F476050

General Info

Members Datasets Scaffolds Average Seq Length
699 359 670 430

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000091|Ga0495633_0000091_42456_43847
Length 463
Sequence MSMPAMPPPLHDNQSYKKAAGPCAALHTRRQNMSSMIDSGLVAEHNATLQSNLDADYAALAGVLARRGQDIEKLTALAQTFAVAVPSWGAGTGGTRFARFPGVGEPRNVFEKLEDCAVINQLTQATPAVSLHFPWDKVSDTAALREIAQSHGLGFDAVNSNTFQDQLGQAHTYKHGSLTSQSAAVRAQAVEHNIECIELGRALGSKALTVWVGDGANFPGQHNLRGALERYLDSMRDIYGALPADWNIFIEHKLFEPAFYATTIADWGTSFACATALGPKAKCLVDLGHHAPNTNIEMIVARLAQFGKLGGFHFNDSKYGDDDLDSGSINPFQLFLVFNELADAAEREGAAFNPAYMLDQSHNVTDPIESLMSSAVEVQRAFIQSALVDRAGLRHLQESNDVHASAQALKQAFRTDVSAILAMARVRSGGAIDPVACYRTTGYREQRGVARPPKAGASSSGIV

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
7 2643221645 Massilia sp. Root351 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221656 Pelomonas sp. Root405 Isolate Unclassified
10 2643221664 Massilia sp. Root418 Isolate Unclassified
11 2643221684 Massilia sp. Root133 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541300 Massilia sp. GV016 Isolate Unclassified
14 2738541337 Pelomonas sp. BT06 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
18 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
19 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
20 2842711865 Duganella sp. R-73148 Isolate Unclassified
21 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
22 2857553236 Duganella sp. R-74557 Isolate Unclassified
23 2857558681 Duganella sp. R-74565 Isolate Unclassified
24 2857564685 Duganella sp. R-74599 Isolate Unclassified
25 2904424332 Duganella sp. 1411 Isolate Rhizosphere
26 2919476304 Duganella sp. 3397 Isolate Unclassified
27 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
162 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
192 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
193 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
194 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
297 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
322 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
343 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
344 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
345 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
346 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
347 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
348 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
351 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
359 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 0.14
Isolates 4.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0.86
Rhizoplane 2.72
Rhizosphere 78.25
Stem 0
Stem Tuber 0
Unclassified 6.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1001281 3300002774 Bacteria 7190
2 JGI25150J39212_1001652 3300002774 Bacteria 6043
3 JGI25159J45721_1008823 3300002987 Bacteria 2728
4 JGI25153J46596_10020644 3300003215 Bacteria 2484
5 rootH1_10004214 3300003316 Bacteria 29063
6 rootL2_10030166 3300003322 Bacteria 3268
7 rootL2_10042461 3300003322 Bacteria 24987
8 JGI25161J50226_1007707 3300003374 Bacteria 1757
9 Ga0055525_1000136 3300003759 Bacteria 107751
10 Ga0055526_1001585 3300003771 Bacteria 15984
11 Ga0055526_1015106 3300003771 Bacteria 3119
12 Ga0055537_1000076 3300003773 Bacteria 70798
13 Ga0055537_1000260 3300003773 Bacteria 38657
14 Ga0055537_1007956 3300003773 Bacteria 2492
15 Ga0055534_1000124 3300003784 Bacteria 57565
16 Ga0055528_1000184 3300003790 Bacteria 52910
17 Ga0055530_10012976 3300003791 Bacteria 2872
18 Ga0055531_10010104 3300003794 Bacteria 4737
19 Ga0055543_1003564 3300004625 Bacteria 4516
20 Ga0055543_1013926 3300004625 Bacteria 1576
21 Ga0065165_1000003 3300005262 Bacteria 390701
22 Ga0065712_10000210 3300005290 Bacteria 35783
23 Ga0065712_10000508 3300005290 Bacteria 18980
24 Ga0065715_10000337 3300005293 Bacteria 18475
25 Ga0065707_10002256 3300005295 Bacteria 4933
26 Ga0065707_10115084 3300005295 Bacteria 2278
27 Ga0070658_10177764 3300005327 Bacteria 1790
28 Ga0070658_10232746 3300005327 Bacteria 1560
29 Ga0070690_100005110 3300005330 Bacteria 7348
30 Ga0070690_100042208 3300005330 Bacteria 2889
31 Ga0070670_100006570 3300005331 Bacteria 9853
32 Ga0070670_100185195 3300005331 Bacteria 1808
33 Ga0070682_100025657 3300005337 Bacteria 3519
34 Ga0070661_100076251 3300005344 Bacteria 2471
35 Ga0070692_10030775 3300005345 Bacteria 2686
36 Ga0070671_100098835 3300005355 Bacteria 2448
37 Ga0070671_100169022 3300005355 Bacteria 1849
38 Ga0070671_100256317 3300005355 Bacteria 1486
39 Ga0070688_100019455 3300005365 Bacteria 3934
40 Ga0070688_100071504 3300005365 Bacteria 2221
41 Ga0070659_100076514 3300005366 Bacteria 2668
42 Ga0070659_100164420 3300005366 Bacteria 1815
43 Ga0070703_10000142 3300005406 Bacteria 37070
44 Ga0070714_100039841 3300005435 Bacteria 3958
45 Ga0070700_100015632 3300005441 Bacteria 4309
46 Ga0070694_100009689 3300005444 Bacteria 5915
47 Ga0070694_100046083 3300005444 Bacteria 2925
48 Ga0070694_100066573 3300005444 Bacteria 2471
49 Ga0070694_100094257 3300005444 Bacteria 2106
50 Ga0070708_100015369 3300005445 Bacteria 6321
51 Ga0070708_100053681 3300005445 Bacteria 3577
52 Ga0070678_100012011 3300005456 Bacteria 5366
53 Ga0070662_100147745 3300005457 Bacteria 1827
54 Ga0070681_10041961 3300005458 Bacteria 4586
55 Ga0068867_100212296 3300005459 Bacteria 1555
56 Ga0070685_10022916 3300005466 Bacteria 3411
57 Ga0070685_10094148 3300005466 Bacteria 1819
58 Ga0070706_100027367 3300005467 Bacteria 5248
59 Ga0070707_100004141 3300005468 Bacteria 13596
60 Ga0070707_100014591 3300005468 Bacteria 7367
61 Ga0070698_100090482 3300005471 Bacteria 3043
62 Ga0070699_100224209 3300005518 Unclassified 1675
63 Ga0070684_100016773 3300005535 Bacteria 5995
64 Ga0070697_100000726 3300005536 Bacteria 24563
65 Ga0070697_100143412 3300005536 Bacteria 2010
66 Ga0070672_100001959 3300005543 Bacteria 12914
67 Ga0070686_100015305 3300005544 Bacteria 4439
68 Ga0070686_100072163 3300005544 Bacteria 2263
69 Ga0070695_100005464 3300005545 Bacteria 7479
70 Ga0070696_100059126 3300005546 Bacteria 2678
71 Ga0070696_100105038 3300005546 Bacteria 2029
72 Ga0070665_100009834 3300005548 Bacteria 9668
73 Ga0070704_100040495 3300005549 Bacteria 3208
74 Ga0068855_100000220 3300005563 Bacteria 72936
75 Ga0068855_100106818 3300005563 Bacteria 3217
76 Ga0070664_100111149 3300005564 Bacteria 2392
77 Ga0068857_100041485 3300005577 Bacteria 4081
78 Ga0068856_100050059 3300005614 Bacteria 4118
79 Ga0068856_100111352 3300005614 Bacteria 2735
80 Ga0068852_100216024 3300005616 Bacteria 1822
81 Ga0068859_100025593 3300005617 Bacteria 5919
82 Ga0068859_100111261 3300005617 Bacteria 2801
83 Ga0068859_100157892 3300005617 Bacteria 2346
84 Ga0068851_10041992 3300005834 Bacteria 2301
85 Ga0068863_100133007 3300005841 Bacteria 2375
86 Ga0068863_100234167 3300005841 Bacteria 1772
87 Ga0068858_100072239 3300005842 Bacteria 3201
88 Ga0068858_100072488 3300005842 Bacteria 3195
89 Ga0068858_100186564 3300005842 Bacteria 1959
90 Ga0068860_100012371 3300005843 Bacteria 8408
91 Ga0068862_100007428 3300005844 Bacteria 9087
92 Ga0068862_100016113 3300005844 Bacteria 6217
93 Ga0068862_100273970 3300005844 Bacteria 1544
94 Ga0081455_10005188 3300005937 Bacteria 14336
95 Ga0081539_10006080 3300005985 Bacteria 11798
96 Ga0075367_10086429 3300006178 Bacteria 1903
97 Ga0075370_10024202 3300006353 Bacteria 3352
98 Ga0075428_100035039 3300006844 Bacteria 5534
99 Ga0075428_100058779 3300006844 Bacteria 4209
100 Ga0075428_100208492 3300006844 Bacteria 2112
101 Ga0075430_100123245 3300006846 Bacteria 2161
102 Ga0075431_100060018 3300006847 Bacteria 3925
103 Ga0075429_100082543 3300006880 Bacteria 2801
104 Ga0097620_100025593 3300006931 Bacteria 5919
105 Ga0097620_100111266 3300006931 Bacteria 2801
106 Ga0097620_100157873 3300006931 Bacteria 2346
107 Ga0079104_1008607 3300006946 Bacteria 3544
108 Ga0099826_10000008 3300006948 Bacteria 380974
109 Ga0075435_100070028 3300007076 Bacteria 2862
110 Ga0105244_10001244 3300009036 Bacteria 20871
111 Ga0111539_10000785 3300009094 Bacteria 41318
112 Ga0111539_10005248 3300009094 Bacteria 16787
113 Ga0111539_10014758 3300009094 Bacteria 9745
114 Ga0111539_10106201 3300009094 Bacteria 3294
115 Ga0111539_10109397 3300009094 Bacteria 3243
116 Ga0114129_10068358 3300009147 Bacteria 4954
117 Ga0114129_10150799 3300009147 Bacteria 3182
118 Ga0114129_10179124 3300009147 Bacteria 2885
119 Ga0114129_10212096 3300009147 Bacteria 2617
120 Ga0114129_10238102 3300009147 Bacteria 2448
121 Ga0105243_10000051 3300009148 Bacteria 139849
122 Ga0105243_10016945 3300009148 Bacteria 5509
123 Ga0105243_10139218 3300009148 Bacteria 2068
124 Ga0105243_10185181 3300009148 Bacteria 1814
125 Ga0105242_10000379 3300009176 Bacteria 35359
126 Ga0105242_10000777 3300009176 Bacteria 24800
127 Ga0105242_10198129 3300009176 Bacteria 1782
128 Ga0105248_10035248 3300009177 Bacteria 5598
129 Ga0105248_10044594 3300009177 Bacteria 4973
130 Ga0105248_10174437 3300009177 Bacteria 2423
131 Ga0105237_10106902 3300009545 Bacteria 2790
132 Ga0105246_10079775 3300011119 Bacteria 2328
133 Ga0157374_10210187 3300013296 Bacteria 1908
134 Ga0157378_10318209 3300013297 Bacteria 1511
135 Ga0163162_10131565 3300013306 Bacteria 2611
136 Ga0163162_10256688 3300013306 Bacteria 1880
137 Ga0163162_10260306 3300013306 Bacteria 1867
138 Ga0157375_10009288 3300013308 Bacteria 8630
139 Ga0157375_10060661 3300013308 Bacteria 3752
140 Ga0157375_10349907 3300013308 Bacteria 1643
141 Ga0157380_10007546 3300014326 Bacteria 7729
142 Ga0157380_10011050 3300014326 Bacteria 6513
143 Ga0157380_10013708 3300014326 Bacteria 5919
144 Ga0157379_10006872 3300014968 Bacteria 9836
145 Ga0157379_10028145 3300014968 Bacteria 5003
146 Ga0157379_10175163 3300014968 Bacteria 1937
147 Ga0182006_1000008 3300015261 Bacteria 449652
148 Ga0182005_1000022 3300015265 Bacteria 266181
149 Ga0163161_10010148 3300017792 Bacteria 6519
150 Ga0163161_10015004 3300017792 Bacteria 5398
151 Ga0163161_10129311 3300017792 Bacteria 1904
152 Ga0213876_10000078 3300021384 Bacteria 110940
153 Ga0213876_10000741 3300021384 Bacteria 22598
154 Ga0209436_100320 3300025208 Bacteria 22042
155 Ga0209436_111731 3300025208 Bacteria 1523
156 Ga0209563_100003 3300025230 Bacteria 1932942
157 Ga0207425_1000110 3300025245 Bacteria 77431
158 Ga0207425_1002130 3300025245 Bacteria 7272
159 Ga0209148_1000817 3300025254 Bacteria 22436
160 Ga0209129_1001089 3300025258 Bacteria 15888
161 Ga0209565_1000018 3300025263 Bacteria 460940
162 Ga0209565_1001274 3300025263 Bacteria 11697
163 Ga0209565_1001275 3300025263 Bacteria 11697
164 Ga0209673_1000006 3300025273 Bacteria 650600
165 Ga0209673_1008901 3300025273 Bacteria 4416
166 Ga0209130_1000036 3300025284 Bacteria 284111
167 Ga0209130_1014739 3300025284 Bacteria 1951
168 Ga0209130_1019582 3300025284 Bacteria 1565
169 Ga0209675_1000005 3300025291 Bacteria 849192
170 Ga0209675_1002720 3300025291 Bacteria 8856
171 Ga0209676_1008457 3300025292 Bacteria 4585
172 Ga0209025_1002805 3300025294 Bacteria 17560
173 Ga0209564_1000144 3300025295 Bacteria 175328
174 Ga0209564_1006481 3300025295 Bacteria 6299
175 Ga0209758_1000048 3300025297 Bacteria 358400
176 Ga0209758_1000304 3300025297 Bacteria 95770
177 Ga0209758_1000515 3300025297 Bacteria 62045
178 Ga0209758_1018730 3300025297 Bacteria 3377
179 Ga0209050_1000519 3300025298 Bacteria 64306
180 Ga0209050_1003570 3300025298 Bacteria 11322
181 Ga0209050_1004809 3300025298 Bacteria 8887
182 Ga0209256_1000018 3300025299 Bacteria 568467
183 Ga0209256_1000325 3300025299 Bacteria 81358
184 Ga0209256_1003732 3300025299 Bacteria 10307
185 Ga0209256_1003816 3300025299 Bacteria 10095
186 Ga0207426_1003756 3300025302 Bacteria 7920
187 Ga0207426_1037090 3300025302 Bacteria 1545
188 Ga0209257_1000123 3300025304 Bacteria 219092
189 Ga0209257_1000237 3300025304 Bacteria 128812
190 Ga0209257_1016477 3300025304 Bacteria 2988
191 Ga0207656_10028251 3300025321 Bacteria 2301
192 Ga0207653_10000247 3300025885 Bacteria 35017
193 Ga0207653_10020529 3300025885 Bacteria 2091
194 Ga0207699_10046414 3300025906 Bacteria 2541
195 Ga0207643_10000274 3300025908 Bacteria 35744
196 Ga0207643_10104818 3300025908 Bacteria 1661
197 Ga0207684_10002300 3300025910 Bacteria 19431
198 Ga0207684_10114987 3300025910 Bacteria 2304
199 Ga0207657_10001032 3300025919 Bacteria 29487
200 Ga0207646_10006553 3300025922 Bacteria 12015
201 Ga0207646_10007766 3300025922 Bacteria 10854
202 Ga0207646_10018507 3300025922 Bacteria 6494
203 Ga0207687_10208179 3300025927 Bacteria 1533
204 Ga0207644_10002534 3300025931 Bacteria 11751
205 Ga0207690_10065585 3300025932 Bacteria 2483
206 Ga0207686_10000022 3300025934 Bacteria 174346
207 Ga0207686_10004880 3300025934 Bacteria 7210
208 Ga0207686_10009833 3300025934 Bacteria 5198
209 Ga0207709_10000056 3300025935 Bacteria 221962
210 Ga0207691_10047614 3300025940 Bacteria 3934
211 Ga0207689_10078668 3300025942 Bacteria 2710
212 Ga0207667_10000044 3300025949 Bacteria 248251
213 Ga0207667_10027431 3300025949 Bacteria 6199
214 Ga0207667_10075798 3300025949 Bacteria 3491
215 Ga0207712_10013477 3300025961 Bacteria 5242
216 Ga0207712_10044240 3300025961 Bacteria 3076
217 Ga0207703_10044294 3300026035 Bacteria 3576
218 Ga0207678_10064323 3300026067 Bacteria 3152
219 Ga0207708_10003060 3300026075 Bacteria 12323
220 Ga0207708_10003897 3300026075 Bacteria 10988
221 Ga0207708_10008452 3300026075 Bacteria 7621
222 Ga0207702_10035657 3300026078 Bacteria 4159
223 Ga0207702_10214066 3300026078 Bacteria 1793
224 Ga0207641_10119298 3300026088 Bacteria 2351
225 Ga0207648_10007383 3300026089 Bacteria 10822
226 Ga0207648_10073127 3300026089 Bacteria 2988
227 Ga0207648_10285810 3300026089 Bacteria 1476
228 Ga0207676_10006868 3300026095 Bacteria 8062
229 Ga0207674_10068641 3300026116 Bacteria 3567
230 Ga0207674_10081328 3300026116 Bacteria 3242
231 Ga0207675_100017764 3300026118 Bacteria 6635
232 Ga0207675_100035141 3300026118 Bacteria 4675
233 Ga0207675_100068100 3300026118 Bacteria 3327
234 Ga0207675_100081266 3300026118 Bacteria 3038
235 Ga0207683_10030940 3300026121 Bacteria 4642
236 Ga0209281_1011147 3300027111 Bacteria 2024
237 Ga0209282_1000005 3300027666 Bacteria 380858
238 Ga0207428_10000543 3300027907 Bacteria 44986
239 Ga0207428_10007378 3300027907 Bacteria 10027
240 Ga0207428_10009786 3300027907 Bacteria 8589
241 Ga0268266_10254080 3300028379 Bacteria 1627
242 Ga0268265_10007809 3300028380 Bacteria 7220
243 Ga0268265_10028333 3300028380 Bacteria 4009
244 Ga0268265_10035430 3300028380 Bacteria 3646
245 Ga0268265_10070553 3300028380 Bacteria 2718
246 Ga0268264_10076573 3300028381 Bacteria 2847
247 Ga0307515_10168092 3300028794 Bacteria 2200
248 Ga0307511_10002924 3300030521 Bacteria 17683
249 Ga0307512_10011207 3300030522 Bacteria 8509
250 Ga0265760_10026782 3300031090 Bacteria 1688
251 Ga0265327_10026312 3300031251 Bacteria 3373
252 Ga0307513_10052728 3300031456 Bacteria 4378
253 Ga0307509_10043511 3300031507 Bacteria 4859
254 Ga0307408_100000023 3300031548 Bacteria 295931
255 Ga0307408_100000112 3300031548 Bacteria 89783
256 Ga0307408_100001881 3300031548 Bacteria 15279
257 Ga0307408_100004065 3300031548 Bacteria 9975
258 Ga0307516_10000424 3300031730 Bacteria 55291
259 Ga0307406_10009213 3300031901 Bacteria 5530
260 Ga0307414_10080493 3300032004 Bacteria 2382
261 Ga0307411_10000141 3300032005 Bacteria 22602
262 Ga0373939_0000107 3300035114 Bacteria 25390
263 Ga0373962_0004162 3300035242 Bacteria 3486
264 Ga0373931_0000226 3300035691 Bacteria 24011
265 Ga0395899_0000012 3300037312 Bacteria 517561
266 Ga0395899_0002976 3300037312 Bacteria 13555
267 Ga0395899_0017747 3300037312 Bacteria 5418
268 Ga0395899_0065133 3300037312 Bacteria 2678
269 Ga0395899_0083320 3300037312 Bacteria 2325
270 Ga0395899_0174683 3300037312 Bacteria 1511
271 Ga0395900_0000426 3300037418 Bacteria 60657
272 Ga0395900_0008926 3300037418 Bacteria 10283
273 Ga0395900_0009371 3300037418 Bacteria 10038
274 Ga0395900_0037192 3300037418 Bacteria 5020
275 Ga0395900_0055166 3300037418 Bacteria 4091
276 Ga0395900_0128182 3300037418 Bacteria 2601
277 Ga0395900_0221967 3300037418 Bacteria 1904
278 Ga0395898_0091347 3300037466 Bacteria 2929
279 Ga0395905_0000071 3300037471 Bacteria 174580
280 Ga0395905_0078616 3300037471 Bacteria 3091
281 Ga0395905_0111047 3300037471 Bacteria 2574
282 Ga0395905_0225131 3300037471 Bacteria 1755
283 Ga0436364_0978054 3300037853 Bacteria 3202
284 Ga0395901_0000345 3300038443 Bacteria 56604
285 Ga0395901_0048652 3300038443 Bacteria 4403
286 Ga0395901_0117245 3300038443 Bacteria 2797
287 Ga0395901_0148614 3300038443 Bacteria 2462
288 Ga0395901_0164250 3300038443 Bacteria 2331
289 Ga0400483_081959 3300039062 Bacteria 6846
290 Ga0400483_262348 3300039062 Bacteria 8840
291 Ga0436365_0012618 3300039437 Bacteria 53643
292 Ga0436365_1660809 3300039437 Bacteria 51972
293 Ga0439450_004606 3300042008 Bacteria 2368
294 Ga0450917_000896 3300042120 Bacteria 2189
295 Ga0450891_000404 3300042129 Bacteria 4525
296 Ga0450892_001485 3300042130 Bacteria 2257
297 Ga0450893_0001386 3300042532 Bacteria 3695
298 Ga0466969_0024345 3300044656 Bacteria 3113
299 Ga0466972_0001589 3300044658 Bacteria 11097
300 Ga0466965_0003109 3300044683 Bacteria 7235
301 Ga0466965_0022718 3300044683 Bacteria 3025
302 Ga0466965_0029512 3300044683 Bacteria 2669
303 Ga0466966_0031487 3300044684 Bacteria 3439
304 Ga0466966_0047422 3300044684 Bacteria 2739
305 Ga0466961_0018984 3300044693 Bacteria 4423
306 Ga0466964_0000328 3300044706 Bacteria 14165
307 Ga0466971_0016636 3300044719 Bacteria 3248
308 Ga0466968_0000248 3300044735 Bacteria 17059
309 Ga0466968_0009937 3300044735 Bacteria 3674
310 Ga0466957_0097887 3300044842 Bacteria 1845
311 Ga0466957_0103911 3300044842 Bacteria 1794
312 Ga0466959_0025228 3300045049 Bacteria 4404
313 Ga0451576_0079446 3300045051 Bacteria 3413
314 Ga0466958_0050341 3300045836 Bacteria 2522
315 Ga0466958_0059013 3300045836 Bacteria 2333
316 Ga0495617_000130 3300046452 Bacteria 49888
317 Ga0495627_000001 3300046453 Bacteria 1104709
318 Ga0495592_0000770 3300046454 Bacteria 22247
319 Ga0495590_0000618 3300046457 Bacteria 16546
320 Ga0495590_0026312 3300046457 Bacteria 2043
321 Ga0495638_0006451 3300046460 Bacteria 8534
322 Ga0495638_0027306 3300046460 Bacteria 3696
323 Ga0495638_0038566 3300046460 Bacteria 3035
324 Ga0495653_0003113 3300046463 Bacteria 13293
325 Ga0495650_0000001 3300046471 Bacteria 1085492
326 Ga0495650_0000827 3300046471 Bacteria 37402
327 Ga0495580_0016123 3300046472 Bacteria 5616
328 Ga0495582_0010922 3300046473 Bacteria 4998
329 Ga0495605_0000073 3300046474 Bacteria 131765
330 Ga0495605_0000104 3300046474 Bacteria 105745
331 Ga0495605_0004058 3300046474 Bacteria 8643
332 Ga0495605_0009955 3300046474 Bacteria 5328
333 Ga0495605_0054890 3300046474 Bacteria 1927
334 Ga0495605_0078900 3300046474 Bacteria 1542
335 Ga0495639_0002880 3300046475 Bacteria 7485
336 Ga0495584_0000002 3300046491 Bacteria 512179
337 Ga0495584_0000034 3300046491 Bacteria 98085
338 Ga0495584_0000317 3300046491 Bacteria 33691
339 Ga0495584_0000793 3300046491 Bacteria 20837
340 Ga0495584_0002866 3300046491 Bacteria 9630
341 Ga0495584_0048895 3300046491 Bacteria 2131
342 Ga0495585_0000002 3300046492 Bacteria 529316
343 Ga0495585_0000346 3300046492 Bacteria 44974
344 Ga0495585_0000735 3300046492 Bacteria 29213
345 Ga0495585_0001180 3300046492 Bacteria 21212
346 Ga0495594_0007632 3300046499 Bacteria 5564
347 Ga0495596_0000017 3300046500 Bacteria 114761
348 Ga0495607_0001142 3300046501 Bacteria 24025
349 Ga0495607_0002148 3300046501 Bacteria 16437
350 Ga0495607_0005357 3300046501 Bacteria 9218
351 Ga0495607_0007861 3300046501 Bacteria 7337
352 Ga0495607_0007948 3300046501 Bacteria 7292
353 Ga0495607_0013111 3300046501 Bacteria 5442
354 Ga0495607_0032605 3300046501 Bacteria 3178
355 Ga0495583_0000008 3300046506 Bacteria 411092
356 Ga0495583_0000009 3300046506 Bacteria 372527
357 Ga0495583_0000053 3300046506 Bacteria 210542
358 Ga0495583_0000098 3300046506 Bacteria 148776
359 Ga0495583_0000133 3300046506 Bacteria 124343
360 Ga0495583_0017678 3300046506 Bacteria 3779
361 Ga0495583_0022838 3300046506 Bacteria 3180
362 Ga0495583_0031855 3300046506 Bacteria 2551
363 Ga0495606_0000049 3300046507 Bacteria 204038
364 Ga0495606_0000062 3300046507 Bacteria 184841
365 Ga0495606_0000152 3300046507 Bacteria 119522
366 Ga0495606_0000774 3300046507 Bacteria 48973
367 Ga0495606_0002108 3300046507 Bacteria 24161
368 Ga0495606_0002332 3300046507 Bacteria 22374
369 Ga0495606_0021681 3300046507 Bacteria 4700
370 Ga0495606_0050333 3300046507 Bacteria 2726
371 Ga0495606_0069011 3300046507 Bacteria 2234
372 Ga0495606_0091549 3300046507 Bacteria 1869
373 Ga0495606_0133202 3300046507 Bacteria 1475
374 Ga0495610_0002130 3300046512 Bacteria 16839
375 Ga0495610_0003130 3300046512 Bacteria 13162
376 Ga0495610_0023015 3300046512 Bacteria 3394
377 Ga0495616_0000034 3300046513 Bacteria 129394
378 Ga0495616_0000705 3300046513 Bacteria 24761
379 Ga0495616_0001810 3300046513 Bacteria 14480
380 Ga0495616_0002630 3300046513 Bacteria 11814
381 Ga0495616_0004158 3300046513 Bacteria 9173
382 Ga0495616_0009960 3300046513 Bacteria 5524
383 Ga0495616_0012678 3300046513 Bacteria 4775
384 Ga0495616_0078286 3300046513 Bacteria 1586
385 Ga0495616_0092085 3300046513 Bacteria 1433
386 Ga0495620_0014632 3300046515 Bacteria 3982
387 Ga0495628_0013477 3300046516 Bacteria 6877
388 Ga0495630_0002965 3300046517 Bacteria 11784
389 Ga0495631_0002821 3300046518 Bacteria 9652
390 Ga0495631_0009263 3300046518 Bacteria 4925
391 Ga0495631_0031476 3300046518 Bacteria 2399
392 Ga0495632_0000018 3300046519 Bacteria 228282
393 Ga0495632_0000029 3300046519 Bacteria 171022
394 Ga0495632_0000056 3300046519 Bacteria 124483
395 Ga0495632_0005429 3300046519 Bacteria 8429
396 Ga0495632_0017149 3300046519 Bacteria 4006
397 Ga0495632_0028528 3300046519 Bacteria 2912
398 Ga0495637_0000051 3300046520 Bacteria 100076
399 Ga0495637_0016198 3300046520 Bacteria 3487
400 Ga0495643_0000011 3300046522 Bacteria 324745
401 Ga0495643_0000172 3300046522 Bacteria 102566
402 Ga0495643_0004446 3300046522 Bacteria 9795
403 Ga0495643_0033501 3300046522 Bacteria 2841
404 Ga0495643_0081924 3300046522 Bacteria 1677
405 Ga0495643_0090982 3300046522 Bacteria 1573
406 Ga0495644_0000478 3300046523 Bacteria 17302
407 Ga0495644_0000862 3300046523 Bacteria 12537
408 Ga0495648_0000027 3300046524 Bacteria 228881
409 Ga0495648_0000401 3300046524 Bacteria 47662
410 Ga0495648_0045122 3300046524 Bacteria 2745
411 Ga0495663_0008229 3300046525 Bacteria 2886
412 Ga0495666_0012850 3300046526 Bacteria 4173
413 Ga0495642_0000349 3300046528 Bacteria 25086
414 Ga0495642_0001348 3300046528 Bacteria 10998
415 Ga0495642_0009462 3300046528 Bacteria 3729
416 Ga0495642_0021212 3300046528 Bacteria 2554
417 Ga0495642_0051457 3300046528 Bacteria 1694
418 Ga0495652_0001226 3300046529 Bacteria 28763
419 Ga0495652_0047030 3300046529 Bacteria 3702
420 Ga0495652_0088092 3300046529 Bacteria 2545
421 Ga0495654_0000011 3300046530 Bacteria 363172
422 Ga0495665_0005839 3300046531 Bacteria 6640
423 Ga0495586_0132694 3300046535 Bacteria 1394
424 Ga0495598_0021857 3300046537 Bacteria 1706
425 Ga0495609_0000095 3300046538 Bacteria 104807
426 Ga0495609_0000180 3300046538 Bacteria 63952
427 Ga0495609_0000227 3300046538 Bacteria 54650
428 Ga0495609_0000653 3300046538 Bacteria 26973
429 Ga0495609_0025937 3300046538 Bacteria 2685
430 Ga0495597_0000073 3300046542 Bacteria 87767
431 Ga0495597_0000102 3300046542 Bacteria 76204
432 Ga0495597_0008250 3300046542 Bacteria 5229
433 Ga0495597_0021537 3300046542 Bacteria 2996
434 Ga0495645_0134659 3300046543 Bacteria 1729
435 Ga0495645_0150077 3300046543 Bacteria 1620
436 Ga0495622_0000001 3300046557 Bacteria 365248
437 Ga0495633_0000091 3300046558 Bacteria 122383
438 Ga0495633_0003288 3300046558 Bacteria 10859
439 Ga0495633_0010266 3300046558 Bacteria 5120
440 Ga0495633_0010666 3300046558 Bacteria 5003
441 Ga0495633_0021080 3300046558 Bacteria 3264
442 Ga0495633_0023181 3300046558 Bacteria 3076
443 Ga0495633_0054745 3300046558 Bacteria 1876
444 Ga0495656_0003970 3300046615 Bacteria 5027
445 Ga0495656_0011500 3300046615 Bacteria 3249
446 Ga0495668_0000077 3300046616 Bacteria 159120
447 Ga0495668_0000091 3300046616 Bacteria 144428
448 Ga0495668_0007138 3300046616 Bacteria 7191
449 Ga0495668_0013403 3300046616 Bacteria 4836
450 Ga0495668_0031385 3300046616 Bacteria 2994
451 Ga0495668_0087447 3300046616 Bacteria 1709
452 Ga0495634_0012602 3300046642 Bacteria 6121
453 Ga0495611_0002992 3300046648 Bacteria 7532
454 Ga0495611_0010758 3300046648 Bacteria 3875
455 Ga0495611_0013349 3300046648 Bacteria 3496
456 Ga0495611_0016737 3300046648 Bacteria 3133
457 Ga0495611_0033998 3300046648 Bacteria 2252
458 Ga0495625_0000623 3300046660 Bacteria 51222
459 Ga0495625_0000631 3300046660 Bacteria 50911
460 Ga0495625_0002081 3300046660 Bacteria 22416
461 Ga0495625_0012847 3300046660 Bacteria 6769
462 Ga0495625_0016043 3300046660 Bacteria 5905
463 Ga0495625_0028909 3300046660 Bacteria 4150
464 Ga0495625_0083381 3300046660 Bacteria 2222
465 Ga0495625_0143185 3300046660 Bacteria 1611
466 Ga0495659_0001127 3300046664 Bacteria 9298
467 Ga0495659_0036098 3300046664 Bacteria 1745
468 Ga0495661_0000012 3300046665 Bacteria 276804
469 Ga0495661_0001746 3300046665 Bacteria 17484
470 Ga0495661_0005236 3300046665 Bacteria 9228
471 Ga0495661_0010354 3300046665 Bacteria 6363
472 Ga0495661_0019019 3300046665 Bacteria 4505
473 Ga0495661_0053449 3300046665 Bacteria 2429
474 Ga0495661_0065632 3300046665 Bacteria 2138
475 Ga0495588_0000099 3300046674 Bacteria 164015
476 Ga0495588_0000118 3300046674 Bacteria 134942
477 Ga0495588_0009889 3300046674 Bacteria 4421
478 Ga0495623_0006366 3300046679 Bacteria 7677
479 Ga0495646_0001427 3300046680 Bacteria 14209
480 Ga0495658_0032150 3300046683 Bacteria 2864
481 Ga0495669_0000243 3300046684 Bacteria 31880
482 Ga0495669_0001370 3300046684 Bacteria 10055
483 Ga0495670_0000155 3300046691 Bacteria 29929
484 Ga0495670_0000860 3300046691 Bacteria 14710
485 Ga0495670_0035838 3300046691 Bacteria 2471
486 Ga0495671_0000119 3300046692 Bacteria 71430
487 Ga0495671_0000594 3300046692 Bacteria 26755
488 Ga0495671_0055845 3300046692 Bacteria 1956
489 Ga0495671_0069604 3300046692 Bacteria 1729
490 Ga0495649_0000545 3300046694 Bacteria 31968
491 Ga0495649_0012426 3300046694 Bacteria 4950
492 Ga0495649_0108733 3300046694 Bacteria 1471
493 Ga0495589_0000007 3300046794 Bacteria 276444
494 Ga0495589_0000082 3300046794 Bacteria 87068
495 Ga0495589_0000091 3300046794 Bacteria 85670
496 Ga0495589_0009695 3300046794 Bacteria 5004
497 Ga0495589_0050394 3300046794 Bacteria 2059
498 Ga0495660_0000024 3300046810 Bacteria 268209
499 Ga0495660_0000050 3300046810 Bacteria 140329
500 Ga0495660_0001319 3300046810 Bacteria 17121
501 Ga0495660_0027636 3300046810 Bacteria 3209
502 Ga0495660_0031527 3300046810 Bacteria 2980
503 Ga0495660_0034382 3300046810 Bacteria 2837
504 Ga0495660_0092150 3300046810 Bacteria 1573
505 Ga0495604_0008330 3300047317 Bacteria 8201
506 Ga0495636_0000294 3300047318 Bacteria 19614
507 Ga0495636_0025058 3300047318 Bacteria 2421
508 Ga0495672_0000023 3300047320 Bacteria 419080
509 Ga0495672_0000091 3300047320 Bacteria 147538
510 Ga0495672_0000222 3300047320 Bacteria 81058
511 Ga0495672_0000274 3300047320 Bacteria 71196
512 Ga0495672_0013311 3300047320 Bacteria 5681
513 Ga0495683_0000308 3300047323 Bacteria 41296
514 Ga0495683_0051662 3300047323 Bacteria 2054
515 Ga0495683_0060964 3300047323 Bacteria 1868
516 Ga0495683_0067748 3300047323 Bacteria 1757
517 Ga0495687_000002 3300047443 Bacteria 1085770
518 Ga0495687_000003 3300047443 Bacteria 859509
519 Ga0495687_000016 3300047443 Bacteria 359237
520 Ga0495687_000097 3300047443 Bacteria 132755
521 Ga0495687_057798 3300047443 Bacteria 1611
522 Ga0495687_057804 3300047443 Bacteria 1611
523 Ga0495675_0003347 3300047444 Bacteria 9651
524 Ga0495677_0000005 3300047445 Bacteria 243336
525 Ga0495677_0002148 3300047445 Bacteria 7805
526 Ga0495677_0002597 3300047445 Bacteria 7066
527 Ga0495677_0002761 3300047445 Bacteria 6849
528 Ga0495677_0013348 3300047445 Bacteria 2989
529 Ga0495679_007291 3300047446 Bacteria 4631
530 Ga0495685_000447 3300047447 Bacteria 12977
531 Ga0495681_0000016 3300047470 Bacteria 181322
532 Ga0495681_0007932 3300047470 Bacteria 6707
533 Ga0495681_0008313 3300047470 Bacteria 6519
534 Ga0495681_0069416 3300047470 Bacteria 1601
535 Ga0495684_0043904 3300047471 Bacteria 3422
536 Ga0495686_0005426 3300047472 Bacteria 10067
537 Ga0495686_0008350 3300047472 Bacteria 7610
538 Ga0495686_0114997 3300047472 Bacteria 1609
539 Ga0495602_0014236 3300048088 Bacteria 8082
540 Ga0495626_0000081 3300048091 Bacteria 128894
541 Ga0495626_0001744 3300048091 Bacteria 16588
542 Ga0495626_0003375 3300048091 Bacteria 10277
543 Ga0495626_0004562 3300048091 Bacteria 8448
544 Ga0495626_0034585 3300048091 Bacteria 2416
545 Ga0496102_0201436 3300048905 Bacteria 1876
546 Ga0496103_0026892 3300048906 Bacteria 3482
547 Ga0496103_0039202 3300048906 Bacteria 2911
548 Ga0496104_0012427 3300048907 Bacteria 7655
549 Ga0496105_0042807 3300048908 Bacteria 3734
550 Ga0496105_0171219 3300048908 Bacteria 1780
551 Ga0496106_0001179 3300048909 Bacteria 19465
552 Ga0496107_0141721 3300048910 Bacteria 1777
553 Ga0496109_0000016 3300048912 Bacteria 212455
554 Ga0496109_0291628 3300048912 Bacteria 1538
555 Ga0496110_0118321 3300048913 Bacteria 2386
556 Ga0496113_0017117 3300048916 Bacteria 5025
557 Ga0496113_0023277 3300048916 Bacteria 4392
558 Ga0496113_0238502 3300048916 Bacteria 1451
559 Ga0496114_0015800 3300048917 Bacteria 6074
560 Ga0496114_0032741 3300048917 Bacteria 4281
561 Ga0496114_0109096 3300048917 Bacteria 2370
562 Ga0496114_0144274 3300048917 Bacteria 2063
563 Ga0496118_0112204 3300048921 Bacteria 1805
564 Ga0496121_0009529 3300048924 Bacteria 11125
565 Ga0496122_0000509 3300048925 Bacteria 80337
566 Ga0496122_0010223 3300048925 Bacteria 9725
567 Ga0496122_0012279 3300048925 Bacteria 8558
568 Ga0496123_0004540 3300048926 Bacteria 14484
569 Ga0496123_0024929 3300048926 Bacteria 4526
570 Ga0496124_0013135 3300048927 Bacteria 8106
571 Ga0496125_0003043 3300048928 Bacteria 20963
572 Ga0495678_000002 3300049459 Bacteria 999613
573 Ga0495678_000038 3300049459 Bacteria 192188
574 Ga0495678_000060 3300049459 Bacteria 142851
575 Ga0495678_001312 3300049459 Bacteria 20025
576 Ga0495678_002370 3300049459 Bacteria 12922
577 Ga0495682_0000035 3300049460 Bacteria 126349
578 Ga0495682_0000041 3300049460 Bacteria 119154
579 Ga0495682_0007543 3300049460 Bacteria 4320
580 Ga0495682_0019415 3300049460 Bacteria 2557
581 Ga0495682_0054819 3300049460 Bacteria 1446
582 Ga0501032_0000949 3300049569 Bacteria 23410
583 Ga0501033_0005130 3300049570 Bacteria 10418
584 Ga0501034_0065018 3300049571 Bacteria 3660
585 Ga0501036_0002105 3300049572 Bacteria 15543
586 Ga0501037_0004413 3300049573 Bacteria 10219
587 Ga0501038_0010034 3300049574 Bacteria 8671
588 Ga0501038_0097601 3300049574 Bacteria 2451
589 Ga0501039_0031084 3300049575 Bacteria 4116
590 Ga0501042_0022503 3300049578 Bacteria 4403
591 Ga0501043_0001717 3300049579 Bacteria 18925
592 Ga0501046_0001953 3300049580 Bacteria 19603
593 Ga0501046_0061126 3300049580 Bacteria 2947
594 Ga0501047_0032685 3300049581 Bacteria 5024
595 Ga0501047_0117541 3300049581 Bacteria 2540
596 Ga0501067_0034033 3300049583 Bacteria 2827
597 Ga0501069_0088192 3300049585 Bacteria 1753
598 Ga0501070_0035755 3300049586 Bacteria 4148
599 Ga0501071_0065370 3300049587 Bacteria 2641
600 Ga0501072_0129747 3300049588 Bacteria 2009
601 Ga0501073_0055571 3300049589 Bacteria 2769
602 Ga0501074_0001065 3300049590 Bacteria 17883
603 Ga0501075_0001896 3300049591 Bacteria 13800
604 Ga0501233_002501 3300049668 Bacteria 3249
605 Ga0501221_003395 3300049704 Bacteria 2617
606 Ga0501080_0014397 3300049742 Bacteria 7284
607 Ga0501080_0084682 3300049742 Bacteria 2945
608 Ga0501083_0001996 3300049744 Bacteria 14037
609 Ga0501083_0028998 3300049744 Bacteria 3811
610 Ga0501267_000405 3300049764 Bacteria 3307
611 Ga0501269_000021 3300049766 Bacteria 53792
612 Ga0501035_0018182 3300049822 Bacteria 6473
613 Ga0501044_0001693 3300049823 Bacteria 25871
614 Ga0501044_0062689 3300049823 Bacteria 3800
615 Ga0501044_0087424 3300049823 Bacteria 3148
616 Ga0501044_0310909 3300049823 Bacteria 1502
617 Ga0501045_0116823 3300049824 Bacteria 1980
618 nmdc:mga0yw44_51919_c1 3300050492 Bacteria 2484
619 nmdc:mga0k408_19234_c1 3300050493 Bacteria 3814
620 nmdc:mga0k408_950_c1 3300050493 Bacteria 11034
621 nmdc:mga06z11_12092_c1 3300050494 Bacteria 3744
622 nmdc:mga06z11_89182_c1 3300050494 Bacteria 1671
623 nmdc:mga07m45_1152_c1 3300050496 Bacteria 11864
624 nmdc:mga05p37_23486_c1 3300050507 Bacteria 7482
625 nmdc:mga05p37_341662_c1 3300050507 Bacteria 1765
626 nmdc:mga05p37_368432_c1 3300050507 Bacteria 1687
627 nmdc:mga05p37_382095_c1 3300050507 Bacteria 1650
628 nmdc:mga09592_153689_c1 3300050508 Bacteria 1986
629 nmdc:mga09592_57522_c1 3300050508 Bacteria 3287
630 nmdc:mga09592_64908_c1 3300050508 Bacteria 3091
631 nmdc:mga06r32_220746_c1 3300050510 Bacteria 1884
632 nmdc:mga06r32_56139_c1 3300050510 Bacteria 3779
633 nmdc:mga06r32_78608_c1 3300050510 Bacteria 3207
634 nmdc:mga08y16_10388_c1 3300050511 Bacteria 9766
635 nmdc:mga08y16_1120_c1 3300050511 Bacteria 26424
636 nmdc:mga08y16_262434_c1 3300050511 Bacteria 1784
637 nmdc:mga08y16_297_c1 3300050511 Bacteria 44732
638 nmdc:mga08y16_73697_c1 3300050511 Bacteria 3557
639 nmdc:mga0n895_9417_c1 3300050512 Bacteria 8545
640 nmdc:mga0rr50_59901_c1 3300050513 Bacteria 2861
641 nmdc:mga0a205_102222_c1 3300050515 Bacteria 2765
642 Ga0495595_0021731 3300053084 Bacteria 2807
643 Ga0495619_0053894 3300053085 Bacteria 2661
644 Ga0500578_0051430 3300053086 Bacteria 2639
645 Ga0500646_0005149 3300053090 Bacteria 3309
646 Ga0500641_0002966 3300053096 Bacteria 6010
647 Ga0500641_0007221 3300053096 Bacteria 3961
648 Ga0500595_001574 3300053119 Bacteria 12062
649 Ga0500618_000052 3300053125 Bacteria 102436
650 Ga0500618_000149 3300053125 Bacteria 57395
651 Ga0500642_0000150 3300053130 Bacteria 29542
652 Ga0500652_049146 3300053131 Bacteria 1718
653 Ga0500568_0004233 3300053139 Bacteria 7722
654 Ga0500568_0005301 3300053139 Bacteria 6695
655 Ga0500586_003036 3300053145 Bacteria 3903
656 Ga0500604_0013246 3300053151 Bacteria 2232
657 Ga0500616_0001920 3300053153 Bacteria 18568
658 Ga0500637_0011482 3300053178 Bacteria 4585
659 Ga0500645_000442 3300053730 Bacteria 28390
660 Ga0501084_0038643 3300054114 Bacteria 3990
661 Ga0590071_000519 3300059421 Bacteria 11238
662 Ga0590074_001524 3300059423 Bacteria 3753
663 Ga0590075_000902 3300059424 Bacteria 7742
664 Ga0590077_000519 3300059426 Bacteria 10643
665 Ga0501082_0001089 3300060353 Bacteria 24038
666 Ga0501082_0011196 3300060353 Bacteria 7708
667 Ga0501082_0062591 3300060353 Bacteria 3203
668 Ga0501082_0242386 3300060353 Bacteria 1569
669 Ga0466962_0002626 3300061719 Bacteria 8545
670 Ga0466962_0011993 3300061719 Bacteria 4169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10210187 Ga0157374_102101871 349
2 3300026067 Ga0207678_10064323 Ga0207678_100643232 374
3 3300046501 Ga0495607_0013111 Ga0495607_0013111_4271_5395 374
4 3300046506 Ga0495583_0031855 Ga0495583_0031855_1403_2527 374
5 3300046691 Ga0495670_0000860 Ga0495670_0000860_23_1147 374
6 3300048912 Ga0496109_0291628 Ga0496109_0291628_15_1139 374
7 3300046660 Ga0495625_0083381 Ga0495625_0083381_1063_2208 381
8 3300030522 Ga0307512_10011207 Ga0307512_100112072 387
9 3300046454 Ga0495592_0000770 Ga0495592_0000770_4752_6041 391
10 3300046501 Ga0495607_0032605 Ga0495607_0032605_1738_3030 399
11 3300046513 Ga0495616_0004158 Ga0495616_0004158_4418_5782 399
12 3300046538 Ga0495609_0000227 Ga0495609_0000227_31478_32842 399
13 3300037418 Ga0395900_0128182 Ga0395900_0128182_1385_2590 401
14 3300046460 Ga0495638_0038566 Ga0495638_0038566_1339_2631 407
15 3300046491 Ga0495584_0002866 Ga0495584_0002866_1516_2880 407
16 3300046506 Ga0495583_0017678 Ga0495583_0017678_1549_2913 407
17 3300046507 Ga0495606_0021681 Ga0495606_0021681_2236_3531 407
18 3300046616 Ga0495668_0007138 Ga0495668_0007138_5369_6733 407
19 3300046660 Ga0495625_0012847 Ga0495625_0012847_5329_6621 407
20 3300046664 Ga0495659_0001127 Ga0495659_0001127_2858_4222 407
21 3300046684 Ga0495669_0000243 Ga0495669_0000243_24307_25671 407
22 3300046694 Ga0495649_0012426 Ga0495649_0012426_212_1576 407
23 3300046810 Ga0495660_0001319 Ga0495660_0001319_1937_3232 407
24 3300047470 Ga0495681_0008313 Ga0495681_0008313_1782_3146 407
25 3300046558 Ga0495633_0010666 Ga0495633_0010666_2525_3820 412
26 3300053145 Ga0500586_003036 Ga0500586_003036_478_1773 412
27 3300046522 Ga0495643_0000011 Ga0495643_0000011_281975_283270 413
28 3300046524 Ga0495648_0045122 Ga0495648_0045122_908_2203 413
29 3300046616 Ga0495668_0013403 Ga0495668_0013403_2601_3890 413
30 3300046660 Ga0495625_0002081 Ga0495625_0002081_2508_3803 413
31 3300047320 Ga0495672_0000274 Ga0495672_0000274_28655_29950 413
32 3300049459 Ga0495678_000038 Ga0495678_000038_149543_150838 413
33 3300046506 Ga0495583_0000133 Ga0495583_0000133_46176_47465 414
34 3300046507 Ga0495606_0000774 Ga0495606_0000774_19565_20860 414
35 3300046507 Ga0495606_0002332 Ga0495606_0002332_1411_2700 414
36 3300046692 Ga0495671_0055845 Ga0495671_0055845_577_1872 414
37 3300046694 Ga0495649_0000545 Ga0495649_0000545_2699_3988 414
38 3300046694 Ga0495649_0108733 Ga0495649_0108733_45_1340 414
39 3300046794 Ga0495589_0009695 Ga0495589_0009695_2174_3463 414
40 3300046692 Ga0495671_0000119 Ga0495671_0000119_55761_57056 415
41 3300047320 Ga0495672_0000023 Ga0495672_0000023_337212_338507 415
42 3300059421 Ga0590071_000519 Ga0590071_000519_852_2144 417
43 3300059423 Ga0590074_001524 Ga0590074_001524_2372_3664 417
44 3300059424 Ga0590075_000902 Ga0590075_000902_6222_7514 417
45 3300059426 Ga0590077_000519 Ga0590077_000519_3040_4332 417
46 3300044656 Ga0466969_0024345 Ga0466969_0024345_385_1677 419
47 3300044683 Ga0466965_0003109 Ga0466965_0003109_1459_2751 419
48 3300044684 Ga0466966_0047422 Ga0466966_0047422_1334_2626 419
49 3300044693 Ga0466961_0018984 Ga0466961_0018984_153_1445 419
50 3300044719 Ga0466971_0016636 Ga0466971_0016636_738_2030 419
51 3300044735 Ga0466968_0009937 Ga0466968_0009937_51_1343 419
52 3300045049 Ga0466959_0025228 Ga0466959_0025228_2169_3461 419
53 3300045836 Ga0466958_0059013 Ga0466958_0059013_533_1825 419
54 3300046457 Ga0495590_0000618 Ga0495590_0000618_5645_6940 419
55 3300046463 Ga0495653_0003113 Ga0495653_0003113_11040_12335 419
56 3300046472 Ga0495580_0016123 Ga0495580_0016123_203_1498 419
57 3300046473 Ga0495582_0010922 Ga0495582_0010922_1604_2899 419
58 3300046499 Ga0495594_0007632 Ga0495594_0007632_696_1991 419
59 3300046507 Ga0495606_0069011 Ga0495606_0069011_535_1830 419
60 3300046517 Ga0495630_0002965 Ga0495630_0002965_9772_11067 419
61 3300046526 Ga0495666_0012850 Ga0495666_0012850_1339_2634 419
62 3300046529 Ga0495652_0047030 Ga0495652_0047030_2302_3597 419
63 3300046531 Ga0495665_0005839 Ga0495665_0005839_5086_6381 419
64 3300046535 Ga0495586_0132694 Ga0495586_0132694_46_1341 419
65 3300046642 Ga0495634_0012602 Ga0495634_0012602_2769_4064 419
66 3300046679 Ga0495623_0006366 Ga0495623_0006366_5612_6907 419
67 3300047317 Ga0495604_0008330 Ga0495604_0008330_6399_7694 419
68 3300047444 Ga0495675_0003347 Ga0495675_0003347_1896_3191 419
69 3300061719 Ga0466962_0002626 Ga0466962_0002626_5484_6776 419
70 3300046519 Ga0495632_0000056 Ga0495632_0000056_46150_47445 421
71 3300046528 Ga0495642_0001348 Ga0495642_0001348_1878_3173 421
72 3300046684 Ga0495669_0001370 Ga0495669_0001370_65_1360 421
73 3300006844 Ga0075428_100035039 Ga0075428_1000350392 422
74 3300009147 Ga0114129_10150799 Ga0114129_101507992 422
75 3300046474 Ga0495605_0004058 Ga0495605_0004058_26_1294 422
76 3300031730 Ga0307516_10000424 Ga0307516_1000042439 423
77 3300046475 Ga0495639_0002880 Ga0495639_0002880_635_1924 423
78 3300046529 Ga0495652_0088092 Ga0495652_0088092_594_1883 423
79 3300046648 Ga0495611_0033998 Ga0495611_0033998_836_2128 423
80 3300050507 nmdc:mga05p37_341662_c1 nmdc:mga05p37_341662_c1_276_1568 423
81 3300037853 Ga0436364_0978054 Ga0436364_0978054_1819_3123 426
82 3300005435 Ga0070714_100039841 Ga0070714_1000398412 427
83 iso_pu_bacteria 2548876994 2550696115 427
84 iso_pu_bacteria 2600255292 2601671518 427
85 iso_pu_bacteria 2643221544 2643743024 427
86 iso_pu_bacteria 2643221556 2643800785 427
87 iso_pu_bacteria 2643221645 2644252922 427
88 iso_pu_bacteria 2643221646 2644260456 427
89 iso_pu_bacteria 2643221664 2644355031 427
90 iso_pu_bacteria 2643221684 2644471015 427
91 iso_pu_bacteria 2738541280 2738737814 427
92 iso_pu_bacteria 2738541300 2738842021 427
93 iso_pu_bacteria 2738541337 2739055879 427
94 iso_pu_bacteria 2738543018 2739272880 427
95 iso_pu_bacteria 2738543030 2739341924 427
96 iso_pu_bacteria 2765235838 2765567920 427
97 iso_pu_bacteria 2839094727 2839097792 427
98 iso_pu_bacteria 2842711865 2842713487 427
99 iso_pu_bacteria 2857547612 2857548648 427
100 iso_pu_bacteria 2857553236 2857555252 427
101 iso_pu_bacteria 2857558681 2857561408 427
102 iso_pu_bacteria 2857564685 2857566450 427
103 iso_pu_bacteria 2857564685 2857568651 427
104 iso_pu_bacteria 2904424332 2904424684 427
105 iso_pu_bacteria 2919476304 2919477616 427
106 iso_pu_bacteria 2928130867 2928132849 427
107 iso_pu_bacteria 8047673197 8047677328 427
108 3300005295 Ga0065707_10002256 Ga0065707_100022564 428
109 3300005467 Ga0070706_100027367 Ga0070706_1000273672 428
110 3300005545 Ga0070695_100005464 Ga0070695_1000054642 428
111 3300005546 Ga0070696_100105038 Ga0070696_1001050382 428
112 3300006178 Ga0075367_10086429 Ga0075367_100864292 428
113 3300006844 Ga0075428_100208492 Ga0075428_1002084922 428
114 3300006846 Ga0075430_100123245 Ga0075430_1001232452 428
115 3300009094 Ga0111539_10014758 Ga0111539_100147583 428
116 3300009147 Ga0114129_10068358 Ga0114129_100683583 428
117 3300014326 Ga0157380_10011050 Ga0157380_100110503 428
118 3300025885 Ga0207653_10020529 Ga0207653_100205292 428
119 3300025910 Ga0207684_10002300 Ga0207684_1000230011 428
120 3300025922 Ga0207646_10006553 Ga0207646_100065534 428
121 3300026118 Ga0207675_100068100 Ga0207675_1000681001 428
122 3300028380 Ga0268265_10028333 Ga0268265_100283333 428
123 3300031090 Ga0265760_10026782 Ga0265760_100267821 428
124 3300031251 Ga0265327_10026312 Ga0265327_100263122 428
125 3300031548 Ga0307408_100000112 Ga0307408_10000011210 428
126 3300031901 Ga0307406_10009213 Ga0307406_100092132 428
127 3300044842 Ga0466957_0097887 Ga0466957_0097887_298_1584 428
128 3300048921 Ga0496118_0112204 Ga0496118_0112204_266_1558 428
129 3300048924 Ga0496121_0009529 Ga0496121_0009529_2981_4273 428
130 3300049578 Ga0501042_0022503 Ga0501042_0022503_1920_3212 428
131 3300049587 Ga0501071_0065370 Ga0501071_0065370_879_2171 428
132 3300049591 Ga0501075_0001896 Ga0501075_0001896_6788_8080 428
133 3300050494 nmdc:mga06z11_12092_c1 nmdc:mga06z11_12092_c1_1947_3248 428
134 3300050494 nmdc:mga06z11_89182_c1 nmdc:mga06z11_89182_c1_163_1464 428
135 3300050507 nmdc:mga05p37_368432_c1 nmdc:mga05p37_368432_c1_198_1490 428
136 3300050508 nmdc:mga09592_64908_c1 nmdc:mga09592_64908_c1_1283_2575 428
137 3300050511 nmdc:mga08y16_10388_c1 nmdc:mga08y16_10388_c1_501_1793 428
138 3300050511 nmdc:mga08y16_73697_c1 nmdc:mga08y16_73697_c1_2072_3364 428
139 3300053139 Ga0500568_0005301 Ga0500568_0005301_745_2046 428
140 3300053730 Ga0500645_000442 Ga0500645_000442_503_1795 428
141 3300060353 Ga0501082_0011196 Ga0501082_0011196_6399_7691 428
142 3300060353 Ga0501082_0242386 Ga0501082_0242386_224_1516 428
143 iso_pu_bacteria 2643221585 2643932955 428
144 iso_pu_bacteria 2643221639 2644218561 428
145 iso_pu_bacteria 2643221656 2644314205 428
146 iso_pu_bacteria 2808606418 2809143688 428
147 3300005365 Ga0070688_100019455 Ga0070688_1000194552 429
148 3300005445 Ga0070708_100015369 Ga0070708_1000153692 429
149 3300005466 Ga0070685_10022916 Ga0070685_100229162 429
150 3300005536 Ga0070697_100143412 Ga0070697_1001434121 429
151 3300005617 Ga0068859_100157892 Ga0068859_1001578922 429
152 3300005841 Ga0068863_100133007 Ga0068863_1001330072 429
153 3300005842 Ga0068858_100072239 Ga0068858_1000722392 429
154 3300005843 Ga0068860_100012371 Ga0068860_1000123714 429
155 3300005844 Ga0068862_100273970 Ga0068862_1002739702 429
156 3300006931 Ga0097620_100157873 Ga0097620_1001578732 429
157 3300009094 Ga0111539_10000785 Ga0111539_1000078511 429
158 3300009148 Ga0105243_10016945 Ga0105243_100169452 429
159 3300009177 Ga0105248_10174437 Ga0105248_101744372 429
160 3300014968 Ga0157379_10006872 Ga0157379_100068725 429
161 3300014968 Ga0157379_10175163 Ga0157379_101751632 429
162 3300017792 Ga0163161_10129311 Ga0163161_101293112 429
163 3300025297 Ga0209758_1000304 Ga0209758_100030444 429
164 3300025910 Ga0207684_10114987 Ga0207684_101149872 429
165 3300025940 Ga0207691_10047614 Ga0207691_100476142 429
166 3300025942 Ga0207689_10078668 Ga0207689_100786682 429
167 3300026075 Ga0207708_10003897 Ga0207708_100038974 429
168 3300026075 Ga0207708_10008452 Ga0207708_100084523 429
169 3300026089 Ga0207648_10007383 Ga0207648_100073835 429
170 3300026089 Ga0207648_10073127 Ga0207648_100731272 429
171 3300026118 Ga0207675_100017764 Ga0207675_1000177642 429
172 3300026118 Ga0207675_100035141 Ga0207675_1000351412 429
173 3300026121 Ga0207683_10030940 Ga0207683_100309402 429
174 3300027907 Ga0207428_10000543 Ga0207428_1000054328 429
175 3300028379 Ga0268266_10254080 Ga0268266_102540802 429
176 3300028380 Ga0268265_10070553 Ga0268265_100705532 429
177 3300046507 Ga0495606_0000062 Ga0495606_0000062_60627_61916 429
178 3300046512 Ga0495610_0002130 Ga0495610_0002130_14686_15975 429
179 3300046516 Ga0495628_0013477 Ga0495628_0013477_3010_4335 429
180 3300046616 Ga0495668_0000091 Ga0495668_0000091_83895_85184 429
181 3300046660 Ga0495625_0000623 Ga0495625_0000623_9162_10451 429
182 3300047318 Ga0495636_0025058 Ga0495636_0025058_47_1342 429
183 3300047471 Ga0495684_0043904 Ga0495684_0043904_1687_3012 429
184 3300047472 Ga0495686_0005426 Ga0495686_0005426_7722_9011 429
185 3300050492 nmdc:mga0yw44_51919_c1 nmdc:mga0yw44_51919_c1_990_2285 429
186 3300050493 nmdc:mga0k408_19234_c1 nmdc:mga0k408_19234_c1_1735_3027 429
187 3300050493 nmdc:mga0k408_950_c1 nmdc:mga0k408_950_c1_5120_6415 429
188 3300050508 nmdc:mga09592_57522_c1 nmdc:mga09592_57522_c1_657_1952 429
189 3300050511 nmdc:mga08y16_297_c1 nmdc:mga08y16_297_c1_14566_15861 429
190 3300053096 Ga0500641_0007221 Ga0500641_0007221_1471_2766 429
191 3300053131 Ga0500652_049146 Ga0500652_049146_126_1421 429
192 3300002774 JGI25150J39212_1001652 JGI25150J39212_10016523 430
193 3300002987 JGI25159J45721_1008823 JGI25159J45721_10088232 430
194 3300003316 rootH1_10004214 rootH1_1000421424 430
195 3300003322 rootL2_10042461 rootL2_100424612 430
196 3300003374 JGI25161J50226_1007707 JGI25161J50226_10077072 430
197 3300003771 Ga0055526_1001585 Ga0055526_10015856 430
198 3300003771 Ga0055526_1015106 Ga0055526_10151062 430
199 3300003773 Ga0055537_1000076 Ga0055537_100007611 430
200 3300003773 Ga0055537_1000260 Ga0055537_100026012 430
201 3300003773 Ga0055537_1007956 Ga0055537_10079562 430
202 3300003784 Ga0055534_1000124 Ga0055534_100012427 430
203 3300003790 Ga0055528_1000184 Ga0055528_100018412 430
204 3300003791 Ga0055530_10012976 Ga0055530_100129762 430
205 3300003794 Ga0055531_10010104 Ga0055531_100101045 430
206 3300004625 Ga0055543_1003564 Ga0055543_10035642 430
207 3300004625 Ga0055543_1013926 Ga0055543_10139261 430
208 3300005262 Ga0065165_1000003 Ga0065165_100000392 430
209 3300005290 Ga0065712_10000210 Ga0065712_1000021012 430
210 3300005293 Ga0065715_10000337 Ga0065715_1000033712 430
211 3300005331 Ga0070670_100185195 Ga0070670_1001851951 430
212 3300005337 Ga0070682_100025657 Ga0070682_1000256572 430
213 3300005355 Ga0070671_100098835 Ga0070671_1000988352 430
214 3300005365 Ga0070688_100071504 Ga0070688_1000715042 430
215 3300005456 Ga0070678_100012011 Ga0070678_1000120114 430
216 3300005459 Ga0068867_100212296 Ga0068867_1002122961 430
217 3300005466 Ga0070685_10094148 Ga0070685_100941481 430
218 3300005468 Ga0070707_100014591 Ga0070707_1000145912 430
219 3300005471 Ga0070698_100090482 Ga0070698_1000904822 430
220 3300005518 Ga0070699_100224209 Ga0070699_1002242091 430
221 3300005535 Ga0070684_100016773 Ga0070684_1000167733 430
222 3300005543 Ga0070672_100001959 Ga0070672_10000195912 430
223 3300005548 Ga0070665_100009834 Ga0070665_1000098346 430
224 3300005564 Ga0070664_100111149 Ga0070664_1001111492 430
225 3300005614 Ga0068856_100111352 Ga0068856_1001113522 430
226 3300005616 Ga0068852_100216024 Ga0068852_1002160242 430
227 3300005937 Ga0081455_10005188 Ga0081455_100051884 430
228 3300005985 Ga0081539_10006080 Ga0081539_100060808 430
229 3300006847 Ga0075431_100060018 Ga0075431_1000600182 430
230 3300006948 Ga0099826_10000008 Ga0099826_10000008368 430
231 3300007076 Ga0075435_100070028 Ga0075435_1000700282 430
232 3300009094 Ga0111539_10106201 Ga0111539_101062012 430
233 3300009147 Ga0114129_10179124 Ga0114129_101791242 430
234 3300009147 Ga0114129_10212096 Ga0114129_102120962 430
235 3300009147 Ga0114129_10238102 Ga0114129_102381022 430
236 3300009148 Ga0105243_10139218 Ga0105243_101392181 430
237 3300009176 Ga0105242_10198129 Ga0105242_101981292 430
238 3300009177 Ga0105248_10035248 Ga0105248_100352483 430
239 3300013306 Ga0163162_10256688 Ga0163162_102566882 430
240 3300013308 Ga0157375_10060661 Ga0157375_100606612 430
241 3300013308 Ga0157375_10349907 Ga0157375_103499071 430
242 3300014968 Ga0157379_10028145 Ga0157379_100281452 430
243 3300017792 Ga0163161_10010148 Ga0163161_100101482 430
244 3300025208 Ga0209436_100320 Ga0209436_10032015 430
245 3300025208 Ga0209436_111731 Ga0209436_1117311 430
246 3300025245 Ga0207425_1000110 Ga0207425_100011019 430
247 3300025258 Ga0209129_1001089 Ga0209129_100108911 430
248 3300025263 Ga0209565_1000018 Ga0209565_1000018299 430
249 3300025263 Ga0209565_1001274 Ga0209565_10012746 430
250 3300025263 Ga0209565_1001275 Ga0209565_10012756 430
251 3300025273 Ga0209673_1000006 Ga0209673_1000006473 430
252 3300025273 Ga0209673_1008901 Ga0209673_10089014 430
253 3300025284 Ga0209130_1000036 Ga0209130_1000036238 430
254 3300025284 Ga0209130_1014739 Ga0209130_10147392 430
255 3300025284 Ga0209130_1019582 Ga0209130_10195822 430
256 3300025291 Ga0209675_1000005 Ga0209675_1000005299 430
257 3300025291 Ga0209675_1002720 Ga0209675_10027205 430
258 3300025292 Ga0209676_1008457 Ga0209676_10084572 430
259 3300025295 Ga0209564_1000144 Ga0209564_100014437 430
260 3300025295 Ga0209564_1006481 Ga0209564_10064816 430
261 3300025297 Ga0209758_1000048 Ga0209758_1000048254 430
262 3300025297 Ga0209758_1018730 Ga0209758_10187303 430
263 3300025298 Ga0209050_1000519 Ga0209050_100051919 430
264 3300025298 Ga0209050_1003570 Ga0209050_10035702 430
265 3300025298 Ga0209050_1004809 Ga0209050_10048093 430
266 3300025299 Ga0209256_1000018 Ga0209256_1000018376 430
267 3300025299 Ga0209256_1000325 Ga0209256_100032551 430
268 3300025299 Ga0209256_1003732 Ga0209256_10037326 430
269 3300025299 Ga0209256_1003816 Ga0209256_10038165 430
270 3300025302 Ga0207426_1003756 Ga0207426_10037562 430
271 3300025302 Ga0207426_1037090 Ga0207426_10370902 430
272 3300025304 Ga0209257_1000123 Ga0209257_100012370 430
273 3300025304 Ga0209257_1000237 Ga0209257_10002374 430
274 3300025304 Ga0209257_1016477 Ga0209257_10164772 430
275 3300025906 Ga0207699_10046414 Ga0207699_100464142 430
276 3300025922 Ga0207646_10018507 Ga0207646_100185073 430
277 3300026089 Ga0207648_10285810 Ga0207648_102858101 430
278 3300026095 Ga0207676_10006868 Ga0207676_100068682 430
279 3300027666 Ga0209282_1000005 Ga0209282_1000005366 430
280 3300027907 Ga0207428_10009786 Ga0207428_100097861 430
281 3300030521 Ga0307511_10002924 Ga0307511_1000292415 430
282 3300031456 Ga0307513_10052728 Ga0307513_100527282 430
283 3300031507 Ga0307509_10043511 Ga0307509_100435113 430
284 3300031548 Ga0307408_100001881 Ga0307408_1000018812 430
285 3300031548 Ga0307408_100004065 Ga0307408_1000040652 430
286 3300037471 Ga0395905_0000071 Ga0395905_0000071_166563_167861 430
287 3300039062 Ga0400483_081959 Ga0400483_081959_4541_5839 430
288 3300039062 Ga0400483_262348 Ga0400483_262348_613_1911 430
289 3300042120 Ga0450917_000896 Ga0450917_000896_801_2096 430
290 3300042129 Ga0450891_000404 Ga0450891_000404_2449_3744 430
291 3300042130 Ga0450892_001485 Ga0450892_001485_497_1792 430
292 3300042532 Ga0450893_0001386 Ga0450893_0001386_302_1597 430
293 3300045051 Ga0451576_0079446 Ga0451576_0079446_1838_3133 430
294 3300046474 Ga0495605_0054890 Ga0495605_0054890_248_1540 430
295 3300046501 Ga0495607_0007861 Ga0495607_0007861_3964_5256 430
296 3300046506 Ga0495583_0000008 Ga0495583_0000008_32027_33319 430
297 3300046506 Ga0495583_0000098 Ga0495583_0000098_70041_71333 430
298 3300046513 Ga0495616_0009960 Ga0495616_0009960_1148_2440 430
299 3300046519 Ga0495632_0005429 Ga0495632_0005429_4018_5310 430
300 3300046522 Ga0495643_0000172 Ga0495643_0000172_974_2266 430
301 3300046522 Ga0495643_0081924 Ga0495643_0081924_193_1485 430
302 3300046542 Ga0495597_0021537 Ga0495597_0021537_1305_2597 430
303 3300046615 Ga0495656_0003970 Ga0495656_0003970_1359_2651 430
304 3300046648 Ga0495611_0010758 Ga0495611_0010758_1418_2710 430
305 3300046665 Ga0495661_0005236 Ga0495661_0005236_3429_4721 430
306 3300046665 Ga0495661_0010354 Ga0495661_0010354_2472_3764 430
307 3300046683 Ga0495658_0032150 Ga0495658_0032150_1135_2433 430
308 3300046810 Ga0495660_0034382 Ga0495660_0034382_651_1943 430
309 3300047318 Ga0495636_0000294 Ga0495636_0000294_17808_19100 430
310 3300047445 Ga0495677_0002597 Ga0495677_0002597_3059_4351 430
311 3300047445 Ga0495677_0002761 Ga0495677_0002761_4376_5668 430
312 3300047446 Ga0495679_007291 Ga0495679_007291_1278_2570 430
313 3300047470 Ga0495681_0069416 Ga0495681_0069416_54_1346 430
314 3300048906 Ga0496103_0039202 Ga0496103_0039202_253_1545 430
315 3300048907 Ga0496104_0012427 Ga0496104_0012427_4700_5998 430
316 3300048908 Ga0496105_0042807 Ga0496105_0042807_1255_2553 430
317 3300048912 Ga0496109_0000016 Ga0496109_0000016_116685_117983 430
318 3300048913 Ga0496110_0118321 Ga0496110_0118321_530_1828 430
319 3300048917 Ga0496114_0015800 Ga0496114_0015800_4256_5554 430
320 3300048917 Ga0496114_0032741 Ga0496114_0032741_2855_4153 430
321 3300049459 Ga0495678_002370 Ga0495678_002370_6213_7505 430
322 3300049569 Ga0501032_0000949 Ga0501032_0000949_13858_15156 430
323 3300049570 Ga0501033_0005130 Ga0501033_0005130_6858_8156 430
324 3300049571 Ga0501034_0065018 Ga0501034_0065018_152_1450 430
325 3300049572 Ga0501036_0002105 Ga0501036_0002105_8746_10044 430
326 3300049573 Ga0501037_0004413 Ga0501037_0004413_1829_3127 430
327 3300049574 Ga0501038_0010034 Ga0501038_0010034_6024_7322 430
328 3300049574 Ga0501038_0097601 Ga0501038_0097601_746_2044 430
329 3300049575 Ga0501039_0031084 Ga0501039_0031084_1318_2616 430
330 3300049579 Ga0501043_0001717 Ga0501043_0001717_1502_2800 430
331 3300049580 Ga0501046_0001953 Ga0501046_0001953_1122_2420 430
332 3300049580 Ga0501046_0061126 Ga0501046_0061126_402_1700 430
333 3300049581 Ga0501047_0032685 Ga0501047_0032685_3674_4972 430
334 3300049581 Ga0501047_0117541 Ga0501047_0117541_1081_2379 430
335 3300049583 Ga0501067_0034033 Ga0501067_0034033_1512_2810 430
336 3300049585 Ga0501069_0088192 Ga0501069_0088192_147_1445 430
337 3300049586 Ga0501070_0035755 Ga0501070_0035755_1349_2647 430
338 3300049588 Ga0501072_0129747 Ga0501072_0129747_113_1411 430
339 3300049589 Ga0501073_0055571 Ga0501073_0055571_243_1541 430
340 3300049590 Ga0501074_0001065 Ga0501074_0001065_272_1570 430
341 3300049668 Ga0501233_002501 Ga0501233_002501_608_1903 430
342 3300049704 Ga0501221_003395 Ga0501221_003395_1023_2318 430
343 3300049742 Ga0501080_0014397 Ga0501080_0014397_5155_6453 430
344 3300049742 Ga0501080_0084682 Ga0501080_0084682_299_1597 430
345 3300049744 Ga0501083_0001996 Ga0501083_0001996_3501_4799 430
346 3300049744 Ga0501083_0028998 Ga0501083_0028998_113_1411 430
347 3300049764 Ga0501267_000405 Ga0501267_000405_1802_3097 430
348 3300049822 Ga0501035_0018182 Ga0501035_0018182_3719_5017 430
349 3300049823 Ga0501044_0001693 Ga0501044_0001693_8615_9913 430
350 3300049823 Ga0501044_0087424 Ga0501044_0087424_1287_2585 430
351 3300049823 Ga0501044_0310909 Ga0501044_0310909_115_1413 430
352 3300049824 Ga0501045_0116823 Ga0501045_0116823_262_1569 430
353 3300050507 nmdc:mga05p37_23486_c1 nmdc:mga05p37_23486_c1_3517_4815 430
354 3300050507 nmdc:mga05p37_382095_c1 nmdc:mga05p37_382095_c1_88_1386 430
355 3300050510 nmdc:mga06r32_220746_c1 nmdc:mga06r32_220746_c1_125_1423 430
356 3300050510 nmdc:mga06r32_56139_c1 nmdc:mga06r32_56139_c1_1464_2762 430
357 3300050510 nmdc:mga06r32_78608_c1 nmdc:mga06r32_78608_c1_276_1574 430
358 3300050511 nmdc:mga08y16_1120_c1 nmdc:mga08y16_1120_c1_834_2132 430
359 3300050512 nmdc:mga0n895_9417_c1 nmdc:mga0n895_9417_c1_4366_5664 430
360 3300050513 nmdc:mga0rr50_59901_c1 nmdc:mga0rr50_59901_c1_468_1766 430
361 3300050515 nmdc:mga0a205_102222_c1 nmdc:mga0a205_102222_c1_1229_2527 430
362 3300053084 Ga0495595_0021731 Ga0495595_0021731_1366_2664 430
363 3300053085 Ga0495619_0053894 Ga0495619_0053894_700_1998 430
364 3300053086 Ga0500578_0051430 Ga0500578_0051430_1094_2392 430
365 3300053090 Ga0500646_0005149 Ga0500646_0005149_328_1626 430
366 3300053096 Ga0500641_0002966 Ga0500641_0002966_268_1566 430
367 3300053119 Ga0500595_001574 Ga0500595_001574_5027_6325 430
368 3300053130 Ga0500642_0000150 Ga0500642_0000150_19588_20886 430
369 3300053139 Ga0500568_0004233 Ga0500568_0004233_4111_5409 430
370 3300053151 Ga0500604_0013246 Ga0500604_0013246_269_1567 430
371 3300053153 Ga0500616_0001920 Ga0500616_0001920_16350_17648 430
372 3300053178 Ga0500637_0011482 Ga0500637_0011482_1187_2494 430
373 3300054114 Ga0501084_0038643 Ga0501084_0038643_1862_3160 430
374 3300060353 Ga0501082_0001089 Ga0501082_0001089_5922_7220 430
375 3300060353 Ga0501082_0062591 Ga0501082_0062591_1516_2814 430
376 3300002774 JGI25150J39212_1001281 JGI25150J39212_10012813 431
377 3300003215 JGI25153J46596_10020644 JGI25153J46596_100206442 431
378 3300003322 rootL2_10030166 rootL2_100301662 431
379 3300003759 Ga0055525_1000136 Ga0055525_100013640 431
380 3300005290 Ga0065712_10000508 Ga0065712_100005087 431
381 3300005295 Ga0065707_10115084 Ga0065707_101150841 431
382 3300005327 Ga0070658_10177764 Ga0070658_101777642 431
383 3300005327 Ga0070658_10232746 Ga0070658_102327461 431
384 3300005330 Ga0070690_100005110 Ga0070690_1000051102 431
385 3300005330 Ga0070690_100042208 Ga0070690_1000422081 431
386 3300005331 Ga0070670_100006570 Ga0070670_1000065701 431
387 3300005344 Ga0070661_100076251 Ga0070661_1000762511 431
388 3300005345 Ga0070692_10030775 Ga0070692_100307752 431
389 3300005355 Ga0070671_100169022 Ga0070671_1001690221 431
390 3300005355 Ga0070671_100256317 Ga0070671_1002563172 431
391 3300005366 Ga0070659_100076514 Ga0070659_1000765142 431
392 3300005366 Ga0070659_100164420 Ga0070659_1001644202 431
393 3300005406 Ga0070703_10000142 Ga0070703_1000014213 431
394 3300005441 Ga0070700_100015632 Ga0070700_1000156323 431
395 3300005444 Ga0070694_100009689 Ga0070694_1000096892 431
396 3300005444 Ga0070694_100046083 Ga0070694_1000460832 431
397 3300005444 Ga0070694_100066573 Ga0070694_1000665731 431
398 3300005444 Ga0070694_100094257 Ga0070694_1000942572 431
399 3300005445 Ga0070708_100053681 Ga0070708_1000536812 431
400 3300005457 Ga0070662_100147745 Ga0070662_1001477452 431
401 3300005458 Ga0070681_10041961 Ga0070681_100419612 431
402 3300005468 Ga0070707_100004141 Ga0070707_1000041418 431
403 3300005536 Ga0070697_100000726 Ga0070697_1000007268 431
404 3300005544 Ga0070686_100015305 Ga0070686_1000153053 431
405 3300005544 Ga0070686_100072163 Ga0070686_1000721631 431
406 3300005546 Ga0070696_100059126 Ga0070696_1000591261 431
407 3300005549 Ga0070704_100040495 Ga0070704_1000404952 431
408 3300005563 Ga0068855_100000220 Ga0068855_10000022050 431
409 3300005563 Ga0068855_100106818 Ga0068855_1001068182 431
410 3300005577 Ga0068857_100041485 Ga0068857_1000414851 431
411 3300005614 Ga0068856_100050059 Ga0068856_1000500593 431
412 3300005617 Ga0068859_100025593 Ga0068859_1000255932 431
413 3300005617 Ga0068859_100111261 Ga0068859_1001112612 431
414 3300005834 Ga0068851_10041992 Ga0068851_100419921 431
415 3300005841 Ga0068863_100234167 Ga0068863_1002341671 431
416 3300005842 Ga0068858_100072488 Ga0068858_1000724882 431
417 3300005842 Ga0068858_100186564 Ga0068858_1001865641 431
418 3300005844 Ga0068862_100007428 Ga0068862_1000074287 431
419 3300005844 Ga0068862_100016113 Ga0068862_1000161134 431
420 3300006353 Ga0075370_10024202 Ga0075370_100242022 431
421 3300006844 Ga0075428_100058779 Ga0075428_1000587792 431
422 3300006880 Ga0075429_100082543 Ga0075429_1000825432 431
423 3300006931 Ga0097620_100025593 Ga0097620_1000255932 431
424 3300006931 Ga0097620_100111266 Ga0097620_1001112662 431
425 3300006946 Ga0079104_1008607 Ga0079104_10086072 431
426 3300009036 Ga0105244_10001244 Ga0105244_1000124415 431
427 3300009094 Ga0111539_10005248 Ga0111539_1000524810 431
428 3300009094 Ga0111539_10109397 Ga0111539_101093972 431
429 3300009148 Ga0105243_10000051 Ga0105243_1000005127 431
430 3300009148 Ga0105243_10185181 Ga0105243_101851812 431
431 3300009176 Ga0105242_10000379 Ga0105242_1000037920 431
432 3300009176 Ga0105242_10000777 Ga0105242_100007775 431
433 3300009177 Ga0105248_10044594 Ga0105248_100445942 431
434 3300009545 Ga0105237_10106902 Ga0105237_101069022 431
435 3300011119 Ga0105246_10079775 Ga0105246_100797751 431
436 3300013297 Ga0157378_10318209 Ga0157378_103182091 431
437 3300013306 Ga0163162_10131565 Ga0163162_101315652 431
438 3300013306 Ga0163162_10260306 Ga0163162_102603062 431
439 3300013308 Ga0157375_10009288 Ga0157375_100092882 431
440 3300014326 Ga0157380_10007546 Ga0157380_100075463 431
441 3300014326 Ga0157380_10013708 Ga0157380_100137084 431
442 3300015261 Ga0182006_1000008 Ga0182006_100000899 431
443 3300015265 Ga0182005_1000022 Ga0182005_1000022123 431
444 3300017792 Ga0163161_10015004 Ga0163161_100150042 431
445 3300021384 Ga0213876_10000078 Ga0213876_1000007844 431
446 3300021384 Ga0213876_10000741 Ga0213876_100007417 431
447 3300025230 Ga0209563_100003 Ga0209563_1000031650 431
448 3300025245 Ga0207425_1002130 Ga0207425_10021305 431
449 3300025254 Ga0209148_1000817 Ga0209148_100081721 431
450 3300025294 Ga0209025_1002805 Ga0209025_100280510 431
451 3300025297 Ga0209758_1000515 Ga0209758_100051511 431
452 3300025321 Ga0207656_10028251 Ga0207656_100282512 431
453 3300025885 Ga0207653_10000247 Ga0207653_1000024713 431
454 3300025908 Ga0207643_10000274 Ga0207643_100002747 431
455 3300025908 Ga0207643_10104818 Ga0207643_101048181 431
456 3300025919 Ga0207657_10001032 Ga0207657_1000103216 431
457 3300025922 Ga0207646_10007766 Ga0207646_100077668 431
458 3300025927 Ga0207687_10208179 Ga0207687_102081791 431
459 3300025931 Ga0207644_10002534 Ga0207644_100025343 431
460 3300025932 Ga0207690_10065585 Ga0207690_100655852 431
461 3300025934 Ga0207686_10000022 Ga0207686_1000002275 431
462 3300025934 Ga0207686_10004880 Ga0207686_100048802 431
463 3300025934 Ga0207686_10009833 Ga0207686_100098332 431
464 3300025935 Ga0207709_10000056 Ga0207709_1000005675 431
465 3300025949 Ga0207667_10000044 Ga0207667_1000004499 431
466 3300025949 Ga0207667_10027431 Ga0207667_100274312 431
467 3300025949 Ga0207667_10075798 Ga0207667_100757982 431
468 3300025961 Ga0207712_10013477 Ga0207712_100134772 431
469 3300025961 Ga0207712_10044240 Ga0207712_100442402 431
470 3300026035 Ga0207703_10044294 Ga0207703_100442942 431
471 3300026075 Ga0207708_10003060 Ga0207708_100030604 431
472 3300026078 Ga0207702_10035657 Ga0207702_100356572 431
473 3300026078 Ga0207702_10214066 Ga0207702_102140662 431
474 3300026088 Ga0207641_10119298 Ga0207641_101192981 431
475 3300026116 Ga0207674_10068641 Ga0207674_100686411 431
476 3300026116 Ga0207674_10081328 Ga0207674_100813282 431
477 3300026118 Ga0207675_100081266 Ga0207675_1000812662 431
478 3300027111 Ga0209281_1011147 Ga0209281_10111472 431
479 3300027907 Ga0207428_10007378 Ga0207428_100073783 431
480 3300028380 Ga0268265_10007809 Ga0268265_100078093 431
481 3300028380 Ga0268265_10035430 Ga0268265_100354303 431
482 3300028381 Ga0268264_10076573 Ga0268264_100765732 431
483 3300028794 Ga0307515_10168092 Ga0307515_101680922 431
484 3300031548 Ga0307408_100000023 Ga0307408_100000023153 431
485 3300032004 Ga0307414_10080493 Ga0307414_100804931 431
486 3300032005 Ga0307411_10000141 Ga0307411_100001419 431
487 3300035114 Ga0373939_0000107 Ga0373939_0000107_20191_21489 431
488 3300035242 Ga0373962_0004162 Ga0373962_0004162_1933_3231 431
489 3300035691 Ga0373931_0000226 Ga0373931_0000226_20412_21710 431
490 3300037312 Ga0395899_0000012 Ga0395899_0000012_27625_28920 431
491 3300037312 Ga0395899_0002976 Ga0395899_0002976_10817_12112 431
492 3300037312 Ga0395899_0017747 Ga0395899_0017747_1374_2669 431
493 3300037312 Ga0395899_0065133 Ga0395899_0065133_455_1750 431
494 3300037312 Ga0395899_0083320 Ga0395899_0083320_1016_2311 431
495 3300037312 Ga0395899_0174683 Ga0395899_0174683_168_1463 431
496 3300037418 Ga0395900_0000426 Ga0395900_0000426_45773_47107 431
497 3300037418 Ga0395900_0008926 Ga0395900_0008926_305_1600 431
498 3300037418 Ga0395900_0009371 Ga0395900_0009371_2621_3916 431
499 3300037418 Ga0395900_0037192 Ga0395900_0037192_3451_4746 431
500 3300037418 Ga0395900_0055166 Ga0395900_0055166_80_1375 431
501 3300037418 Ga0395900_0221967 Ga0395900_0221967_450_1799 431
502 3300037466 Ga0395898_0091347 Ga0395898_0091347_1426_2721 431
503 3300037471 Ga0395905_0078616 Ga0395905_0078616_1534_2829 431
504 3300037471 Ga0395905_0111047 Ga0395905_0111047_727_2022 431
505 3300037471 Ga0395905_0225131 Ga0395905_0225131_177_1472 431
506 3300038443 Ga0395901_0000345 Ga0395901_0000345_20217_21512 431
507 3300038443 Ga0395901_0048652 Ga0395901_0048652_155_1450 431
508 3300038443 Ga0395901_0117245 Ga0395901_0117245_1106_2401 431
509 3300038443 Ga0395901_0148614 Ga0395901_0148614_999_2342 431
510 3300038443 Ga0395901_0164250 Ga0395901_0164250_209_1504 431
511 3300039437 Ga0436365_0012618 Ga0436365_0012618_40747_42048 431
512 3300039437 Ga0436365_1660809 Ga0436365_1660809_37965_39266 431
513 3300042008 Ga0439450_004606 Ga0439450_004606_178_1473 431
514 3300044658 Ga0466972_0001589 Ga0466972_0001589_2323_3618 431
515 3300044683 Ga0466965_0022718 Ga0466965_0022718_36_1331 431
516 3300044683 Ga0466965_0029512 Ga0466965_0029512_987_2282 431
517 3300044684 Ga0466966_0031487 Ga0466966_0031487_173_1468 431
518 3300044706 Ga0466964_0000328 Ga0466964_0000328_2408_3703 431
519 3300044735 Ga0466968_0000248 Ga0466968_0000248_13442_14737 431
520 3300044842 Ga0466957_0103911 Ga0466957_0103911_392_1687 431
521 3300045836 Ga0466958_0050341 Ga0466958_0050341_356_1651 431
522 3300046452 Ga0495617_000130 Ga0495617_000130_9693_10988 431
523 3300046453 Ga0495627_000001 Ga0495627_000001_305302_306663 431
524 3300046457 Ga0495590_0026312 Ga0495590_0026312_408_1703 431
525 3300046460 Ga0495638_0006451 Ga0495638_0006451_2751_4046 431
526 3300046460 Ga0495638_0027306 Ga0495638_0027306_2225_3520 431
527 3300046471 Ga0495650_0000001 Ga0495650_0000001_126323_127618 431
528 3300046471 Ga0495650_0000827 Ga0495650_0000827_15811_17106 431
529 3300046474 Ga0495605_0000073 Ga0495605_0000073_38008_39303 431
530 3300046474 Ga0495605_0000104 Ga0495605_0000104_69417_70712 431
531 3300046474 Ga0495605_0009955 Ga0495605_0009955_1539_2834 431
532 3300046474 Ga0495605_0078900 Ga0495605_0078900_99_1394 431
533 3300046491 Ga0495584_0000002 Ga0495584_0000002_283416_284711 431
534 3300046491 Ga0495584_0000034 Ga0495584_0000034_1945_3288 431
535 3300046491 Ga0495584_0000317 Ga0495584_0000317_11607_12902 431
536 3300046491 Ga0495584_0000793 Ga0495584_0000793_667_1962 431
537 3300046491 Ga0495584_0048895 Ga0495584_0048895_181_1476 431
538 3300046492 Ga0495585_0000002 Ga0495585_0000002_63302_64597 431
539 3300046492 Ga0495585_0000346 Ga0495585_0000346_864_2207 431
540 3300046492 Ga0495585_0000735 Ga0495585_0000735_26932_28242 431
541 3300046492 Ga0495585_0001180 Ga0495585_0001180_18852_20147 431
542 3300046500 Ga0495596_0000017 Ga0495596_0000017_259_1554 431
543 3300046501 Ga0495607_0001142 Ga0495607_0001142_15200_16495 431
544 3300046501 Ga0495607_0002148 Ga0495607_0002148_14938_16233 431
545 3300046501 Ga0495607_0005357 Ga0495607_0005357_1424_2719 431
546 3300046501 Ga0495607_0007948 Ga0495607_0007948_5890_7185 431
547 3300046506 Ga0495583_0000009 Ga0495583_0000009_357019_358329 431
548 3300046506 Ga0495583_0000053 Ga0495583_0000053_63892_65187 431
549 3300046506 Ga0495583_0022838 Ga0495583_0022838_324_1625 431
550 3300046507 Ga0495606_0000049 Ga0495606_0000049_97366_98661 431
551 3300046507 Ga0495606_0000152 Ga0495606_0000152_51709_53067 431
552 3300046507 Ga0495606_0002108 Ga0495606_0002108_7060_8355 431
553 3300046507 Ga0495606_0050333 Ga0495606_0050333_577_1872 431
554 3300046507 Ga0495606_0091549 Ga0495606_0091549_98_1393 431
555 3300046507 Ga0495606_0133202 Ga0495606_0133202_27_1322 431
556 3300046512 Ga0495610_0003130 Ga0495610_0003130_7292_8587 431
557 3300046512 Ga0495610_0023015 Ga0495610_0023015_1996_3291 431
558 3300046513 Ga0495616_0000034 Ga0495616_0000034_10798_12093 431
559 3300046513 Ga0495616_0000705 Ga0495616_0000705_20133_21428 431
560 3300046513 Ga0495616_0001810 Ga0495616_0001810_4655_5950 431
561 3300046513 Ga0495616_0002630 Ga0495616_0002630_28_1323 431
562 3300046513 Ga0495616_0012678 Ga0495616_0012678_3334_4677 431
563 3300046513 Ga0495616_0078286 Ga0495616_0078286_94_1389 431
564 3300046513 Ga0495616_0092085 Ga0495616_0092085_84_1379 431
565 3300046515 Ga0495620_0014632 Ga0495620_0014632_2077_3387 431
566 3300046518 Ga0495631_0002821 Ga0495631_0002821_1373_2668 431
567 3300046518 Ga0495631_0009263 Ga0495631_0009263_2720_4015 431
568 3300046518 Ga0495631_0031476 Ga0495631_0031476_978_2273 431
569 3300046519 Ga0495632_0000018 Ga0495632_0000018_84419_85714 431
570 3300046519 Ga0495632_0000029 Ga0495632_0000029_48968_50269 431
571 3300046519 Ga0495632_0017149 Ga0495632_0017149_214_1509 431
572 3300046519 Ga0495632_0028528 Ga0495632_0028528_564_1859 431
573 3300046520 Ga0495637_0000051 Ga0495637_0000051_58414_59709 431
574 3300046520 Ga0495637_0016198 Ga0495637_0016198_1113_2408 431
575 3300046522 Ga0495643_0004446 Ga0495643_0004446_5507_6802 431
576 3300046522 Ga0495643_0033501 Ga0495643_0033501_1378_2673 431
577 3300046522 Ga0495643_0090982 Ga0495643_0090982_99_1394 431
578 3300046523 Ga0495644_0000478 Ga0495644_0000478_11663_12958 431
579 3300046523 Ga0495644_0000862 Ga0495644_0000862_6995_8290 431
580 3300046524 Ga0495648_0000027 Ga0495648_0000027_63302_64597 431
581 3300046524 Ga0495648_0000401 Ga0495648_0000401_42092_43387 431
582 3300046525 Ga0495663_0008229 Ga0495663_0008229_605_1900 431
583 3300046528 Ga0495642_0000349 Ga0495642_0000349_15075_16370 431
584 3300046528 Ga0495642_0009462 Ga0495642_0009462_641_1942 431
585 3300046528 Ga0495642_0021212 Ga0495642_0021212_407_1717 431
586 3300046528 Ga0495642_0051457 Ga0495642_0051457_389_1684 431
587 3300046529 Ga0495652_0001226 Ga0495652_0001226_12467_13762 431
588 3300046530 Ga0495654_0000011 Ga0495654_0000011_102868_104163 431
589 3300046537 Ga0495598_0021857 Ga0495598_0021857_96_1397 431
590 3300046538 Ga0495609_0000095 Ga0495609_0000095_44611_45906 431
591 3300046538 Ga0495609_0000180 Ga0495609_0000180_24830_26125 431
592 3300046538 Ga0495609_0000653 Ga0495609_0000653_23363_24724 431
593 3300046538 Ga0495609_0025937 Ga0495609_0025937_233_1528 431
594 3300046542 Ga0495597_0000073 Ga0495597_0000073_29142_30437 431
595 3300046542 Ga0495597_0000102 Ga0495597_0000102_12831_14126 431
596 3300046542 Ga0495597_0008250 Ga0495597_0008250_101_1396 431
597 3300046543 Ga0495645_0134659 Ga0495645_0134659_177_1472 431
598 3300046543 Ga0495645_0150077 Ga0495645_0150077_12_1307 431
599 3300046557 Ga0495622_0000001 Ga0495622_0000001_355777_357072 431
600 3300046558 Ga0495633_0000091 Ga0495633_0000091_42456_43847 431
601 3300046558 Ga0495633_0003288 Ga0495633_0003288_14_1309 431
602 3300046558 Ga0495633_0010266 Ga0495633_0010266_437_1780 431
603 3300046558 Ga0495633_0021080 Ga0495633_0021080_904_2199 431
604 3300046558 Ga0495633_0023181 Ga0495633_0023181_171_1472 431
605 3300046558 Ga0495633_0054745 Ga0495633_0054745_432_1727 431
606 3300046615 Ga0495656_0011500 Ga0495656_0011500_699_1994 431
607 3300046616 Ga0495668_0000077 Ga0495668_0000077_97319_98614 431
608 3300046616 Ga0495668_0031385 Ga0495668_0031385_611_1906 431
609 3300046616 Ga0495668_0087447 Ga0495668_0087447_13_1308 431
610 3300046648 Ga0495611_0002992 Ga0495611_0002992_5351_6646 431
611 3300046648 Ga0495611_0013349 Ga0495611_0013349_887_2182 431
612 3300046648 Ga0495611_0016737 Ga0495611_0016737_99_1394 431
613 3300046660 Ga0495625_0000631 Ga0495625_0000631_26360_27655 431
614 3300046660 Ga0495625_0016043 Ga0495625_0016043_1536_2831 431
615 3300046660 Ga0495625_0028909 Ga0495625_0028909_83_1378 431
616 3300046660 Ga0495625_0143185 Ga0495625_0143185_83_1378 431
617 3300046664 Ga0495659_0036098 Ga0495659_0036098_159_1454 431
618 3300046665 Ga0495661_0000012 Ga0495661_0000012_216608_217903 431
619 3300046665 Ga0495661_0001746 Ga0495661_0001746_14490_15785 431
620 3300046665 Ga0495661_0019019 Ga0495661_0019019_811_2106 431
621 3300046665 Ga0495661_0053449 Ga0495661_0053449_399_1694 431
622 3300046665 Ga0495661_0065632 Ga0495661_0065632_60_1355 431
623 3300046674 Ga0495588_0000099 Ga0495588_0000099_92812_94107 431
624 3300046674 Ga0495588_0000118 Ga0495588_0000118_68070_69365 431
625 3300046674 Ga0495588_0009889 Ga0495588_0009889_711_2012 431
626 3300046680 Ga0495646_0001427 Ga0495646_0001427_9476_10771 431
627 3300046691 Ga0495670_0000155 Ga0495670_0000155_7835_9145 431
628 3300046691 Ga0495670_0035838 Ga0495670_0035838_84_1379 431
629 3300046692 Ga0495671_0000594 Ga0495671_0000594_20752_22053 431
630 3300046692 Ga0495671_0069604 Ga0495671_0069604_352_1647 431
631 3300046794 Ga0495589_0000007 Ga0495589_0000007_216248_217543 431
632 3300046794 Ga0495589_0000082 Ga0495589_0000082_16655_17950 431
633 3300046794 Ga0495589_0000091 Ga0495589_0000091_69431_70726 431
634 3300046794 Ga0495589_0050394 Ga0495589_0050394_716_2017 431
635 3300046810 Ga0495660_0000024 Ga0495660_0000024_36690_37985 431
636 3300046810 Ga0495660_0000050 Ga0495660_0000050_17505_18800 431
637 3300046810 Ga0495660_0027636 Ga0495660_0027636_1673_3034 431
638 3300046810 Ga0495660_0031527 Ga0495660_0031527_211_1512 431
639 3300046810 Ga0495660_0092150 Ga0495660_0092150_146_1456 431
640 3300047320 Ga0495672_0000091 Ga0495672_0000091_53145_54440 431
641 3300047320 Ga0495672_0000222 Ga0495672_0000222_60054_61349 431
642 3300047320 Ga0495672_0013311 Ga0495672_0013311_4329_5624 431
643 3300047323 Ga0495683_0000308 Ga0495683_0000308_20077_21420 431
644 3300047323 Ga0495683_0051662 Ga0495683_0051662_356_1666 431
645 3300047323 Ga0495683_0060964 Ga0495683_0060964_233_1528 431
646 3300047323 Ga0495683_0067748 Ga0495683_0067748_278_1573 431
647 3300047443 Ga0495687_000002 Ga0495687_000002_804211_805518 431
648 3300047443 Ga0495687_000003 Ga0495687_000003_342288_343583 431
649 3300047443 Ga0495687_000016 Ga0495687_000016_27204_28499 431
650 3300047443 Ga0495687_000097 Ga0495687_000097_104082_105377 431
651 3300047443 Ga0495687_057798 Ga0495687_057798_234_1529 431
652 3300047443 Ga0495687_057804 Ga0495687_057804_234_1529 431
653 3300047445 Ga0495677_0000005 Ga0495677_0000005_59124_60419 431
654 3300047445 Ga0495677_0002148 Ga0495677_0002148_130_1425 431
655 3300047445 Ga0495677_0013348 Ga0495677_0013348_1461_2756 431
656 3300047447 Ga0495685_000447 Ga0495685_000447_7351_8646 431
657 3300047470 Ga0495681_0000016 Ga0495681_0000016_90004_91299 431
658 3300047470 Ga0495681_0007932 Ga0495681_0007932_64_1374 431
659 3300047472 Ga0495686_0008350 Ga0495686_0008350_1206_2501 431
660 3300047472 Ga0495686_0114997 Ga0495686_0114997_42_1340 431
661 3300048088 Ga0495602_0014236 Ga0495602_0014236_4342_5637 431
662 3300048091 Ga0495626_0000081 Ga0495626_0000081_62826_64121 431
663 3300048091 Ga0495626_0001744 Ga0495626_0001744_14936_16231 431
664 3300048091 Ga0495626_0003375 Ga0495626_0003375_4472_5767 431
665 3300048091 Ga0495626_0004562 Ga0495626_0004562_6196_7491 431
666 3300048091 Ga0495626_0034585 Ga0495626_0034585_186_1481 431
667 3300048905 Ga0496102_0201436 Ga0496102_0201436_421_1716 431
668 3300048906 Ga0496103_0026892 Ga0496103_0026892_1474_2769 431
669 3300048908 Ga0496105_0171219 Ga0496105_0171219_368_1663 431
670 3300048909 Ga0496106_0001179 Ga0496106_0001179_9957_11252 431
671 3300048910 Ga0496107_0141721 Ga0496107_0141721_106_1443 431
672 3300048916 Ga0496113_0017117 Ga0496113_0017117_3398_4693 431
673 3300048916 Ga0496113_0023277 Ga0496113_0023277_417_1712 431
674 3300048916 Ga0496113_0238502 Ga0496113_0238502_87_1382 431
675 3300048917 Ga0496114_0109096 Ga0496114_0109096_16_1311 431
676 3300048917 Ga0496114_0144274 Ga0496114_0144274_288_1583 431
677 3300048925 Ga0496122_0000509 Ga0496122_0000509_18954_20249 431
678 3300048925 Ga0496122_0010223 Ga0496122_0010223_4029_5324 431
679 3300048925 Ga0496122_0012279 Ga0496122_0012279_187_1482 431
680 3300048926 Ga0496123_0004540 Ga0496123_0004540_3017_4312 431
681 3300048926 Ga0496123_0024929 Ga0496123_0024929_1986_3281 431
682 3300048927 Ga0496124_0013135 Ga0496124_0013135_4757_6052 431
683 3300048928 Ga0496125_0003043 Ga0496125_0003043_14086_15381 431
684 3300049459 Ga0495678_000002 Ga0495678_000002_243236_244531 431
685 3300049459 Ga0495678_000060 Ga0495678_000060_139043_140344 431
686 3300049459 Ga0495678_001312 Ga0495678_001312_2487_3788 431
687 3300049460 Ga0495682_0000035 Ga0495682_0000035_37445_38746 431
688 3300049460 Ga0495682_0000041 Ga0495682_0000041_95894_97189 431
689 3300049460 Ga0495682_0007543 Ga0495682_0007543_422_1717 431
690 3300049460 Ga0495682_0019415 Ga0495682_0019415_696_1991 431
691 3300049460 Ga0495682_0054819 Ga0495682_0054819_69_1364 431
692 3300049766 Ga0501269_000021 Ga0501269_000021_25589_26884 431
693 3300049823 Ga0501044_0062689 Ga0501044_0062689_14_1309 431
694 3300050496 nmdc:mga07m45_1152_c1 nmdc:mga07m45_1152_c1_10328_11626 431
695 3300050508 nmdc:mga09592_153689_c1 nmdc:mga09592_153689_c1_435_1736 431
696 3300050511 nmdc:mga08y16_262434_c1 nmdc:mga08y16_262434_c1_234_1535 431
697 3300053125 Ga0500618_000052 Ga0500618_000052_79058_80353 431
698 3300053125 Ga0500618_000149 Ga0500618_000149_52312_53607 431
699 3300061719 Ga0466962_0011993 Ga0466962_0011993_1933_3228 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

121

350

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iud-assembly1.cif.gz_C cu2+-bound form of pseudomonas stutzeri l-rhamnose isomerase 0.9468 2 423
3itt-assembly1.cif.gz_C crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329k in complex with l-rhamnose 0.9447 4 423
3m0y-assembly1.cif.gz_D crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose 0.9442 2 421
3m0y-assembly1.cif.gz_D crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose 0.942 2 421
4gjj-assembly1.cif.gz_B crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose 0.9397 4 424
ID Description Score Start End Superfamily
3m0vD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9301 2 431 3.20.20.150
3m0vD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.928 2 431 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8318 49 385 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8105 49 385 3.20.20.150
3uvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7717 24 419 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3S1K3D3-F1-model_v4 Sugar isomerase 0.9637 1 174 GO:0016853
AF-A0A3S1VD68-F1-model_v4 deleted 0.9632 1 125
AF-A0A3D0Q3Y4-F1-model_v4 Sugar isomerase 0.9607 1 193 GO:0016853
AF-A0A529HK39-F1-model_v4 deleted 0.9606 73 224
AF-A0A3S1SYS7-F1-model_v4 Sugar isomerase 0.9594 1 204 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.46 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map