10063734 | Ga0105239_100637344 | 286 |
| 631 | 3300013296 | Ga0157374_10073775 | Ga0157374_100737751 | 286 |
| 632 | 3300025298 | Ga0209050_1000916 | Ga0209050_100091611 | 286 |
| 633 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036335 | 286 |
| 634 | 3300025303 | Ga0209051_1000379 | Ga0209051_100037930 | 286 |
| 635 | 3300025304 | Ga0209257_1000141 | Ga0209257_1000141124 | 286 |
| 636 | 3300025913 | Ga0207695_10042210 | Ga0207695_100422104 | 286 |
| 637 | 3300025914 | Ga0207671_10076846 | Ga0207671_100768463 | 286 |
| 638 | 3300025926 | Ga0207659_10139509 | Ga0207659_101395092 | 286 |
| 639 | 3300025927 | Ga0207687_10224417 | Ga0207687_102244172 | 286 |
| 640 | 3300025933 | Ga0207706_10031551 | Ga0207706_100315514 | 286 |
| 641 | 3300025960 | Ga0207651_10085215 | Ga0207651_100852152 | 286 |
| 642 | 3300025986 | Ga0207658_10142446 | Ga0207658_101424462 | 286 |
| 643 | 3300025986 | Ga0207658_10278192 | Ga0207658_102781922 | 286 |
| 644 | 3300026067 | Ga0207678_10022183 | Ga0207678_100221835 | 286 |
| 645 | 3300026116 | Ga0207674_10016404 | Ga0207674_100164045 | 286 |
| 646 | 3300031507 | Ga0307509_10001361 | Ga0307509_100013614 | 286 |
| 647 | 3300031548 | Ga0307408_100149218 | Ga0307408_1001492183 | 286 |
| 648 | 3300031649 | Ga0307514_10048470 | Ga0307514_100484704 | 286 |
| 649 | 3300033180 | Ga0307510_10042584 | Ga0307510_100425843 | 286 |
| 650 | 3300044656 | Ga0466969_0002974 | Ga0466969_0002974_188_1165 | 286 |
| 651 | 3300044683 | Ga0466965_0012379 | Ga0466965_0012379_2659_3636 | 286 |
| 652 | 3300044684 | Ga0466966_0007015 | Ga0466966_0007015_5559_6536 | 286 |
| 653 | 3300044693 | Ga0466961_0000623 | Ga0466961_0000623_3906_4883 | 286 |
| 654 | 3300045049 | Ga0466959_0000504 | Ga0466959_0000504_15845_16822 | 286 |
| 655 | 3300046454 | Ga0495592_0000495 | Ga0495592_0000495_17426_18346 | 286 |
| 656 | 3300046513 | Ga0495616_0000335 | Ga0495616_0000335_32164_33105 | 286 |
| 657 | 3300046517 | Ga0495630_0026460 | Ga0495630_0026460_2087_3001 | 286 |
| 658 | 3300046542 | Ga0495597_0009698 | Ga0495597_0009698_1208_2128 | 286 |
| 659 | 3300046557 | Ga0495622_0064984 | Ga0495622_0064984_350_1264 | 286 |
| 660 | 3300047320 | Ga0495672_0186580 | Ga0495672_0186580_35_949 | 286 |
| 661 | 3300047321 | Ga0495676_0015875 | Ga0495676_0015875_5187_6101 | 286 |
| 662 | 3300047443 | Ga0495687_000292 | Ga0495687_000292_55432_56352 | 286 |
| 663 | 3300048917 | Ga0496114_0028986 | Ga0496114_0028986_2200_3120 | 286 |
| 664 | 3300050491 | nmdc:mga00v17_59262_c1 | nmdc:mga00v17_59262_c1_1030_1950 | 286 |
| 665 | 3300050493 | nmdc:mga0k408_10619_c1 | nmdc:mga0k408_10619_c1_3495_4415 | 286 |
| 666 | 3300050493 | nmdc:mga0k408_96282_c1 | nmdc:mga0k408_96282_c1_637_1560 | 286 |
| 667 | 3300050496 | nmdc:mga07m45_94776_c1 | nmdc:mga07m45_94776_c1_752_1675 | 286 |
| 668 | 3300050516 | nmdc:mga0sz30_15062_c1 | nmdc:mga0sz30_15062_c1_1561_2481 | 286 |
| 669 | 3300033180 | Ga0307510_10001484 | Ga0307510_1000148418 | 287 |
| 670 | 3300003792 | Ga0055540_1032310 | Ga0055540_10323102 | 288 |
| 671 | 3300025303 | Ga0209051_1002249 | Ga0209051_10022499 | 288 |
| 672 | 3300039447 | Ga0436361_0480843 | Ga0436361_0480843_4871_5791 | 289 |
| 673 | 3300034820 | Ga0373959_0008059 | Ga0373959_0008059_120_1049 | 292 |
| 674 | 3300002705 | JGI25156J39149_1000149 | JGI25156J39149_100014915 | 294 |
| 675 | 3300002738 | JGI25154J39366_1003663 | JGI25154J39366_10036632 | 294 |
| 676 | 3300002741 | JGI25157J39369_1000192 | JGI25157J39369_100019215 | 294 |
| 677 | 3300003323 | rootH1_10013779 | rootH1_100137792 | 294 |
| 678 | 3300005535 | Ga0070684_100076143 | Ga0070684_1000761433 | 294 |
| 679 | 3300005539 | Ga0068853_100314873 | Ga0068853_1003148731 | 294 |
| 680 | 3300005563 | Ga0068855_100125016 | Ga0068855_1001250161 | 294 |
| 681 | 3300005577 | Ga0068857_100010026 | Ga0068857_1000100262 | 294 |
| 682 | 3300005578 | Ga0068854_100027116 | Ga0068854_1000271165 | 294 |
| 683 | 3300005614 | Ga0068856_100002916 | Ga0068856_10000291611 | 294 |
| 684 | 3300009174 | Ga0105241_10131066 | Ga0105241_101310662 | 294 |
| 685 | 3300009545 | Ga0105237_10291089 | Ga0105237_102910892 | 294 |
| 686 | 3300013105 | Ga0157369_10355325 | Ga0157369_103553252 | 294 |
| 687 | 3300013307 | Ga0157372_10045465 | Ga0157372_100454653 | 294 |
| 688 | 3300025242 | Ga0209258_100941 | Ga0209258_1009417 | 294 |
| 689 | 3300025246 | Ga0209646_1000258 | Ga0209646_100025815 | 294 |
| 690 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011443 | 294 |
| 691 | 3300025253 | Ga0209677_100633 | Ga0209677_10063320 | 294 |
| 692 | 3300025256 | Ga0209759_1000034 | Ga0209759_100003433 | 294 |
| 693 | 3300025911 | Ga0207654_10121201 | Ga0207654_101212012 | 294 |
| 694 | 3300025914 | Ga0207671_10036606 | Ga0207671_100366062 | 294 |
| 695 | 3300025919 | Ga0207657_10025339 | Ga0207657_100253395 | 294 |
| 696 | 3300025924 | Ga0207694_10051260 | Ga0207694_100512602 | 294 |
| 697 | 3300025949 | Ga0207667_10260974 | Ga0207667_102609742 | 294 |
| 698 | 3300025981 | Ga0207640_10006820 | Ga0207640_100068207 | 294 |
| 699 | 3300026041 | Ga0207639_10247393 | Ga0207639_102473932 | 294 |
| 700 | 3300026078 | Ga0207702_10002432 | Ga0207702_1000243211 | 294 |
| 701 | 3300026116 | Ga0207674_10313003 | Ga0207674_103130032 | 294 |
| 702 | 3300035086 | Ga0373934_0031007 | Ga0373934_0031007_448_1386 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zqi-assembly1.cif.gz_A | alginate lyase algat5 from polysaccharide lyase family 7 | 0.6712 | 251 | 291 |
| 6zvz-assembly2.cif.gz_B | connectase mj0548 from methanocaldococcus jannaschii | 0.6514 | 255 | 291 |
| 4zqv-assembly1.cif.gz_A | cdii immunity protein from yersinia kristensenii | 0.6098 | 254 | 290 |
| 8p5d-assembly1.cif.gz_LM0 | spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging | 0.5916 | 60 | 114 |
| 2zab-assembly1.cif.gz_A | crystal structure of family 7 alginate lyase a1-ii' y284f in cmplex with product (ggg) | 0.5881 | 233 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B0S7S0_1030_1200_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.8363 | 255 | 293 | 2.60.120.200 |
| af_A0A5S9MNN1_63_201_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.7938 | 256 | 293 | 3.80.10.10 |
| af_F1QPX5_1022_1195_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7928 | 255 | 294 | 2.60.120.200 |
| 5ik8A02 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7811 | 255 | 293 | 2.60.120.200 |
| af_A1ZA87_621_795_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7641 | 252 | 294 | 2.60.120.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S0MJI5-F1-model_v4 | DUF2145 domain-containing protein | 0.9731 | 25 | 293 |
|
| AF-A0A521ZX68-F1-model_v4 | DUF2145 domain-containing protein | 0.972 | 31 | 292 |
|
| AF-A0A1I2PYI2-F1-model_v4 | DUF2145 domain-containing protein | 0.968 | 30 | 293 |
|
| AF-A0A354IXN4-F1-model_v4 | DUF2145 domain-containing protein | 0.9638 | 30 | 293 |
|
| AF-A0A431JRI7-F1-model_v4 | DUF2145 domain-containing protein | 0.9635 | 31 | 292 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar