F476050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 359 | 670 | 430 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0000091|Ga0495633_0000091_42456_43847 |
| Length | 463 |
| Sequence | MSMPAMPPPLHDNQSYKKAAGPCAALHTRRQNMSSMIDSGLVAEHNATLQSNLDADYAALAGVLARRGQDIEKLTALAQTFAVAVPSWGAGTGGTRFARFPGVGEPRNVFEKLEDCAVINQLTQATPAVSLHFPWDKVSDTAALREIAQSHGLGFDAVNSNTFQDQLGQAHTYKHGSLTSQSAAVRAQAVEHNIECIELGRALGSKALTVWVGDGANFPGQHNLRGALERYLDSMRDIYGALPADWNIFIEHKLFEPAFYATTIADWGTSFACATALGPKAKCLVDLGHHAPNTNIEMIVARLAQFGKLGGFHFNDSKYGDDDLDSGSINPFQLFLVFNELADAAEREGAAFNPAYMLDQSHNVTDPIESLMSSAVEVQRAFIQSALVDRAGLRHLQESNDVHASAQALKQAFRTDVSAILAMARVRSGGAIDPVACYRTTGYREQRGVARPPKAGASSSGIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 2 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 3 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 4 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 5 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 6 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 7 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 8 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 9 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 10 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 11 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 12 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 13 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 14 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 15 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 16 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 17 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 18 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 19 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 20 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 21 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 22 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 23 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 24 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 25 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 26 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 27 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 32 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 33 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 34 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 169 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 170 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 191 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 192 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 193 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 194 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 296 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 322 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 341 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 345 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 346 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 348 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 351 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 354 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 356 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 359 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.71 |
| Metatranscriptomes | 0.14 |
| Isolates | 4.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.3 |
| Nodule | 0.86 |
| Rhizoplane | 2.72 |
| Rhizosphere | 78.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1001281 | 3300002774 | Bacteria | 7190 |
| 2 | JGI25150J39212_1001652 | 3300002774 | Bacteria | 6043 |
| 3 | JGI25159J45721_1008823 | 3300002987 | Bacteria | 2728 |
| 4 | JGI25153J46596_10020644 | 3300003215 | Bacteria | 2484 |
| 5 | rootH1_10004214 | 3300003316 | Bacteria | 29063 |
| 6 | rootL2_10030166 | 3300003322 | Bacteria | 3268 |
| 7 | rootL2_10042461 | 3300003322 | Bacteria | 24987 |
| 8 | JGI25161J50226_1007707 | 3300003374 | Bacteria | 1757 |
| 9 | Ga0055525_1000136 | 3300003759 | Bacteria | 107751 |
| 10 | Ga0055526_1001585 | 3300003771 | Bacteria | 15984 |
| 11 | Ga0055526_1015106 | 3300003771 | Bacteria | 3119 |
| 12 | Ga0055537_1000076 | 3300003773 | Bacteria | 70798 |
| 13 | Ga0055537_1000260 | 3300003773 | Bacteria | 38657 |
| 14 | Ga0055537_1007956 | 3300003773 | Bacteria | 2492 |
| 15 | Ga0055534_1000124 | 3300003784 | Bacteria | 57565 |
| 16 | Ga0055528_1000184 | 3300003790 | Bacteria | 52910 |
| 17 | Ga0055530_10012976 | 3300003791 | Bacteria | 2872 |
| 18 | Ga0055531_10010104 | 3300003794 | Bacteria | 4737 |
| 19 | Ga0055543_1003564 | 3300004625 | Bacteria | 4516 |
| 20 | Ga0055543_1013926 | 3300004625 | Bacteria | 1576 |
| 21 | Ga0065165_1000003 | 3300005262 | Bacteria | 390701 |
| 22 | Ga0065712_10000210 | 3300005290 | Bacteria | 35783 |
| 23 | Ga0065712_10000508 | 3300005290 | Bacteria | 18980 |
| 24 | Ga0065715_10000337 | 3300005293 | Bacteria | 18475 |
| 25 | Ga0065707_10002256 | 3300005295 | Bacteria | 4933 |
| 26 | Ga0065707_10115084 | 3300005295 | Bacteria | 2278 |
| 27 | Ga0070658_10177764 | 3300005327 | Bacteria | 1790 |
| 28 | Ga0070658_10232746 | 3300005327 | Bacteria | 1560 |
| 29 | Ga0070690_100005110 | 3300005330 | Bacteria | 7348 |
| 30 | Ga0070690_100042208 | 3300005330 | Bacteria | 2889 |
| 31 | Ga0070670_100006570 | 3300005331 | Bacteria | 9853 |
| 32 | Ga0070670_100185195 | 3300005331 | Bacteria | 1808 |
| 33 | Ga0070682_100025657 | 3300005337 | Bacteria | 3519 |
| 34 | Ga0070661_100076251 | 3300005344 | Bacteria | 2471 |
| 35 | Ga0070692_10030775 | 3300005345 | Bacteria | 2686 |
| 36 | Ga0070671_100098835 | 3300005355 | Bacteria | 2448 |
| 37 | Ga0070671_100169022 | 3300005355 | Bacteria | 1849 |
| 38 | Ga0070671_100256317 | 3300005355 | Bacteria | 1486 |
| 39 | Ga0070688_100019455 | 3300005365 | Bacteria | 3934 |
| 40 | Ga0070688_100071504 | 3300005365 | Bacteria | 2221 |
| 41 | Ga0070659_100076514 | 3300005366 | Bacteria | 2668 |
| 42 | Ga0070659_100164420 | 3300005366 | Bacteria | 1815 |
| 43 | Ga0070703_10000142 | 3300005406 | Bacteria | 37070 |
| 44 | Ga0070714_100039841 | 3300005435 | Bacteria | 3958 |
| 45 | Ga0070700_100015632 | 3300005441 | Bacteria | 4309 |
| 46 | Ga0070694_100009689 | 3300005444 | Bacteria | 5915 |
| 47 | Ga0070694_100046083 | 3300005444 | Bacteria | 2925 |
| 48 | Ga0070694_100066573 | 3300005444 | Bacteria | 2471 |
| 49 | Ga0070694_100094257 | 3300005444 | Bacteria | 2106 |
| 50 | Ga0070708_100015369 | 3300005445 | Bacteria | 6321 |
| 51 | Ga0070708_100053681 | 3300005445 | Bacteria | 3577 |
| 52 | Ga0070678_100012011 | 3300005456 | Bacteria | 5366 |
| 53 | Ga0070662_100147745 | 3300005457 | Bacteria | 1827 |
| 54 | Ga0070681_10041961 | 3300005458 | Bacteria | 4586 |
| 55 | Ga0068867_100212296 | 3300005459 | Bacteria | 1555 |
| 56 | Ga0070685_10022916 | 3300005466 | Bacteria | 3411 |
| 57 | Ga0070685_10094148 | 3300005466 | Bacteria | 1819 |
| 58 | Ga0070706_100027367 | 3300005467 | Bacteria | 5248 |
| 59 | Ga0070707_100004141 | 3300005468 | Bacteria | 13596 |
| 60 | Ga0070707_100014591 | 3300005468 | Bacteria | 7367 |
| 61 | Ga0070698_100090482 | 3300005471 | Bacteria | 3043 |
| 62 | Ga0070699_100224209 | 3300005518 | Unclassified | 1675 |
| 63 | Ga0070684_100016773 | 3300005535 | Bacteria | 5995 |
| 64 | Ga0070697_100000726 | 3300005536 | Bacteria | 24563 |
| 65 | Ga0070697_100143412 | 3300005536 | Bacteria | 2010 |
| 66 | Ga0070672_100001959 | 3300005543 | Bacteria | 12914 |
| 67 | Ga0070686_100015305 | 3300005544 | Bacteria | 4439 |
| 68 | Ga0070686_100072163 | 3300005544 | Bacteria | 2263 |
| 69 | Ga0070695_100005464 | 3300005545 | Bacteria | 7479 |
| 70 | Ga0070696_100059126 | 3300005546 | Bacteria | 2678 |
| 71 | Ga0070696_100105038 | 3300005546 | Bacteria | 2029 |
| 72 | Ga0070665_100009834 | 3300005548 | Bacteria | 9668 |
| 73 | Ga0070704_100040495 | 3300005549 | Bacteria | 3208 |
| 74 | Ga0068855_100000220 | 3300005563 | Bacteria | 72936 |
| 75 | Ga0068855_100106818 | 3300005563 | Bacteria | 3217 |
| 76 | Ga0070664_100111149 | 3300005564 | Bacteria | 2392 |
| 77 | Ga0068857_100041485 | 3300005577 | Bacteria | 4081 |
| 78 | Ga0068856_100050059 | 3300005614 | Bacteria | 4118 |
| 79 | Ga0068856_100111352 | 3300005614 | Bacteria | 2735 |
| 80 | Ga0068852_100216024 | 3300005616 | Bacteria | 1822 |
| 81 | Ga0068859_100025593 | 3300005617 | Bacteria | 5919 |
| 82 | Ga0068859_100111261 | 3300005617 | Bacteria | 2801 |
| 83 | Ga0068859_100157892 | 3300005617 | Bacteria | 2346 |
| 84 | Ga0068851_10041992 | 3300005834 | Bacteria | 2301 |
| 85 | Ga0068863_100133007 | 3300005841 | Bacteria | 2375 |
| 86 | Ga0068863_100234167 | 3300005841 | Bacteria | 1772 |
| 87 | Ga0068858_100072239 | 3300005842 | Bacteria | 3201 |
| 88 | Ga0068858_100072488 | 3300005842 | Bacteria | 3195 |
| 89 | Ga0068858_100186564 | 3300005842 | Bacteria | 1959 |
| 90 | Ga0068860_100012371 | 3300005843 | Bacteria | 8408 |
| 91 | Ga0068862_100007428 | 3300005844 | Bacteria | 9087 |
| 92 | Ga0068862_100016113 | 3300005844 | Bacteria | 6217 |
| 93 | Ga0068862_100273970 | 3300005844 | Bacteria | 1544 |
| 94 | Ga0081455_10005188 | 3300005937 | Bacteria | 14336 |
| 95 | Ga0081539_10006080 | 3300005985 | Bacteria | 11798 |
| 96 | Ga0075367_10086429 | 3300006178 | Bacteria | 1903 |
| 97 | Ga0075370_10024202 | 3300006353 | Bacteria | 3352 |
| 98 | Ga0075428_100035039 | 3300006844 | Bacteria | 5534 |
| 99 | Ga0075428_100058779 | 3300006844 | Bacteria | 4209 |
| 100 | Ga0075428_100208492 | 3300006844 | Bacteria | 2112 |
| 101 | Ga0075430_100123245 | 3300006846 | Bacteria | 2161 |
| 102 | Ga0075431_100060018 | 3300006847 | Bacteria | 3925 |
| 103 | Ga0075429_100082543 | 3300006880 | Bacteria | 2801 |
| 104 | Ga0097620_100025593 | 3300006931 | Bacteria | 5919 |
| 105 | Ga0097620_100111266 | 3300006931 | Bacteria | 2801 |
| 106 | Ga0097620_100157873 | 3300006931 | Bacteria | 2346 |
| 107 | Ga0079104_1008607 | 3300006946 | Bacteria | 3544 |
| 108 | Ga0099826_10000008 | 3300006948 | Bacteria | 380974 |
| 109 | Ga0075435_100070028 | 3300007076 | Bacteria | 2862 |
| 110 | Ga0105244_10001244 | 3300009036 | Bacteria | 20871 |
| 111 | Ga0111539_10000785 | 3300009094 | Bacteria | 41318 |
| 112 | Ga0111539_10005248 | 3300009094 | Bacteria | 16787 |
| 113 | Ga0111539_10014758 | 3300009094 | Bacteria | 9745 |
| 114 | Ga0111539_10106201 | 3300009094 | Bacteria | 3294 |
| 115 | Ga0111539_10109397 | 3300009094 | Bacteria | 3243 |
| 116 | Ga0114129_10068358 | 3300009147 | Bacteria | 4954 |
| 117 | Ga0114129_10150799 | 3300009147 | Bacteria | 3182 |
| 118 | Ga0114129_10179124 | 3300009147 | Bacteria | 2885 |
| 119 | Ga0114129_10212096 | 3300009147 | Bacteria | 2617 |
| 120 | Ga0114129_10238102 | 3300009147 | Bacteria | 2448 |
| 121 | Ga0105243_10000051 | 3300009148 | Bacteria | 139849 |
| 122 | Ga0105243_10016945 | 3300009148 | Bacteria | 5509 |
| 123 | Ga0105243_10139218 | 3300009148 | Bacteria | 2068 |
| 124 | Ga0105243_10185181 | 3300009148 | Bacteria | 1814 |
| 125 | Ga0105242_10000379 | 3300009176 | Bacteria | 35359 |
| 126 | Ga0105242_10000777 | 3300009176 | Bacteria | 24800 |
| 127 | Ga0105242_10198129 | 3300009176 | Bacteria | 1782 |
| 128 | Ga0105248_10035248 | 3300009177 | Bacteria | 5598 |
| 129 | Ga0105248_10044594 | 3300009177 | Bacteria | 4973 |
| 130 | Ga0105248_10174437 | 3300009177 | Bacteria | 2423 |
| 131 | Ga0105237_10106902 | 3300009545 | Bacteria | 2790 |
| 132 | Ga0105246_10079775 | 3300011119 | Bacteria | 2328 |
| 133 | Ga0157374_10210187 | 3300013296 | Bacteria | 1908 |
| 134 | Ga0157378_10318209 | 3300013297 | Bacteria | 1511 |
| 135 | Ga0163162_10131565 | 3300013306 | Bacteria | 2611 |
| 136 | Ga0163162_10256688 | 3300013306 | Bacteria | 1880 |
| 137 | Ga0163162_10260306 | 3300013306 | Bacteria | 1867 |
| 138 | Ga0157375_10009288 | 3300013308 | Bacteria | 8630 |
| 139 | Ga0157375_10060661 | 3300013308 | Bacteria | 3752 |
| 140 | Ga0157375_10349907 | 3300013308 | Bacteria | 1643 |
| 141 | Ga0157380_10007546 | 3300014326 | Bacteria | 7729 |
| 142 | Ga0157380_10011050 | 3300014326 | Bacteria | 6513 |
| 143 | Ga0157380_10013708 | 3300014326 | Bacteria | 5919 |
| 144 | Ga0157379_10006872 | 3300014968 | Bacteria | 9836 |
| 145 | Ga0157379_10028145 | 3300014968 | Bacteria | 5003 |
| 146 | Ga0157379_10175163 | 3300014968 | Bacteria | 1937 |
| 147 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 148 | Ga0182005_1000022 | 3300015265 | Bacteria | 266181 |
| 149 | Ga0163161_10010148 | 3300017792 | Bacteria | 6519 |
| 150 | Ga0163161_10015004 | 3300017792 | Bacteria | 5398 |
| 151 | Ga0163161_10129311 | 3300017792 | Bacteria | 1904 |
| 152 | Ga0213876_10000078 | 3300021384 | Bacteria | 110940 |
| 153 | Ga0213876_10000741 | 3300021384 | Bacteria | 22598 |
| 154 | Ga0209436_100320 | 3300025208 | Bacteria | 22042 |
| 155 | Ga0209436_111731 | 3300025208 | Bacteria | 1523 |
| 156 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 157 | Ga0207425_1000110 | 3300025245 | Bacteria | 77431 |
| 158 | Ga0207425_1002130 | 3300025245 | Bacteria | 7272 |
| 159 | Ga0209148_1000817 | 3300025254 | Bacteria | 22436 |
| 160 | Ga0209129_1001089 | 3300025258 | Bacteria | 15888 |
| 161 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 162 | Ga0209565_1001274 | 3300025263 | Bacteria | 11697 |
| 163 | Ga0209565_1001275 | 3300025263 | Bacteria | 11697 |
| 164 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 165 | Ga0209673_1008901 | 3300025273 | Bacteria | 4416 |
| 166 | Ga0209130_1000036 | 3300025284 | Bacteria | 284111 |
| 167 | Ga0209130_1014739 | 3300025284 | Bacteria | 1951 |
| 168 | Ga0209130_1019582 | 3300025284 | Bacteria | 1565 |
| 169 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 170 | Ga0209675_1002720 | 3300025291 | Bacteria | 8856 |
| 171 | Ga0209676_1008457 | 3300025292 | Bacteria | 4585 |
| 172 | Ga0209025_1002805 | 3300025294 | Bacteria | 17560 |
| 173 | Ga0209564_1000144 | 3300025295 | Bacteria | 175328 |
| 174 | Ga0209564_1006481 | 3300025295 | Bacteria | 6299 |
| 175 | Ga0209758_1000048 | 3300025297 | Bacteria | 358400 |
| 176 | Ga0209758_1000304 | 3300025297 | Bacteria | 95770 |
| 177 | Ga0209758_1000515 | 3300025297 | Bacteria | 62045 |
| 178 | Ga0209758_1018730 | 3300025297 | Bacteria | 3377 |
| 179 | Ga0209050_1000519 | 3300025298 | Bacteria | 64306 |
| 180 | Ga0209050_1003570 | 3300025298 | Bacteria | 11322 |
| 181 | Ga0209050_1004809 | 3300025298 | Bacteria | 8887 |
| 182 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 183 | Ga0209256_1000325 | 3300025299 | Bacteria | 81358 |
| 184 | Ga0209256_1003732 | 3300025299 | Bacteria | 10307 |
| 185 | Ga0209256_1003816 | 3300025299 | Bacteria | 10095 |
| 186 | Ga0207426_1003756 | 3300025302 | Bacteria | 7920 |
| 187 | Ga0207426_1037090 | 3300025302 | Bacteria | 1545 |
| 188 | Ga0209257_1000123 | 3300025304 | Bacteria | 219092 |
| 189 | Ga0209257_1000237 | 3300025304 | Bacteria | 128812 |
| 190 | Ga0209257_1016477 | 3300025304 | Bacteria | 2988 |
| 191 | Ga0207656_10028251 | 3300025321 | Bacteria | 2301 |
| 192 | Ga0207653_10000247 | 3300025885 | Bacteria | 35017 |
| 193 | Ga0207653_10020529 | 3300025885 | Bacteria | 2091 |
| 194 | Ga0207699_10046414 | 3300025906 | Bacteria | 2541 |
| 195 | Ga0207643_10000274 | 3300025908 | Bacteria | 35744 |
| 196 | Ga0207643_10104818 | 3300025908 | Bacteria | 1661 |
| 197 | Ga0207684_10002300 | 3300025910 | Bacteria | 19431 |
| 198 | Ga0207684_10114987 | 3300025910 | Bacteria | 2304 |
| 199 | Ga0207657_10001032 | 3300025919 | Bacteria | 29487 |
| 200 | Ga0207646_10006553 | 3300025922 | Bacteria | 12015 |
| 201 | Ga0207646_10007766 | 3300025922 | Bacteria | 10854 |
| 202 | Ga0207646_10018507 | 3300025922 | Bacteria | 6494 |
| 203 | Ga0207687_10208179 | 3300025927 | Bacteria | 1533 |
| 204 | Ga0207644_10002534 | 3300025931 | Bacteria | 11751 |
| 205 | Ga0207690_10065585 | 3300025932 | Bacteria | 2483 |
| 206 | Ga0207686_10000022 | 3300025934 | Bacteria | 174346 |
| 207 | Ga0207686_10004880 | 3300025934 | Bacteria | 7210 |
| 208 | Ga0207686_10009833 | 3300025934 | Bacteria | 5198 |
| 209 | Ga0207709_10000056 | 3300025935 | Bacteria | 221962 |
| 210 | Ga0207691_10047614 | 3300025940 | Bacteria | 3934 |
| 211 | Ga0207689_10078668 | 3300025942 | Bacteria | 2710 |
| 212 | Ga0207667_10000044 | 3300025949 | Bacteria | 248251 |
| 213 | Ga0207667_10027431 | 3300025949 | Bacteria | 6199 |
| 214 | Ga0207667_10075798 | 3300025949 | Bacteria | 3491 |
| 215 | Ga0207712_10013477 | 3300025961 | Bacteria | 5242 |
| 216 | Ga0207712_10044240 | 3300025961 | Bacteria | 3076 |
| 217 | Ga0207703_10044294 | 3300026035 | Bacteria | 3576 |
| 218 | Ga0207678_10064323 | 3300026067 | Bacteria | 3152 |
| 219 | Ga0207708_10003060 | 3300026075 | Bacteria | 12323 |
| 220 | Ga0207708_10003897 | 3300026075 | Bacteria | 10988 |
| 221 | Ga0207708_10008452 | 3300026075 | Bacteria | 7621 |
| 222 | Ga0207702_10035657 | 3300026078 | Bacteria | 4159 |
| 223 | Ga0207702_10214066 | 3300026078 | Bacteria | 1793 |
| 224 | Ga0207641_10119298 | 3300026088 | Bacteria | 2351 |
| 225 | Ga0207648_10007383 | 3300026089 | Bacteria | 10822 |
| 226 | Ga0207648_10073127 | 3300026089 | Bacteria | 2988 |
| 227 | Ga0207648_10285810 | 3300026089 | Bacteria | 1476 |
| 228 | Ga0207676_10006868 | 3300026095 | Bacteria | 8062 |
| 229 | Ga0207674_10068641 | 3300026116 | Bacteria | 3567 |
| 230 | Ga0207674_10081328 | 3300026116 | Bacteria | 3242 |
| 231 | Ga0207675_100017764 | 3300026118 | Bacteria | 6635 |
| 232 | Ga0207675_100035141 | 3300026118 | Bacteria | 4675 |
| 233 | Ga0207675_100068100 | 3300026118 | Bacteria | 3327 |
| 234 | Ga0207675_100081266 | 3300026118 | Bacteria | 3038 |
| 235 | Ga0207683_10030940 | 3300026121 | Bacteria | 4642 |
| 236 | Ga0209281_1011147 | 3300027111 | Bacteria | 2024 |
| 237 | Ga0209282_1000005 | 3300027666 | Bacteria | 380858 |
| 238 | Ga0207428_10000543 | 3300027907 | Bacteria | 44986 |
| 239 | Ga0207428_10007378 | 3300027907 | Bacteria | 10027 |
| 240 | Ga0207428_10009786 | 3300027907 | Bacteria | 8589 |
| 241 | Ga0268266_10254080 | 3300028379 | Bacteria | 1627 |
| 242 | Ga0268265_10007809 | 3300028380 | Bacteria | 7220 |
| 243 | Ga0268265_10028333 | 3300028380 | Bacteria | 4009 |
| 244 | Ga0268265_10035430 | 3300028380 | Bacteria | 3646 |
| 245 | Ga0268265_10070553 | 3300028380 | Bacteria | 2718 |
| 246 | Ga0268264_10076573 | 3300028381 | Bacteria | 2847 |
| 247 | Ga0307515_10168092 | 3300028794 | Bacteria | 2200 |
| 248 | Ga0307511_10002924 | 3300030521 | Bacteria | 17683 |
| 249 | Ga0307512_10011207 | 3300030522 | Bacteria | 8509 |
| 250 | Ga0265760_10026782 | 3300031090 | Bacteria | 1688 |
| 251 | Ga0265327_10026312 | 3300031251 | Bacteria | 3373 |
| 252 | Ga0307513_10052728 | 3300031456 | Bacteria | 4378 |
| 253 | Ga0307509_10043511 | 3300031507 | Bacteria | 4859 |
| 254 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 255 | Ga0307408_100000112 | 3300031548 | Bacteria | 89783 |
| 256 | Ga0307408_100001881 | 3300031548 | Bacteria | 15279 |
| 257 | Ga0307408_100004065 | 3300031548 | Bacteria | 9975 |
| 258 | Ga0307516_10000424 | 3300031730 | Bacteria | 55291 |
| 259 | Ga0307406_10009213 | 3300031901 | Bacteria | 5530 |
| 260 | Ga0307414_10080493 | 3300032004 | Bacteria | 2382 |
| 261 | Ga0307411_10000141 | 3300032005 | Bacteria | 22602 |
| 262 | Ga0373939_0000107 | 3300035114 | Bacteria | 25390 |
| 263 | Ga0373962_0004162 | 3300035242 | Bacteria | 3486 |
| 264 | Ga0373931_0000226 | 3300035691 | Bacteria | 24011 |
| 265 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 266 | Ga0395899_0002976 | 3300037312 | Bacteria | 13555 |
| 267 | Ga0395899_0017747 | 3300037312 | Bacteria | 5418 |
| 268 | Ga0395899_0065133 | 3300037312 | Bacteria | 2678 |
| 269 | Ga0395899_0083320 | 3300037312 | Bacteria | 2325 |
| 270 | Ga0395899_0174683 | 3300037312 | Bacteria | 1511 |
| 271 | Ga0395900_0000426 | 3300037418 | Bacteria | 60657 |
| 272 | Ga0395900_0008926 | 3300037418 | Bacteria | 10283 |
| 273 | Ga0395900_0009371 | 3300037418 | Bacteria | 10038 |
| 274 | Ga0395900_0037192 | 3300037418 | Bacteria | 5020 |
| 275 | Ga0395900_0055166 | 3300037418 | Bacteria | 4091 |
| 276 | Ga0395900_0128182 | 3300037418 | Bacteria | 2601 |
| 277 | Ga0395900_0221967 | 3300037418 | Bacteria | 1904 |
| 278 | Ga0395898_0091347 | 3300037466 | Bacteria | 2929 |
| 279 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 280 | Ga0395905_0078616 | 3300037471 | Bacteria | 3091 |
| 281 | Ga0395905_0111047 | 3300037471 | Bacteria | 2574 |
| 282 | Ga0395905_0225131 | 3300037471 | Bacteria | 1755 |
| 283 | Ga0436364_0978054 | 3300037853 | Bacteria | 3202 |
| 284 | Ga0395901_0000345 | 3300038443 | Bacteria | 56604 |
| 285 | Ga0395901_0048652 | 3300038443 | Bacteria | 4403 |
| 286 | Ga0395901_0117245 | 3300038443 | Bacteria | 2797 |
| 287 | Ga0395901_0148614 | 3300038443 | Bacteria | 2462 |
| 288 | Ga0395901_0164250 | 3300038443 | Bacteria | 2331 |
| 289 | Ga0400483_081959 | 3300039062 | Bacteria | 6846 |
| 290 | Ga0400483_262348 | 3300039062 | Bacteria | 8840 |
| 291 | Ga0436365_0012618 | 3300039437 | Bacteria | 53643 |
| 292 | Ga0436365_1660809 | 3300039437 | Bacteria | 51972 |
| 293 | Ga0439450_004606 | 3300042008 | Bacteria | 2368 |
| 294 | Ga0450917_000896 | 3300042120 | Bacteria | 2189 |
| 295 | Ga0450891_000404 | 3300042129 | Bacteria | 4525 |
| 296 | Ga0450892_001485 | 3300042130 | Bacteria | 2257 |
| 297 | Ga0450893_0001386 | 3300042532 | Bacteria | 3695 |
| 298 | Ga0466969_0024345 | 3300044656 | Bacteria | 3113 |
| 299 | Ga0466972_0001589 | 3300044658 | Bacteria | 11097 |
| 300 | Ga0466965_0003109 | 3300044683 | Bacteria | 7235 |
| 301 | Ga0466965_0022718 | 3300044683 | Bacteria | 3025 |
| 302 | Ga0466965_0029512 | 3300044683 | Bacteria | 2669 |
| 303 | Ga0466966_0031487 | 3300044684 | Bacteria | 3439 |
| 304 | Ga0466966_0047422 | 3300044684 | Bacteria | 2739 |
| 305 | Ga0466961_0018984 | 3300044693 | Bacteria | 4423 |
| 306 | Ga0466964_0000328 | 3300044706 | Bacteria | 14165 |
| 307 | Ga0466971_0016636 | 3300044719 | Bacteria | 3248 |
| 308 | Ga0466968_0000248 | 3300044735 | Bacteria | 17059 |
| 309 | Ga0466968_0009937 | 3300044735 | Bacteria | 3674 |
| 310 | Ga0466957_0097887 | 3300044842 | Bacteria | 1845 |
| 311 | Ga0466957_0103911 | 3300044842 | Bacteria | 1794 |
| 312 | Ga0466959_0025228 | 3300045049 | Bacteria | 4404 |
| 313 | Ga0451576_0079446 | 3300045051 | Bacteria | 3413 |
| 314 | Ga0466958_0050341 | 3300045836 | Bacteria | 2522 |
| 315 | Ga0466958_0059013 | 3300045836 | Bacteria | 2333 |
| 316 | Ga0495617_000130 | 3300046452 | Bacteria | 49888 |
| 317 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 318 | Ga0495592_0000770 | 3300046454 | Bacteria | 22247 |
| 319 | Ga0495590_0000618 | 3300046457 | Bacteria | 16546 |
| 320 | Ga0495590_0026312 | 3300046457 | Bacteria | 2043 |
| 321 | Ga0495638_0006451 | 3300046460 | Bacteria | 8534 |
| 322 | Ga0495638_0027306 | 3300046460 | Bacteria | 3696 |
| 323 | Ga0495638_0038566 | 3300046460 | Bacteria | 3035 |
| 324 | Ga0495653_0003113 | 3300046463 | Bacteria | 13293 |
| 325 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 326 | Ga0495650_0000827 | 3300046471 | Bacteria | 37402 |
| 327 | Ga0495580_0016123 | 3300046472 | Bacteria | 5616 |
| 328 | Ga0495582_0010922 | 3300046473 | Bacteria | 4998 |
| 329 | Ga0495605_0000073 | 3300046474 | Bacteria | 131765 |
| 330 | Ga0495605_0000104 | 3300046474 | Bacteria | 105745 |
| 331 | Ga0495605_0004058 | 3300046474 | Bacteria | 8643 |
| 332 | Ga0495605_0009955 | 3300046474 | Bacteria | 5328 |
| 333 | Ga0495605_0054890 | 3300046474 | Bacteria | 1927 |
| 334 | Ga0495605_0078900 | 3300046474 | Bacteria | 1542 |
| 335 | Ga0495639_0002880 | 3300046475 | Bacteria | 7485 |
| 336 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 337 | Ga0495584_0000034 | 3300046491 | Bacteria | 98085 |
| 338 | Ga0495584_0000317 | 3300046491 | Bacteria | 33691 |
| 339 | Ga0495584_0000793 | 3300046491 | Bacteria | 20837 |
| 340 | Ga0495584_0002866 | 3300046491 | Bacteria | 9630 |
| 341 | Ga0495584_0048895 | 3300046491 | Bacteria | 2131 |
| 342 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 343 | Ga0495585_0000346 | 3300046492 | Bacteria | 44974 |
| 344 | Ga0495585_0000735 | 3300046492 | Bacteria | 29213 |
| 345 | Ga0495585_0001180 | 3300046492 | Bacteria | 21212 |
| 346 | Ga0495594_0007632 | 3300046499 | Bacteria | 5564 |
| 347 | Ga0495596_0000017 | 3300046500 | Bacteria | 114761 |
| 348 | Ga0495607_0001142 | 3300046501 | Bacteria | 24025 |
| 349 | Ga0495607_0002148 | 3300046501 | Bacteria | 16437 |
| 350 | Ga0495607_0005357 | 3300046501 | Bacteria | 9218 |
| 351 | Ga0495607_0007861 | 3300046501 | Bacteria | 7337 |
| 352 | Ga0495607_0007948 | 3300046501 | Bacteria | 7292 |
| 353 | Ga0495607_0013111 | 3300046501 | Bacteria | 5442 |
| 354 | Ga0495607_0032605 | 3300046501 | Bacteria | 3178 |
| 355 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 356 | Ga0495583_0000009 | 3300046506 | Bacteria | 372527 |
| 357 | Ga0495583_0000053 | 3300046506 | Bacteria | 210542 |
| 358 | Ga0495583_0000098 | 3300046506 | Bacteria | 148776 |
| 359 | Ga0495583_0000133 | 3300046506 | Bacteria | 124343 |
| 360 | Ga0495583_0017678 | 3300046506 | Bacteria | 3779 |
| 361 | Ga0495583_0022838 | 3300046506 | Bacteria | 3180 |
| 362 | Ga0495583_0031855 | 3300046506 | Bacteria | 2551 |
| 363 | Ga0495606_0000049 | 3300046507 | Bacteria | 204038 |
| 364 | Ga0495606_0000062 | 3300046507 | Bacteria | 184841 |
| 365 | Ga0495606_0000152 | 3300046507 | Bacteria | 119522 |
| 366 | Ga0495606_0000774 | 3300046507 | Bacteria | 48973 |
| 367 | Ga0495606_0002108 | 3300046507 | Bacteria | 24161 |
| 368 | Ga0495606_0002332 | 3300046507 | Bacteria | 22374 |
| 369 | Ga0495606_0021681 | 3300046507 | Bacteria | 4700 |
| 370 | Ga0495606_0050333 | 3300046507 | Bacteria | 2726 |
| 371 | Ga0495606_0069011 | 3300046507 | Bacteria | 2234 |
| 372 | Ga0495606_0091549 | 3300046507 | Bacteria | 1869 |
| 373 | Ga0495606_0133202 | 3300046507 | Bacteria | 1475 |
| 374 | Ga0495610_0002130 | 3300046512 | Bacteria | 16839 |
| 375 | Ga0495610_0003130 | 3300046512 | Bacteria | 13162 |
| 376 | Ga0495610_0023015 | 3300046512 | Bacteria | 3394 |
| 377 | Ga0495616_0000034 | 3300046513 | Bacteria | 129394 |
| 378 | Ga0495616_0000705 | 3300046513 | Bacteria | 24761 |
| 379 | Ga0495616_0001810 | 3300046513 | Bacteria | 14480 |
| 380 | Ga0495616_0002630 | 3300046513 | Bacteria | 11814 |
| 381 | Ga0495616_0004158 | 3300046513 | Bacteria | 9173 |
| 382 | Ga0495616_0009960 | 3300046513 | Bacteria | 5524 |
| 383 | Ga0495616_0012678 | 3300046513 | Bacteria | 4775 |
| 384 | Ga0495616_0078286 | 3300046513 | Bacteria | 1586 |
| 385 | Ga0495616_0092085 | 3300046513 | Bacteria | 1433 |
| 386 | Ga0495620_0014632 | 3300046515 | Bacteria | 3982 |
| 387 | Ga0495628_0013477 | 3300046516 | Bacteria | 6877 |
| 388 | Ga0495630_0002965 | 3300046517 | Bacteria | 11784 |
| 389 | Ga0495631_0002821 | 3300046518 | Bacteria | 9652 |
| 390 | Ga0495631_0009263 | 3300046518 | Bacteria | 4925 |
| 391 | Ga0495631_0031476 | 3300046518 | Bacteria | 2399 |
| 392 | Ga0495632_0000018 | 3300046519 | Bacteria | 228282 |
| 393 | Ga0495632_0000029 | 3300046519 | Bacteria | 171022 |
| 394 | Ga0495632_0000056 | 3300046519 | Bacteria | 124483 |
| 395 | Ga0495632_0005429 | 3300046519 | Bacteria | 8429 |
| 396 | Ga0495632_0017149 | 3300046519 | Bacteria | 4006 |
| 397 | Ga0495632_0028528 | 3300046519 | Bacteria | 2912 |
| 398 | Ga0495637_0000051 | 3300046520 | Bacteria | 100076 |
| 399 | Ga0495637_0016198 | 3300046520 | Bacteria | 3487 |
| 400 | Ga0495643_0000011 | 3300046522 | Bacteria | 324745 |
| 401 | Ga0495643_0000172 | 3300046522 | Bacteria | 102566 |
| 402 | Ga0495643_0004446 | 3300046522 | Bacteria | 9795 |
| 403 | Ga0495643_0033501 | 3300046522 | Bacteria | 2841 |
| 404 | Ga0495643_0081924 | 3300046522 | Bacteria | 1677 |
| 405 | Ga0495643_0090982 | 3300046522 | Bacteria | 1573 |
| 406 | Ga0495644_0000478 | 3300046523 | Bacteria | 17302 |
| 407 | Ga0495644_0000862 | 3300046523 | Bacteria | 12537 |
| 408 | Ga0495648_0000027 | 3300046524 | Bacteria | 228881 |
| 409 | Ga0495648_0000401 | 3300046524 | Bacteria | 47662 |
| 410 | Ga0495648_0045122 | 3300046524 | Bacteria | 2745 |
| 411 | Ga0495663_0008229 | 3300046525 | Bacteria | 2886 |
| 412 | Ga0495666_0012850 | 3300046526 | Bacteria | 4173 |
| 413 | Ga0495642_0000349 | 3300046528 | Bacteria | 25086 |
| 414 | Ga0495642_0001348 | 3300046528 | Bacteria | 10998 |
| 415 | Ga0495642_0009462 | 3300046528 | Bacteria | 3729 |
| 416 | Ga0495642_0021212 | 3300046528 | Bacteria | 2554 |
| 417 | Ga0495642_0051457 | 3300046528 | Bacteria | 1694 |
| 418 | Ga0495652_0001226 | 3300046529 | Bacteria | 28763 |
| 419 | Ga0495652_0047030 | 3300046529 | Bacteria | 3702 |
| 420 | Ga0495652_0088092 | 3300046529 | Bacteria | 2545 |
| 421 | Ga0495654_0000011 | 3300046530 | Bacteria | 363172 |
| 422 | Ga0495665_0005839 | 3300046531 | Bacteria | 6640 |
| 423 | Ga0495586_0132694 | 3300046535 | Bacteria | 1394 |
| 424 | Ga0495598_0021857 | 3300046537 | Bacteria | 1706 |
| 425 | Ga0495609_0000095 | 3300046538 | Bacteria | 104807 |
| 426 | Ga0495609_0000180 | 3300046538 | Bacteria | 63952 |
| 427 | Ga0495609_0000227 | 3300046538 | Bacteria | 54650 |
| 428 | Ga0495609_0000653 | 3300046538 | Bacteria | 26973 |
| 429 | Ga0495609_0025937 | 3300046538 | Bacteria | 2685 |
| 430 | Ga0495597_0000073 | 3300046542 | Bacteria | 87767 |
| 431 | Ga0495597_0000102 | 3300046542 | Bacteria | 76204 |
| 432 | Ga0495597_0008250 | 3300046542 | Bacteria | 5229 |
| 433 | Ga0495597_0021537 | 3300046542 | Bacteria | 2996 |
| 434 | Ga0495645_0134659 | 3300046543 | Bacteria | 1729 |
| 435 | Ga0495645_0150077 | 3300046543 | Bacteria | 1620 |
| 436 | Ga0495622_0000001 | 3300046557 | Bacteria | 365248 |
| 437 | Ga0495633_0000091 | 3300046558 | Bacteria | 122383 |
| 438 | Ga0495633_0003288 | 3300046558 | Bacteria | 10859 |
| 439 | Ga0495633_0010266 | 3300046558 | Bacteria | 5120 |
| 440 | Ga0495633_0010666 | 3300046558 | Bacteria | 5003 |
| 441 | Ga0495633_0021080 | 3300046558 | Bacteria | 3264 |
| 442 | Ga0495633_0023181 | 3300046558 | Bacteria | 3076 |
| 443 | Ga0495633_0054745 | 3300046558 | Bacteria | 1876 |
| 444 | Ga0495656_0003970 | 3300046615 | Bacteria | 5027 |
| 445 | Ga0495656_0011500 | 3300046615 | Bacteria | 3249 |
| 446 | Ga0495668_0000077 | 3300046616 | Bacteria | 159120 |
| 447 | Ga0495668_0000091 | 3300046616 | Bacteria | 144428 |
| 448 | Ga0495668_0007138 | 3300046616 | Bacteria | 7191 |
| 449 | Ga0495668_0013403 | 3300046616 | Bacteria | 4836 |
| 450 | Ga0495668_0031385 | 3300046616 | Bacteria | 2994 |
| 451 | Ga0495668_0087447 | 3300046616 | Bacteria | 1709 |
| 452 | Ga0495634_0012602 | 3300046642 | Bacteria | 6121 |
| 453 | Ga0495611_0002992 | 3300046648 | Bacteria | 7532 |
| 454 | Ga0495611_0010758 | 3300046648 | Bacteria | 3875 |
| 455 | Ga0495611_0013349 | 3300046648 | Bacteria | 3496 |
| 456 | Ga0495611_0016737 | 3300046648 | Bacteria | 3133 |
| 457 | Ga0495611_0033998 | 3300046648 | Bacteria | 2252 |
| 458 | Ga0495625_0000623 | 3300046660 | Bacteria | 51222 |
| 459 | Ga0495625_0000631 | 3300046660 | Bacteria | 50911 |
| 460 | Ga0495625_0002081 | 3300046660 | Bacteria | 22416 |
| 461 | Ga0495625_0012847 | 3300046660 | Bacteria | 6769 |
| 462 | Ga0495625_0016043 | 3300046660 | Bacteria | 5905 |
| 463 | Ga0495625_0028909 | 3300046660 | Bacteria | 4150 |
| 464 | Ga0495625_0083381 | 3300046660 | Bacteria | 2222 |
| 465 | Ga0495625_0143185 | 3300046660 | Bacteria | 1611 |
| 466 | Ga0495659_0001127 | 3300046664 | Bacteria | 9298 |
| 467 | Ga0495659_0036098 | 3300046664 | Bacteria | 1745 |
| 468 | Ga0495661_0000012 | 3300046665 | Bacteria | 276804 |
| 469 | Ga0495661_0001746 | 3300046665 | Bacteria | 17484 |
| 470 | Ga0495661_0005236 | 3300046665 | Bacteria | 9228 |
| 471 | Ga0495661_0010354 | 3300046665 | Bacteria | 6363 |
| 472 | Ga0495661_0019019 | 3300046665 | Bacteria | 4505 |
| 473 | Ga0495661_0053449 | 3300046665 | Bacteria | 2429 |
| 474 | Ga0495661_0065632 | 3300046665 | Bacteria | 2138 |
| 475 | Ga0495588_0000099 | 3300046674 | Bacteria | 164015 |
| 476 | Ga0495588_0000118 | 3300046674 | Bacteria | 134942 |
| 477 | Ga0495588_0009889 | 3300046674 | Bacteria | 4421 |
| 478 | Ga0495623_0006366 | 3300046679 | Bacteria | 7677 |
| 479 | Ga0495646_0001427 | 3300046680 | Bacteria | 14209 |
| 480 | Ga0495658_0032150 | 3300046683 | Bacteria | 2864 |
| 481 | Ga0495669_0000243 | 3300046684 | Bacteria | 31880 |
| 482 | Ga0495669_0001370 | 3300046684 | Bacteria | 10055 |
| 483 | Ga0495670_0000155 | 3300046691 | Bacteria | 29929 |
| 484 | Ga0495670_0000860 | 3300046691 | Bacteria | 14710 |
| 485 | Ga0495670_0035838 | 3300046691 | Bacteria | 2471 |
| 486 | Ga0495671_0000119 | 3300046692 | Bacteria | 71430 |
| 487 | Ga0495671_0000594 | 3300046692 | Bacteria | 26755 |
| 488 | Ga0495671_0055845 | 3300046692 | Bacteria | 1956 |
| 489 | Ga0495671_0069604 | 3300046692 | Bacteria | 1729 |
| 490 | Ga0495649_0000545 | 3300046694 | Bacteria | 31968 |
| 491 | Ga0495649_0012426 | 3300046694 | Bacteria | 4950 |
| 492 | Ga0495649_0108733 | 3300046694 | Bacteria | 1471 |
| 493 | Ga0495589_0000007 | 3300046794 | Bacteria | 276444 |
| 494 | Ga0495589_0000082 | 3300046794 | Bacteria | 87068 |
| 495 | Ga0495589_0000091 | 3300046794 | Bacteria | 85670 |
| 496 | Ga0495589_0009695 | 3300046794 | Bacteria | 5004 |
| 497 | Ga0495589_0050394 | 3300046794 | Bacteria | 2059 |
| 498 | Ga0495660_0000024 | 3300046810 | Bacteria | 268209 |
| 499 | Ga0495660_0000050 | 3300046810 | Bacteria | 140329 |
| 500 | Ga0495660_0001319 | 3300046810 | Bacteria | 17121 |
| 501 | Ga0495660_0027636 | 3300046810 | Bacteria | 3209 |
| 502 | Ga0495660_0031527 | 3300046810 | Bacteria | 2980 |
| 503 | Ga0495660_0034382 | 3300046810 | Bacteria | 2837 |
| 504 | Ga0495660_0092150 | 3300046810 | Bacteria | 1573 |
| 505 | Ga0495604_0008330 | 3300047317 | Bacteria | 8201 |
| 506 | Ga0495636_0000294 | 3300047318 | Bacteria | 19614 |
| 507 | Ga0495636_0025058 | 3300047318 | Bacteria | 2421 |
| 508 | Ga0495672_0000023 | 3300047320 | Bacteria | 419080 |
| 509 | Ga0495672_0000091 | 3300047320 | Bacteria | 147538 |
| 510 | Ga0495672_0000222 | 3300047320 | Bacteria | 81058 |
| 511 | Ga0495672_0000274 | 3300047320 | Bacteria | 71196 |
| 512 | Ga0495672_0013311 | 3300047320 | Bacteria | 5681 |
| 513 | Ga0495683_0000308 | 3300047323 | Bacteria | 41296 |
| 514 | Ga0495683_0051662 | 3300047323 | Bacteria | 2054 |
| 515 | Ga0495683_0060964 | 3300047323 | Bacteria | 1868 |
| 516 | Ga0495683_0067748 | 3300047323 | Bacteria | 1757 |
| 517 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 518 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 519 | Ga0495687_000016 | 3300047443 | Bacteria | 359237 |
| 520 | Ga0495687_000097 | 3300047443 | Bacteria | 132755 |
| 521 | Ga0495687_057798 | 3300047443 | Bacteria | 1611 |
| 522 | Ga0495687_057804 | 3300047443 | Bacteria | 1611 |
| 523 | Ga0495675_0003347 | 3300047444 | Bacteria | 9651 |
| 524 | Ga0495677_0000005 | 3300047445 | Bacteria | 243336 |
| 525 | Ga0495677_0002148 | 3300047445 | Bacteria | 7805 |
| 526 | Ga0495677_0002597 | 3300047445 | Bacteria | 7066 |
| 527 | Ga0495677_0002761 | 3300047445 | Bacteria | 6849 |
| 528 | Ga0495677_0013348 | 3300047445 | Bacteria | 2989 |
| 529 | Ga0495679_007291 | 3300047446 | Bacteria | 4631 |
| 530 | Ga0495685_000447 | 3300047447 | Bacteria | 12977 |
| 531 | Ga0495681_0000016 | 3300047470 | Bacteria | 181322 |
| 532 | Ga0495681_0007932 | 3300047470 | Bacteria | 6707 |
| 533 | Ga0495681_0008313 | 3300047470 | Bacteria | 6519 |
| 534 | Ga0495681_0069416 | 3300047470 | Bacteria | 1601 |
| 535 | Ga0495684_0043904 | 3300047471 | Bacteria | 3422 |
| 536 | Ga0495686_0005426 | 3300047472 | Bacteria | 10067 |
| 537 | Ga0495686_0008350 | 3300047472 | Bacteria | 7610 |
| 538 | Ga0495686_0114997 | 3300047472 | Bacteria | 1609 |
| 539 | Ga0495602_0014236 | 3300048088 | Bacteria | 8082 |
| 540 | Ga0495626_0000081 | 3300048091 | Bacteria | 128894 |
| 541 | Ga0495626_0001744 | 3300048091 | Bacteria | 16588 |
| 542 | Ga0495626_0003375 | 3300048091 | Bacteria | 10277 |
| 543 | Ga0495626_0004562 | 3300048091 | Bacteria | 8448 |
| 544 | Ga0495626_0034585 | 3300048091 | Bacteria | 2416 |
| 545 | Ga0496102_0201436 | 3300048905 | Bacteria | 1876 |
| 546 | Ga0496103_0026892 | 3300048906 | Bacteria | 3482 |
| 547 | Ga0496103_0039202 | 3300048906 | Bacteria | 2911 |
| 548 | Ga0496104_0012427 | 3300048907 | Bacteria | 7655 |
| 549 | Ga0496105_0042807 | 3300048908 | Bacteria | 3734 |
| 550 | Ga0496105_0171219 | 3300048908 | Bacteria | 1780 |
| 551 | Ga0496106_0001179 | 3300048909 | Bacteria | 19465 |
| 552 | Ga0496107_0141721 | 3300048910 | Bacteria | 1777 |
| 553 | Ga0496109_0000016 | 3300048912 | Bacteria | 212455 |
| 554 | Ga0496109_0291628 | 3300048912 | Bacteria | 1538 |
| 555 | Ga0496110_0118321 | 3300048913 | Bacteria | 2386 |
| 556 | Ga0496113_0017117 | 3300048916 | Bacteria | 5025 |
| 557 | Ga0496113_0023277 | 3300048916 | Bacteria | 4392 |
| 558 | Ga0496113_0238502 | 3300048916 | Bacteria | 1451 |
| 559 | Ga0496114_0015800 | 3300048917 | Bacteria | 6074 |
| 560 | Ga0496114_0032741 | 3300048917 | Bacteria | 4281 |
| 561 | Ga0496114_0109096 | 3300048917 | Bacteria | 2370 |
| 562 | Ga0496114_0144274 | 3300048917 | Bacteria | 2063 |
| 563 | Ga0496118_0112204 | 3300048921 | Bacteria | 1805 |
| 564 | Ga0496121_0009529 | 3300048924 | Bacteria | 11125 |
| 565 | Ga0496122_0000509 | 3300048925 | Bacteria | 80337 |
| 566 | Ga0496122_0010223 | 3300048925 | Bacteria | 9725 |
| 567 | Ga0496122_0012279 | 3300048925 | Bacteria | 8558 |
| 568 | Ga0496123_0004540 | 3300048926 | Bacteria | 14484 |
| 569 | Ga0496123_0024929 | 3300048926 | Bacteria | 4526 |
| 570 | Ga0496124_0013135 | 3300048927 | Bacteria | 8106 |
| 571 | Ga0496125_0003043 | 3300048928 | Bacteria | 20963 |
| 572 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 573 | Ga0495678_000038 | 3300049459 | Bacteria | 192188 |
| 574 | Ga0495678_000060 | 3300049459 | Bacteria | 142851 |
| 575 | Ga0495678_001312 | 3300049459 | Bacteria | 20025 |
| 576 | Ga0495678_002370 | 3300049459 | Bacteria | 12922 |
| 577 | Ga0495682_0000035 | 3300049460 | Bacteria | 126349 |
| 578 | Ga0495682_0000041 | 3300049460 | Bacteria | 119154 |
| 579 | Ga0495682_0007543 | 3300049460 | Bacteria | 4320 |
| 580 | Ga0495682_0019415 | 3300049460 | Bacteria | 2557 |
| 581 | Ga0495682_0054819 | 3300049460 | Bacteria | 1446 |
| 582 | Ga0501032_0000949 | 3300049569 | Bacteria | 23410 |
| 583 | Ga0501033_0005130 | 3300049570 | Bacteria | 10418 |
| 584 | Ga0501034_0065018 | 3300049571 | Bacteria | 3660 |
| 585 | Ga0501036_0002105 | 3300049572 | Bacteria | 15543 |
| 586 | Ga0501037_0004413 | 3300049573 | Bacteria | 10219 |
| 587 | Ga0501038_0010034 | 3300049574 | Bacteria | 8671 |
| 588 | Ga0501038_0097601 | 3300049574 | Bacteria | 2451 |
| 589 | Ga0501039_0031084 | 3300049575 | Bacteria | 4116 |
| 590 | Ga0501042_0022503 | 3300049578 | Bacteria | 4403 |
| 591 | Ga0501043_0001717 | 3300049579 | Bacteria | 18925 |
| 592 | Ga0501046_0001953 | 3300049580 | Bacteria | 19603 |
| 593 | Ga0501046_0061126 | 3300049580 | Bacteria | 2947 |
| 594 | Ga0501047_0032685 | 3300049581 | Bacteria | 5024 |
| 595 | Ga0501047_0117541 | 3300049581 | Bacteria | 2540 |
| 596 | Ga0501067_0034033 | 3300049583 | Bacteria | 2827 |
| 597 | Ga0501069_0088192 | 3300049585 | Bacteria | 1753 |
| 598 | Ga0501070_0035755 | 3300049586 | Bacteria | 4148 |
| 599 | Ga0501071_0065370 | 3300049587 | Bacteria | 2641 |
| 600 | Ga0501072_0129747 | 3300049588 | Bacteria | 2009 |
| 601 | Ga0501073_0055571 | 3300049589 | Bacteria | 2769 |
| 602 | Ga0501074_0001065 | 3300049590 | Bacteria | 17883 |
| 603 | Ga0501075_0001896 | 3300049591 | Bacteria | 13800 |
| 604 | Ga0501233_002501 | 3300049668 | Bacteria | 3249 |
| 605 | Ga0501221_003395 | 3300049704 | Bacteria | 2617 |
| 606 | Ga0501080_0014397 | 3300049742 | Bacteria | 7284 |
| 607 | Ga0501080_0084682 | 3300049742 | Bacteria | 2945 |
| 608 | Ga0501083_0001996 | 3300049744 | Bacteria | 14037 |
| 609 | Ga0501083_0028998 | 3300049744 | Bacteria | 3811 |
| 610 | Ga0501267_000405 | 3300049764 | Bacteria | 3307 |
| 611 | Ga0501269_000021 | 3300049766 | Bacteria | 53792 |
| 612 | Ga0501035_0018182 | 3300049822 | Bacteria | 6473 |
| 613 | Ga0501044_0001693 | 3300049823 | Bacteria | 25871 |
| 614 | Ga0501044_0062689 | 3300049823 | Bacteria | 3800 |
| 615 | Ga0501044_0087424 | 3300049823 | Bacteria | 3148 |
| 616 | Ga0501044_0310909 | 3300049823 | Bacteria | 1502 |
| 617 | Ga0501045_0116823 | 3300049824 | Bacteria | 1980 |
| 618 | nmdc:mga0yw44_51919_c1 | 3300050492 | Bacteria | 2484 |
| 619 | nmdc:mga0k408_19234_c1 | 3300050493 | Bacteria | 3814 |
| 620 | nmdc:mga0k408_950_c1 | 3300050493 | Bacteria | 11034 |
| 621 | nmdc:mga06z11_12092_c1 | 3300050494 | Bacteria | 3744 |
| 622 | nmdc:mga06z11_89182_c1 | 3300050494 | Bacteria | 1671 |
| 623 | nmdc:mga07m45_1152_c1 | 3300050496 | Bacteria | 11864 |
| 624 | nmdc:mga05p37_23486_c1 | 3300050507 | Bacteria | 7482 |
| 625 | nmdc:mga05p37_341662_c1 | 3300050507 | Bacteria | 1765 |
| 626 | nmdc:mga05p37_368432_c1 | 3300050507 | Bacteria | 1687 |
| 627 | nmdc:mga05p37_382095_c1 | 3300050507 | Bacteria | 1650 |
| 628 | nmdc:mga09592_153689_c1 | 3300050508 | Bacteria | 1986 |
| 629 | nmdc:mga09592_57522_c1 | 3300050508 | Bacteria | 3287 |
| 630 | nmdc:mga09592_64908_c1 | 3300050508 | Bacteria | 3091 |
| 631 | nmdc:mga06r32_220746_c1 | 3300050510 | Bacteria | 1884 |
| 632 | nmdc:mga06r32_56139_c1 | 3300050510 | Bacteria | 3779 |
| 633 | nmdc:mga06r32_78608_c1 | 3300050510 | Bacteria | 3207 |
| 634 | nmdc:mga08y16_10388_c1 | 3300050511 | Bacteria | 9766 |
| 635 | nmdc:mga08y16_1120_c1 | 3300050511 | Bacteria | 26424 |
| 636 | nmdc:mga08y16_262434_c1 | 3300050511 | Bacteria | 1784 |
| 637 | nmdc:mga08y16_297_c1 | 3300050511 | Bacteria | 44732 |
| 638 | nmdc:mga08y16_73697_c1 | 3300050511 | Bacteria | 3557 |
| 639 | nmdc:mga0n895_9417_c1 | 3300050512 | Bacteria | 8545 |
| 640 | nmdc:mga0rr50_59901_c1 | 3300050513 | Bacteria | 2861 |
| 641 | nmdc:mga0a205_102222_c1 | 3300050515 | Bacteria | 2765 |
| 642 | Ga0495595_0021731 | 3300053084 | Bacteria | 2807 |
| 643 | Ga0495619_0053894 | 3300053085 | Bacteria | 2661 |
| 644 | Ga0500578_0051430 | 3300053086 | Bacteria | 2639 |
| 645 | Ga0500646_0005149 | 3300053090 | Bacteria | 3309 |
| 646 | Ga0500641_0002966 | 3300053096 | Bacteria | 6010 |
| 647 | Ga0500641_0007221 | 3300053096 | Bacteria | 3961 |
| 648 | Ga0500595_001574 | 3300053119 | Bacteria | 12062 |
| 649 | Ga0500618_000052 | 3300053125 | Bacteria | 102436 |
| 650 | Ga0500618_000149 | 3300053125 | Bacteria | 57395 |
| 651 | Ga0500642_0000150 | 3300053130 | Bacteria | 29542 |
| 652 | Ga0500652_049146 | 3300053131 | Bacteria | 1718 |
| 653 | Ga0500568_0004233 | 3300053139 | Bacteria | 7722 |
| 654 | Ga0500568_0005301 | 3300053139 | Bacteria | 6695 |
| 655 | Ga0500586_003036 | 3300053145 | Bacteria | 3903 |
| 656 | Ga0500604_0013246 | 3300053151 | Bacteria | 2232 |
| 657 | Ga0500616_0001920 | 3300053153 | Bacteria | 18568 |
| 658 | Ga0500637_0011482 | 3300053178 | Bacteria | 4585 |
| 659 | Ga0500645_000442 | 3300053730 | Bacteria | 28390 |
| 660 | Ga0501084_0038643 | 3300054114 | Bacteria | 3990 |
| 661 | Ga0590071_000519 | 3300059421 | Bacteria | 11238 |
| 662 | Ga0590074_001524 | 3300059423 | Bacteria | 3753 |
| 663 | Ga0590075_000902 | 3300059424 | Bacteria | 7742 |
| 664 | Ga0590077_000519 | 3300059426 | Bacteria | 10643 |
| 665 | Ga0501082_0001089 | 3300060353 | Bacteria | 24038 |
| 666 | Ga0501082_0011196 | 3300060353 | Bacteria | 7708 |
| 667 | Ga0501082_0062591 | 3300060353 | Bacteria | 3203 |
| 668 | Ga0501082_0242386 | 3300060353 | Bacteria | 1569 |
| 669 | Ga0466962_0002626 | 3300061719 | Bacteria | 8545 |
| 670 | Ga0466962_0011993 | 3300061719 | Bacteria | 4169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10210187 | Ga0157374_102101871 | 349 |
| 2 | 3300026067 | Ga0207678_10064323 | Ga0207678_100643232 | 374 |
| 3 | 3300046501 | Ga0495607_0013111 | Ga0495607_0013111_4271_5395 | 374 |
| 4 | 3300046506 | Ga0495583_0031855 | Ga0495583_0031855_1403_2527 | 374 |
| 5 | 3300046691 | Ga0495670_0000860 | Ga0495670_0000860_23_1147 | 374 |
| 6 | 3300048912 | Ga0496109_0291628 | Ga0496109_0291628_15_1139 | 374 |
| 7 | 3300046660 | Ga0495625_0083381 | Ga0495625_0083381_1063_2208 | 381 |
| 8 | 3300030522 | Ga0307512_10011207 | Ga0307512_100112072 | 387 |
| 9 | 3300046454 | Ga0495592_0000770 | Ga0495592_0000770_4752_6041 | 391 |
| 10 | 3300046501 | Ga0495607_0032605 | Ga0495607_0032605_1738_3030 | 399 |
| 11 | 3300046513 | Ga0495616_0004158 | Ga0495616_0004158_4418_5782 | 399 |
| 12 | 3300046538 | Ga0495609_0000227 | Ga0495609_0000227_31478_32842 | 399 |
| 13 | 3300037418 | Ga0395900_0128182 | Ga0395900_0128182_1385_2590 | 401 |
| 14 | 3300046460 | Ga0495638_0038566 | Ga0495638_0038566_1339_2631 | 407 |
| 15 | 3300046491 | Ga0495584_0002866 | Ga0495584_0002866_1516_2880 | 407 |
| 16 | 3300046506 | Ga0495583_0017678 | Ga0495583_0017678_1549_2913 | 407 |
| 17 | 3300046507 | Ga0495606_0021681 | Ga0495606_0021681_2236_3531 | 407 |
| 18 | 3300046616 | Ga0495668_0007138 | Ga0495668_0007138_5369_6733 | 407 |
| 19 | 3300046660 | Ga0495625_0012847 | Ga0495625_0012847_5329_6621 | 407 |
| 20 | 3300046664 | Ga0495659_0001127 | Ga0495659_0001127_2858_4222 | 407 |
| 21 | 3300046684 | Ga0495669_0000243 | Ga0495669_0000243_24307_25671 | 407 |
| 22 | 3300046694 | Ga0495649_0012426 | Ga0495649_0012426_212_1576 | 407 |
| 23 | 3300046810 | Ga0495660_0001319 | Ga0495660_0001319_1937_3232 | 407 |
| 24 | 3300047470 | Ga0495681_0008313 | Ga0495681_0008313_1782_3146 | 407 |
| 25 | 3300046558 | Ga0495633_0010666 | Ga0495633_0010666_2525_3820 | 412 |
| 26 | 3300053145 | Ga0500586_003036 | Ga0500586_003036_478_1773 | 412 |
| 27 | 3300046522 | Ga0495643_0000011 | Ga0495643_0000011_281975_283270 | 413 |
| 28 | 3300046524 | Ga0495648_0045122 | Ga0495648_0045122_908_2203 | 413 |
| 29 | 3300046616 | Ga0495668_0013403 | Ga0495668_0013403_2601_3890 | 413 |
| 30 | 3300046660 | Ga0495625_0002081 | Ga0495625_0002081_2508_3803 | 413 |
| 31 | 3300047320 | Ga0495672_0000274 | Ga0495672_0000274_28655_29950 | 413 |
| 32 | 3300049459 | Ga0495678_000038 | Ga0495678_000038_149543_150838 | 413 |
| 33 | 3300046506 | Ga0495583_0000133 | Ga0495583_0000133_46176_47465 | 414 |
| 34 | 3300046507 | Ga0495606_0000774 | Ga0495606_0000774_19565_20860 | 414 |
| 35 | 3300046507 | Ga0495606_0002332 | Ga0495606_0002332_1411_2700 | 414 |
| 36 | 3300046692 | Ga0495671_0055845 | Ga0495671_0055845_577_1872 | 414 |
| 37 | 3300046694 | Ga0495649_0000545 | Ga0495649_0000545_2699_3988 | 414 |
| 38 | 3300046694 | Ga0495649_0108733 | Ga0495649_0108733_45_1340 | 414 |
| 39 | 3300046794 | Ga0495589_0009695 | Ga0495589_0009695_2174_3463 | 414 |
| 40 | 3300046692 | Ga0495671_0000119 | Ga0495671_0000119_55761_57056 | 415 |
| 41 | 3300047320 | Ga0495672_0000023 | Ga0495672_0000023_337212_338507 | 415 |
| 42 | 3300059421 | Ga0590071_000519 | Ga0590071_000519_852_2144 | 417 |
| 43 | 3300059423 | Ga0590074_001524 | Ga0590074_001524_2372_3664 | 417 |
| 44 | 3300059424 | Ga0590075_000902 | Ga0590075_000902_6222_7514 | 417 |
| 45 | 3300059426 | Ga0590077_000519 | Ga0590077_000519_3040_4332 | 417 |
| 46 | 3300044656 | Ga0466969_0024345 | Ga0466969_0024345_385_1677 | 419 |
| 47 | 3300044683 | Ga0466965_0003109 | Ga0466965_0003109_1459_2751 | 419 |
| 48 | 3300044684 | Ga0466966_0047422 | Ga0466966_0047422_1334_2626 | 419 |
| 49 | 3300044693 | Ga0466961_0018984 | Ga0466961_0018984_153_1445 | 419 |
| 50 | 3300044719 | Ga0466971_0016636 | Ga0466971_0016636_738_2030 | 419 |
| 51 | 3300044735 | Ga0466968_0009937 | Ga0466968_0009937_51_1343 | 419 |
| 52 | 3300045049 | Ga0466959_0025228 | Ga0466959_0025228_2169_3461 | 419 |
| 53 | 3300045836 | Ga0466958_0059013 | Ga0466958_0059013_533_1825 | 419 |
| 54 | 3300046457 | Ga0495590_0000618 | Ga0495590_0000618_5645_6940 | 419 |
| 55 | 3300046463 | Ga0495653_0003113 | Ga0495653_0003113_11040_12335 | 419 |
| 56 | 3300046472 | Ga0495580_0016123 | Ga0495580_0016123_203_1498 | 419 |
| 57 | 3300046473 | Ga0495582_0010922 | Ga0495582_0010922_1604_2899 | 419 |
| 58 | 3300046499 | Ga0495594_0007632 | Ga0495594_0007632_696_1991 | 419 |
| 59 | 3300046507 | Ga0495606_0069011 | Ga0495606_0069011_535_1830 | 419 |
| 60 | 3300046517 | Ga0495630_0002965 | Ga0495630_0002965_9772_11067 | 419 |
| 61 | 3300046526 | Ga0495666_0012850 | Ga0495666_0012850_1339_2634 | 419 |
| 62 | 3300046529 | Ga0495652_0047030 | Ga0495652_0047030_2302_3597 | 419 |
| 63 | 3300046531 | Ga0495665_0005839 | Ga0495665_0005839_5086_6381 | 419 |
| 64 | 3300046535 | Ga0495586_0132694 | Ga0495586_0132694_46_1341 | 419 |
| 65 | 3300046642 | Ga0495634_0012602 | Ga0495634_0012602_2769_4064 | 419 |
| 66 | 3300046679 | Ga0495623_0006366 | Ga0495623_0006366_5612_6907 | 419 |
| 67 | 3300047317 | Ga0495604_0008330 | Ga0495604_0008330_6399_7694 | 419 |
| 68 | 3300047444 | Ga0495675_0003347 | Ga0495675_0003347_1896_3191 | 419 |
| 69 | 3300061719 | Ga0466962_0002626 | Ga0466962_0002626_5484_6776 | 419 |
| 70 | 3300046519 | Ga0495632_0000056 | Ga0495632_0000056_46150_47445 | 421 |
| 71 | 3300046528 | Ga0495642_0001348 | Ga0495642_0001348_1878_3173 | 421 |
| 72 | 3300046684 | Ga0495669_0001370 | Ga0495669_0001370_65_1360 | 421 |
| 73 | 3300006844 | Ga0075428_100035039 | Ga0075428_1000350392 | 422 |
| 74 | 3300009147 | Ga0114129_10150799 | Ga0114129_101507992 | 422 |
| 75 | 3300046474 | Ga0495605_0004058 | Ga0495605_0004058_26_1294 | 422 |
| 76 | 3300031730 | Ga0307516_10000424 | Ga0307516_1000042439 | 423 |
| 77 | 3300046475 | Ga0495639_0002880 | Ga0495639_0002880_635_1924 | 423 |
| 78 | 3300046529 | Ga0495652_0088092 | Ga0495652_0088092_594_1883 | 423 |
| 79 | 3300046648 | Ga0495611_0033998 | Ga0495611_0033998_836_2128 | 423 |
| 80 | 3300050507 | nmdc:mga05p37_341662_c1 | nmdc:mga05p37_341662_c1_276_1568 | 423 |
| 81 | 3300037853 | Ga0436364_0978054 | Ga0436364_0978054_1819_3123 | 426 |
| 82 | 3300005435 | Ga0070714_100039841 | Ga0070714_1000398412 | 427 |
| 83 | iso_pu_bacteria | 2548876994 | 2550696115 | 427 |
| 84 | iso_pu_bacteria | 2600255292 | 2601671518 | 427 |
| 85 | iso_pu_bacteria | 2643221544 | 2643743024 | 427 |
| 86 | iso_pu_bacteria | 2643221556 | 2643800785 | 427 |
| 87 | iso_pu_bacteria | 2643221645 | 2644252922 | 427 |
| 88 | iso_pu_bacteria | 2643221646 | 2644260456 | 427 |
| 89 | iso_pu_bacteria | 2643221664 | 2644355031 | 427 |
| 90 | iso_pu_bacteria | 2643221684 | 2644471015 | 427 |
| 91 | iso_pu_bacteria | 2738541280 | 2738737814 | 427 |
| 92 | iso_pu_bacteria | 2738541300 | 2738842021 | 427 |
| 93 | iso_pu_bacteria | 2738541337 | 2739055879 | 427 |
| 94 | iso_pu_bacteria | 2738543018 | 2739272880 | 427 |
| 95 | iso_pu_bacteria | 2738543030 | 2739341924 | 427 |
| 96 | iso_pu_bacteria | 2765235838 | 2765567920 | 427 |
| 97 | iso_pu_bacteria | 2839094727 | 2839097792 | 427 |
| 98 | iso_pu_bacteria | 2842711865 | 2842713487 | 427 |
| 99 | iso_pu_bacteria | 2857547612 | 2857548648 | 427 |
| 100 | iso_pu_bacteria | 2857553236 | 2857555252 | 427 |
| 101 | iso_pu_bacteria | 2857558681 | 2857561408 | 427 |
| 102 | iso_pu_bacteria | 2857564685 | 2857566450 | 427 |
| 103 | iso_pu_bacteria | 2857564685 | 2857568651 | 427 |
| 104 | iso_pu_bacteria | 2904424332 | 2904424684 | 427 |
| 105 | iso_pu_bacteria | 2919476304 | 2919477616 | 427 |
| 106 | iso_pu_bacteria | 2928130867 | 2928132849 | 427 |
| 107 | iso_pu_bacteria | 8047673197 | 8047677328 | 427 |
| 108 | 3300005295 | Ga0065707_10002256 | Ga0065707_100022564 | 428 |
| 109 | 3300005467 | Ga0070706_100027367 | Ga0070706_1000273672 | 428 |
| 110 | 3300005545 | Ga0070695_100005464 | Ga0070695_1000054642 | 428 |
| 111 | 3300005546 | Ga0070696_100105038 | Ga0070696_1001050382 | 428 |
| 112 | 3300006178 | Ga0075367_10086429 | Ga0075367_100864292 | 428 |
| 113 | 3300006844 | Ga0075428_100208492 | Ga0075428_1002084922 | 428 |
| 114 | 3300006846 | Ga0075430_100123245 | Ga0075430_1001232452 | 428 |
| 115 | 3300009094 | Ga0111539_10014758 | Ga0111539_100147583 | 428 |
| 116 | 3300009147 | Ga0114129_10068358 | Ga0114129_100683583 | 428 |
| 117 | 3300014326 | Ga0157380_10011050 | Ga0157380_100110503 | 428 |
| 118 | 3300025885 | Ga0207653_10020529 | Ga0207653_100205292 | 428 |
| 119 | 3300025910 | Ga0207684_10002300 | Ga0207684_1000230011 | 428 |
| 120 | 3300025922 | Ga0207646_10006553 | Ga0207646_100065534 | 428 |
| 121 | 3300026118 | Ga0207675_100068100 | Ga0207675_1000681001 | 428 |
| 122 | 3300028380 | Ga0268265_10028333 | Ga0268265_100283333 | 428 |
| 123 | 3300031090 | Ga0265760_10026782 | Ga0265760_100267821 | 428 |
| 124 | 3300031251 | Ga0265327_10026312 | Ga0265327_100263122 | 428 |
| 125 | 3300031548 | Ga0307408_100000112 | Ga0307408_10000011210 | 428 |
| 126 | 3300031901 | Ga0307406_10009213 | Ga0307406_100092132 | 428 |
| 127 | 3300044842 | Ga0466957_0097887 | Ga0466957_0097887_298_1584 | 428 |
| 128 | 3300048921 | Ga0496118_0112204 | Ga0496118_0112204_266_1558 | 428 |
| 129 | 3300048924 | Ga0496121_0009529 | Ga0496121_0009529_2981_4273 | 428 |
| 130 | 3300049578 | Ga0501042_0022503 | Ga0501042_0022503_1920_3212 | 428 |
| 131 | 3300049587 | Ga0501071_0065370 | Ga0501071_0065370_879_2171 | 428 |
| 132 | 3300049591 | Ga0501075_0001896 | Ga0501075_0001896_6788_8080 | 428 |
| 133 | 3300050494 | nmdc:mga06z11_12092_c1 | nmdc:mga06z11_12092_c1_1947_3248 | 428 |
| 134 | 3300050494 | nmdc:mga06z11_89182_c1 | nmdc:mga06z11_89182_c1_163_1464 | 428 |
| 135 | 3300050507 | nmdc:mga05p37_368432_c1 | nmdc:mga05p37_368432_c1_198_1490 | 428 |
| 136 | 3300050508 | nmdc:mga09592_64908_c1 | nmdc:mga09592_64908_c1_1283_2575 | 428 |
| 137 | 3300050511 | nmdc:mga08y16_10388_c1 | nmdc:mga08y16_10388_c1_501_1793 | 428 |
| 138 | 3300050511 | nmdc:mga08y16_73697_c1 | nmdc:mga08y16_73697_c1_2072_3364 | 428 |
| 139 | 3300053139 | Ga0500568_0005301 | Ga0500568_0005301_745_2046 | 428 |
| 140 | 3300053730 | Ga0500645_000442 | Ga0500645_000442_503_1795 | 428 |
| 141 | 3300060353 | Ga0501082_0011196 | Ga0501082_0011196_6399_7691 | 428 |
| 142 | 3300060353 | Ga0501082_0242386 | Ga0501082_0242386_224_1516 | 428 |
| 143 | iso_pu_bacteria | 2643221585 | 2643932955 | 428 |
| 144 | iso_pu_bacteria | 2643221639 | 2644218561 | 428 |
| 145 | iso_pu_bacteria | 2643221656 | 2644314205 | 428 |
| 146 | iso_pu_bacteria | 2808606418 | 2809143688 | 428 |
| 147 | 3300005365 | Ga0070688_100019455 | Ga0070688_1000194552 | 429 |
| 148 | 3300005445 | Ga0070708_100015369 | Ga0070708_1000153692 | 429 |
| 149 | 3300005466 | Ga0070685_10022916 | Ga0070685_100229162 | 429 |
| 150 | 3300005536 | Ga0070697_100143412 | Ga0070697_1001434121 | 429 |
| 151 | 3300005617 | Ga0068859_100157892 | Ga0068859_1001578922 | 429 |
| 152 | 3300005841 | Ga0068863_100133007 | Ga0068863_1001330072 | 429 |
| 153 | 3300005842 | Ga0068858_100072239 | Ga0068858_1000722392 | 429 |
| 154 | 3300005843 | Ga0068860_100012371 | Ga0068860_1000123714 | 429 |
| 155 | 3300005844 | Ga0068862_100273970 | Ga0068862_1002739702 | 429 |
| 156 | 3300006931 | Ga0097620_100157873 | Ga0097620_1001578732 | 429 |
| 157 | 3300009094 | Ga0111539_10000785 | Ga0111539_1000078511 | 429 |
| 158 | 3300009148 | Ga0105243_10016945 | Ga0105243_100169452 | 429 |
| 159 | 3300009177 | Ga0105248_10174437 | Ga0105248_101744372 | 429 |
| 160 | 3300014968 | Ga0157379_10006872 | Ga0157379_100068725 | 429 |
| 161 | 3300014968 | Ga0157379_10175163 | Ga0157379_101751632 | 429 |
| 162 | 3300017792 | Ga0163161_10129311 | Ga0163161_101293112 | 429 |
| 163 | 3300025297 | Ga0209758_1000304 | Ga0209758_100030444 | 429 |
| 164 | 3300025910 | Ga0207684_10114987 | Ga0207684_101149872 | 429 |
| 165 | 3300025940 | Ga0207691_10047614 | Ga0207691_100476142 | 429 |
| 166 | 3300025942 | Ga0207689_10078668 | Ga0207689_100786682 | 429 |
| 167 | 3300026075 | Ga0207708_10003897 | Ga0207708_100038974 | 429 |
| 168 | 3300026075 | Ga0207708_10008452 | Ga0207708_100084523 | 429 |
| 169 | 3300026089 | Ga0207648_10007383 | Ga0207648_100073835 | 429 |
| 170 | 3300026089 | Ga0207648_10073127 | Ga0207648_100731272 | 429 |
| 171 | 3300026118 | Ga0207675_100017764 | Ga0207675_1000177642 | 429 |
| 172 | 3300026118 | Ga0207675_100035141 | Ga0207675_1000351412 | 429 |
| 173 | 3300026121 | Ga0207683_10030940 | Ga0207683_100309402 | 429 |
| 174 | 3300027907 | Ga0207428_10000543 | Ga0207428_1000054328 | 429 |
| 175 | 3300028379 | Ga0268266_10254080 | Ga0268266_102540802 | 429 |
| 176 | 3300028380 | Ga0268265_10070553 | Ga0268265_100705532 | 429 |
| 177 | 3300046507 | Ga0495606_0000062 | Ga0495606_0000062_60627_61916 | 429 |
| 178 | 3300046512 | Ga0495610_0002130 | Ga0495610_0002130_14686_15975 | 429 |
| 179 | 3300046516 | Ga0495628_0013477 | Ga0495628_0013477_3010_4335 | 429 |
| 180 | 3300046616 | Ga0495668_0000091 | Ga0495668_0000091_83895_85184 | 429 |
| 181 | 3300046660 | Ga0495625_0000623 | Ga0495625_0000623_9162_10451 | 429 |
| 182 | 3300047318 | Ga0495636_0025058 | Ga0495636_0025058_47_1342 | 429 |
| 183 | 3300047471 | Ga0495684_0043904 | Ga0495684_0043904_1687_3012 | 429 |
| 184 | 3300047472 | Ga0495686_0005426 | Ga0495686_0005426_7722_9011 | 429 |
| 185 | 3300050492 | nmdc:mga0yw44_51919_c1 | nmdc:mga0yw44_51919_c1_990_2285 | 429 |
| 186 | 3300050493 | nmdc:mga0k408_19234_c1 | nmdc:mga0k408_19234_c1_1735_3027 | 429 |
| 187 | 3300050493 | nmdc:mga0k408_950_c1 | nmdc:mga0k408_950_c1_5120_6415 | 429 |
| 188 | 3300050508 | nmdc:mga09592_57522_c1 | nmdc:mga09592_57522_c1_657_1952 | 429 |
| 189 | 3300050511 | nmdc:mga08y16_297_c1 | nmdc:mga08y16_297_c1_14566_15861 | 429 |
| 190 | 3300053096 | Ga0500641_0007221 | Ga0500641_0007221_1471_2766 | 429 |
| 191 | 3300053131 | Ga0500652_049146 | Ga0500652_049146_126_1421 | 429 |
| 192 | 3300002774 | JGI25150J39212_1001652 | JGI25150J39212_10016523 | 430 |
| 193 | 3300002987 | JGI25159J45721_1008823 | JGI25159J45721_10088232 | 430 |
| 194 | 3300003316 | rootH1_10004214 | rootH1_1000421424 | 430 |
| 195 | 3300003322 | rootL2_10042461 | rootL2_100424612 | 430 |
| 196 | 3300003374 | JGI25161J50226_1007707 | JGI25161J50226_10077072 | 430 |
| 197 | 3300003771 | Ga0055526_1001585 | Ga0055526_10015856 | 430 |
| 198 | 3300003771 | Ga0055526_1015106 | Ga0055526_10151062 | 430 |
| 199 | 3300003773 | Ga0055537_1000076 | Ga0055537_100007611 | 430 |
| 200 | 3300003773 | Ga0055537_1000260 | Ga0055537_100026012 | 430 |
| 201 | 3300003773 | Ga0055537_1007956 | Ga0055537_10079562 | 430 |
| 202 | 3300003784 | Ga0055534_1000124 | Ga0055534_100012427 | 430 |
| 203 | 3300003790 | Ga0055528_1000184 | Ga0055528_100018412 | 430 |
| 204 | 3300003791 | Ga0055530_10012976 | Ga0055530_100129762 | 430 |
| 205 | 3300003794 | Ga0055531_10010104 | Ga0055531_100101045 | 430 |
| 206 | 3300004625 | Ga0055543_1003564 | Ga0055543_10035642 | 430 |
| 207 | 3300004625 | Ga0055543_1013926 | Ga0055543_10139261 | 430 |
| 208 | 3300005262 | Ga0065165_1000003 | Ga0065165_100000392 | 430 |
| 209 | 3300005290 | Ga0065712_10000210 | Ga0065712_1000021012 | 430 |
| 210 | 3300005293 | Ga0065715_10000337 | Ga0065715_1000033712 | 430 |
| 211 | 3300005331 | Ga0070670_100185195 | Ga0070670_1001851951 | 430 |
| 212 | 3300005337 | Ga0070682_100025657 | Ga0070682_1000256572 | 430 |
| 213 | 3300005355 | Ga0070671_100098835 | Ga0070671_1000988352 | 430 |
| 214 | 3300005365 | Ga0070688_100071504 | Ga0070688_1000715042 | 430 |
| 215 | 3300005456 | Ga0070678_100012011 | Ga0070678_1000120114 | 430 |
| 216 | 3300005459 | Ga0068867_100212296 | Ga0068867_1002122961 | 430 |
| 217 | 3300005466 | Ga0070685_10094148 | Ga0070685_100941481 | 430 |
| 218 | 3300005468 | Ga0070707_100014591 | Ga0070707_1000145912 | 430 |
| 219 | 3300005471 | Ga0070698_100090482 | Ga0070698_1000904822 | 430 |
| 220 | 3300005518 | Ga0070699_100224209 | Ga0070699_1002242091 | 430 |
| 221 | 3300005535 | Ga0070684_100016773 | Ga0070684_1000167733 | 430 |
| 222 | 3300005543 | Ga0070672_100001959 | Ga0070672_10000195912 | 430 |
| 223 | 3300005548 | Ga0070665_100009834 | Ga0070665_1000098346 | 430 |
| 224 | 3300005564 | Ga0070664_100111149 | Ga0070664_1001111492 | 430 |
| 225 | 3300005614 | Ga0068856_100111352 | Ga0068856_1001113522 | 430 |
| 226 | 3300005616 | Ga0068852_100216024 | Ga0068852_1002160242 | 430 |
| 227 | 3300005937 | Ga0081455_10005188 | Ga0081455_100051884 | 430 |
| 228 | 3300005985 | Ga0081539_10006080 | Ga0081539_100060808 | 430 |
| 229 | 3300006847 | Ga0075431_100060018 | Ga0075431_1000600182 | 430 |
| 230 | 3300006948 | Ga0099826_10000008 | Ga0099826_10000008368 | 430 |
| 231 | 3300007076 | Ga0075435_100070028 | Ga0075435_1000700282 | 430 |
| 232 | 3300009094 | Ga0111539_10106201 | Ga0111539_101062012 | 430 |
| 233 | 3300009147 | Ga0114129_10179124 | Ga0114129_101791242 | 430 |
| 234 | 3300009147 | Ga0114129_10212096 | Ga0114129_102120962 | 430 |
| 235 | 3300009147 | Ga0114129_10238102 | Ga0114129_102381022 | 430 |
| 236 | 3300009148 | Ga0105243_10139218 | Ga0105243_101392181 | 430 |
| 237 | 3300009176 | Ga0105242_10198129 | Ga0105242_101981292 | 430 |
| 238 | 3300009177 | Ga0105248_10035248 | Ga0105248_100352483 | 430 |
| 239 | 3300013306 | Ga0163162_10256688 | Ga0163162_102566882 | 430 |
| 240 | 3300013308 | Ga0157375_10060661 | Ga0157375_100606612 | 430 |
| 241 | 3300013308 | Ga0157375_10349907 | Ga0157375_103499071 | 430 |
| 242 | 3300014968 | Ga0157379_10028145 | Ga0157379_100281452 | 430 |
| 243 | 3300017792 | Ga0163161_10010148 | Ga0163161_100101482 | 430 |
| 244 | 3300025208 | Ga0209436_100320 | Ga0209436_10032015 | 430 |
| 245 | 3300025208 | Ga0209436_111731 | Ga0209436_1117311 | 430 |
| 246 | 3300025245 | Ga0207425_1000110 | Ga0207425_100011019 | 430 |
| 247 | 3300025258 | Ga0209129_1001089 | Ga0209129_100108911 | 430 |
| 248 | 3300025263 | Ga0209565_1000018 | Ga0209565_1000018299 | 430 |
| 249 | 3300025263 | Ga0209565_1001274 | Ga0209565_10012746 | 430 |
| 250 | 3300025263 | Ga0209565_1001275 | Ga0209565_10012756 | 430 |
| 251 | 3300025273 | Ga0209673_1000006 | Ga0209673_1000006473 | 430 |
| 252 | 3300025273 | Ga0209673_1008901 | Ga0209673_10089014 | 430 |
| 253 | 3300025284 | Ga0209130_1000036 | Ga0209130_1000036238 | 430 |
| 254 | 3300025284 | Ga0209130_1014739 | Ga0209130_10147392 | 430 |
| 255 | 3300025284 | Ga0209130_1019582 | Ga0209130_10195822 | 430 |
| 256 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005299 | 430 |
| 257 | 3300025291 | Ga0209675_1002720 | Ga0209675_10027205 | 430 |
| 258 | 3300025292 | Ga0209676_1008457 | Ga0209676_10084572 | 430 |
| 259 | 3300025295 | Ga0209564_1000144 | Ga0209564_100014437 | 430 |
| 260 | 3300025295 | Ga0209564_1006481 | Ga0209564_10064816 | 430 |
| 261 | 3300025297 | Ga0209758_1000048 | Ga0209758_1000048254 | 430 |
| 262 | 3300025297 | Ga0209758_1018730 | Ga0209758_10187303 | 430 |
| 263 | 3300025298 | Ga0209050_1000519 | Ga0209050_100051919 | 430 |
| 264 | 3300025298 | Ga0209050_1003570 | Ga0209050_10035702 | 430 |
| 265 | 3300025298 | Ga0209050_1004809 | Ga0209050_10048093 | 430 |
| 266 | 3300025299 | Ga0209256_1000018 | Ga0209256_1000018376 | 430 |
| 267 | 3300025299 | Ga0209256_1000325 | Ga0209256_100032551 | 430 |
| 268 | 3300025299 | Ga0209256_1003732 | Ga0209256_10037326 | 430 |
| 269 | 3300025299 | Ga0209256_1003816 | Ga0209256_10038165 | 430 |
| 270 | 3300025302 | Ga0207426_1003756 | Ga0207426_10037562 | 430 |
| 271 | 3300025302 | Ga0207426_1037090 | Ga0207426_10370902 | 430 |
| 272 | 3300025304 | Ga0209257_1000123 | Ga0209257_100012370 | 430 |
| 273 | 3300025304 | Ga0209257_1000237 | Ga0209257_10002374 | 430 |
| 274 | 3300025304 | Ga0209257_1016477 | Ga0209257_10164772 | 430 |
| 275 | 3300025906 | Ga0207699_10046414 | Ga0207699_100464142 | 430 |
| 276 | 3300025922 | Ga0207646_10018507 | Ga0207646_100185073 | 430 |
| 277 | 3300026089 | Ga0207648_10285810 | Ga0207648_102858101 | 430 |
| 278 | 3300026095 | Ga0207676_10006868 | Ga0207676_100068682 | 430 |
| 279 | 3300027666 | Ga0209282_1000005 | Ga0209282_1000005366 | 430 |
| 280 | 3300027907 | Ga0207428_10009786 | Ga0207428_100097861 | 430 |
| 281 | 3300030521 | Ga0307511_10002924 | Ga0307511_1000292415 | 430 |
| 282 | 3300031456 | Ga0307513_10052728 | Ga0307513_100527282 | 430 |
| 283 | 3300031507 | Ga0307509_10043511 | Ga0307509_100435113 | 430 |
| 284 | 3300031548 | Ga0307408_100001881 | Ga0307408_1000018812 | 430 |
| 285 | 3300031548 | Ga0307408_100004065 | Ga0307408_1000040652 | 430 |
| 286 | 3300037471 | Ga0395905_0000071 | Ga0395905_0000071_166563_167861 | 430 |
| 287 | 3300039062 | Ga0400483_081959 | Ga0400483_081959_4541_5839 | 430 |
| 288 | 3300039062 | Ga0400483_262348 | Ga0400483_262348_613_1911 | 430 |
| 289 | 3300042120 | Ga0450917_000896 | Ga0450917_000896_801_2096 | 430 |
| 290 | 3300042129 | Ga0450891_000404 | Ga0450891_000404_2449_3744 | 430 |
| 291 | 3300042130 | Ga0450892_001485 | Ga0450892_001485_497_1792 | 430 |
| 292 | 3300042532 | Ga0450893_0001386 | Ga0450893_0001386_302_1597 | 430 |
| 293 | 3300045051 | Ga0451576_0079446 | Ga0451576_0079446_1838_3133 | 430 |
| 294 | 3300046474 | Ga0495605_0054890 | Ga0495605_0054890_248_1540 | 430 |
| 295 | 3300046501 | Ga0495607_0007861 | Ga0495607_0007861_3964_5256 | 430 |
| 296 | 3300046506 | Ga0495583_0000008 | Ga0495583_0000008_32027_33319 | 430 |
| 297 | 3300046506 | Ga0495583_0000098 | Ga0495583_0000098_70041_71333 | 430 |
| 298 | 3300046513 | Ga0495616_0009960 | Ga0495616_0009960_1148_2440 | 430 |
| 299 | 3300046519 | Ga0495632_0005429 | Ga0495632_0005429_4018_5310 | 430 |
| 300 | 3300046522 | Ga0495643_0000172 | Ga0495643_0000172_974_2266 | 430 |
| 301 | 3300046522 | Ga0495643_0081924 | Ga0495643_0081924_193_1485 | 430 |
| 302 | 3300046542 | Ga0495597_0021537 | Ga0495597_0021537_1305_2597 | 430 |
| 303 | 3300046615 | Ga0495656_0003970 | Ga0495656_0003970_1359_2651 | 430 |
| 304 | 3300046648 | Ga0495611_0010758 | Ga0495611_0010758_1418_2710 | 430 |
| 305 | 3300046665 | Ga0495661_0005236 | Ga0495661_0005236_3429_4721 | 430 |
| 306 | 3300046665 | Ga0495661_0010354 | Ga0495661_0010354_2472_3764 | 430 |
| 307 | 3300046683 | Ga0495658_0032150 | Ga0495658_0032150_1135_2433 | 430 |
| 308 | 3300046810 | Ga0495660_0034382 | Ga0495660_0034382_651_1943 | 430 |
| 309 | 3300047318 | Ga0495636_0000294 | Ga0495636_0000294_17808_19100 | 430 |
| 310 | 3300047445 | Ga0495677_0002597 | Ga0495677_0002597_3059_4351 | 430 |
| 311 | 3300047445 | Ga0495677_0002761 | Ga0495677_0002761_4376_5668 | 430 |
| 312 | 3300047446 | Ga0495679_007291 | Ga0495679_007291_1278_2570 | 430 |
| 313 | 3300047470 | Ga0495681_0069416 | Ga0495681_0069416_54_1346 | 430 |
| 314 | 3300048906 | Ga0496103_0039202 | Ga0496103_0039202_253_1545 | 430 |
| 315 | 3300048907 | Ga0496104_0012427 | Ga0496104_0012427_4700_5998 | 430 |
| 316 | 3300048908 | Ga0496105_0042807 | Ga0496105_0042807_1255_2553 | 430 |
| 317 | 3300048912 | Ga0496109_0000016 | Ga0496109_0000016_116685_117983 | 430 |
| 318 | 3300048913 | Ga0496110_0118321 | Ga0496110_0118321_530_1828 | 430 |
| 319 | 3300048917 | Ga0496114_0015800 | Ga0496114_0015800_4256_5554 | 430 |
| 320 | 3300048917 | Ga0496114_0032741 | Ga0496114_0032741_2855_4153 | 430 |
| 321 | 3300049459 | Ga0495678_002370 | Ga0495678_002370_6213_7505 | 430 |
| 322 | 3300049569 | Ga0501032_0000949 | Ga0501032_0000949_13858_15156 | 430 |
| 323 | 3300049570 | Ga0501033_0005130 | Ga0501033_0005130_6858_8156 | 430 |
| 324 | 3300049571 | Ga0501034_0065018 | Ga0501034_0065018_152_1450 | 430 |
| 325 | 3300049572 | Ga0501036_0002105 | Ga0501036_0002105_8746_10044 | 430 |
| 326 | 3300049573 | Ga0501037_0004413 | Ga0501037_0004413_1829_3127 | 430 |
| 327 | 3300049574 | Ga0501038_0010034 | Ga0501038_0010034_6024_7322 | 430 |
| 328 | 3300049574 | Ga0501038_0097601 | Ga0501038_0097601_746_2044 | 430 |
| 329 | 3300049575 | Ga0501039_0031084 | Ga0501039_0031084_1318_2616 | 430 |
| 330 | 3300049579 | Ga0501043_0001717 | Ga0501043_0001717_1502_2800 | 430 |
| 331 | 3300049580 | Ga0501046_0001953 | Ga0501046_0001953_1122_2420 | 430 |
| 332 | 3300049580 | Ga0501046_0061126 | Ga0501046_0061126_402_1700 | 430 |
| 333 | 3300049581 | Ga0501047_0032685 | Ga0501047_0032685_3674_4972 | 430 |
| 334 | 3300049581 | Ga0501047_0117541 | Ga0501047_0117541_1081_2379 | 430 |
| 335 | 3300049583 | Ga0501067_0034033 | Ga0501067_0034033_1512_2810 | 430 |
| 336 | 3300049585 | Ga0501069_0088192 | Ga0501069_0088192_147_1445 | 430 |
| 337 | 3300049586 | Ga0501070_0035755 | Ga0501070_0035755_1349_2647 | 430 |
| 338 | 3300049588 | Ga0501072_0129747 | Ga0501072_0129747_113_1411 | 430 |
| 339 | 3300049589 | Ga0501073_0055571 | Ga0501073_0055571_243_1541 | 430 |
| 340 | 3300049590 | Ga0501074_0001065 | Ga0501074_0001065_272_1570 | 430 |
| 341 | 3300049668 | Ga0501233_002501 | Ga0501233_002501_608_1903 | 430 |
| 342 | 3300049704 | Ga0501221_003395 | Ga0501221_003395_1023_2318 | 430 |
| 343 | 3300049742 | Ga0501080_0014397 | Ga0501080_0014397_5155_6453 | 430 |
| 344 | 3300049742 | Ga0501080_0084682 | Ga0501080_0084682_299_1597 | 430 |
| 345 | 3300049744 | Ga0501083_0001996 | Ga0501083_0001996_3501_4799 | 430 |
| 346 | 3300049744 | Ga0501083_0028998 | Ga0501083_0028998_113_1411 | 430 |
| 347 | 3300049764 | Ga0501267_000405 | Ga0501267_000405_1802_3097 | 430 |
| 348 | 3300049822 | Ga0501035_0018182 | Ga0501035_0018182_3719_5017 | 430 |
| 349 | 3300049823 | Ga0501044_0001693 | Ga0501044_0001693_8615_9913 | 430 |
| 350 | 3300049823 | Ga0501044_0087424 | Ga0501044_0087424_1287_2585 | 430 |
| 351 | 3300049823 | Ga0501044_0310909 | Ga0501044_0310909_115_1413 | 430 |
| 352 | 3300049824 | Ga0501045_0116823 | Ga0501045_0116823_262_1569 | 430 |
| 353 | 3300050507 | nmdc:mga05p37_23486_c1 | nmdc:mga05p37_23486_c1_3517_4815 | 430 |
| 354 | 3300050507 | nmdc:mga05p37_382095_c1 | nmdc:mga05p37_382095_c1_88_1386 | 430 |
| 355 | 3300050510 | nmdc:mga06r32_220746_c1 | nmdc:mga06r32_220746_c1_125_1423 | 430 |
| 356 | 3300050510 | nmdc:mga06r32_56139_c1 | nmdc:mga06r32_56139_c1_1464_2762 | 430 |
| 357 | 3300050510 | nmdc:mga06r32_78608_c1 | nmdc:mga06r32_78608_c1_276_1574 | 430 |
| 358 | 3300050511 | nmdc:mga08y16_1120_c1 | nmdc:mga08y16_1120_c1_834_2132 | 430 |
| 359 | 3300050512 | nmdc:mga0n895_9417_c1 | nmdc:mga0n895_9417_c1_4366_5664 | 430 |
| 360 | 3300050513 | nmdc:mga0rr50_59901_c1 | nmdc:mga0rr50_59901_c1_468_1766 | 430 |
| 361 | 3300050515 | nmdc:mga0a205_102222_c1 | nmdc:mga0a205_102222_c1_1229_2527 | 430 |
| 362 | 3300053084 | Ga0495595_0021731 | Ga0495595_0021731_1366_2664 | 430 |
| 363 | 3300053085 | Ga0495619_0053894 | Ga0495619_0053894_700_1998 | 430 |
| 364 | 3300053086 | Ga0500578_0051430 | Ga0500578_0051430_1094_2392 | 430 |
| 365 | 3300053090 | Ga0500646_0005149 | Ga0500646_0005149_328_1626 | 430 |
| 366 | 3300053096 | Ga0500641_0002966 | Ga0500641_0002966_268_1566 | 430 |
| 367 | 3300053119 | Ga0500595_001574 | Ga0500595_001574_5027_6325 | 430 |
| 368 | 3300053130 | Ga0500642_0000150 | Ga0500642_0000150_19588_20886 | 430 |
| 369 | 3300053139 | Ga0500568_0004233 | Ga0500568_0004233_4111_5409 | 430 |
| 370 | 3300053151 | Ga0500604_0013246 | Ga0500604_0013246_269_1567 | 430 |
| 371 | 3300053153 | Ga0500616_0001920 | Ga0500616_0001920_16350_17648 | 430 |
| 372 | 3300053178 | Ga0500637_0011482 | Ga0500637_0011482_1187_2494 | 430 |
| 373 | 3300054114 | Ga0501084_0038643 | Ga0501084_0038643_1862_3160 | 430 |
| 374 | 3300060353 | Ga0501082_0001089 | Ga0501082_0001089_5922_7220 | 430 |
| 375 | 3300060353 | Ga0501082_0062591 | Ga0501082_0062591_1516_2814 | 430 |
| 376 | 3300002774 | JGI25150J39212_1001281 | JGI25150J39212_10012813 | 431 |
| 377 | 3300003215 | JGI25153J46596_10020644 | JGI25153J46596_100206442 | 431 |
| 378 | 3300003322 | rootL2_10030166 | rootL2_100301662 | 431 |
| 379 | 3300003759 | Ga0055525_1000136 | Ga0055525_100013640 | 431 |
| 380 | 3300005290 | Ga0065712_10000508 | Ga0065712_100005087 | 431 |
| 381 | 3300005295 | Ga0065707_10115084 | Ga0065707_101150841 | 431 |
| 382 | 3300005327 | Ga0070658_10177764 | Ga0070658_101777642 | 431 |
| 383 | 3300005327 | Ga0070658_10232746 | Ga0070658_102327461 | 431 |
| 384 | 3300005330 | Ga0070690_100005110 | Ga0070690_1000051102 | 431 |
| 385 | 3300005330 | Ga0070690_100042208 | Ga0070690_1000422081 | 431 |
| 386 | 3300005331 | Ga0070670_100006570 | Ga0070670_1000065701 | 431 |
| 387 | 3300005344 | Ga0070661_100076251 | Ga0070661_1000762511 | 431 |
| 388 | 3300005345 | Ga0070692_10030775 | Ga0070692_100307752 | 431 |
| 389 | 3300005355 | Ga0070671_100169022 | Ga0070671_1001690221 | 431 |
| 390 | 3300005355 | Ga0070671_100256317 | Ga0070671_1002563172 | 431 |
| 391 | 3300005366 | Ga0070659_100076514 | Ga0070659_1000765142 | 431 |
| 392 | 3300005366 | Ga0070659_100164420 | Ga0070659_1001644202 | 431 |
| 393 | 3300005406 | Ga0070703_10000142 | Ga0070703_1000014213 | 431 |
| 394 | 3300005441 | Ga0070700_100015632 | Ga0070700_1000156323 | 431 |
| 395 | 3300005444 | Ga0070694_100009689 | Ga0070694_1000096892 | 431 |
| 396 | 3300005444 | Ga0070694_100046083 | Ga0070694_1000460832 | 431 |
| 397 | 3300005444 | Ga0070694_100066573 | Ga0070694_1000665731 | 431 |
| 398 | 3300005444 | Ga0070694_100094257 | Ga0070694_1000942572 | 431 |
| 399 | 3300005445 | Ga0070708_100053681 | Ga0070708_1000536812 | 431 |
| 400 | 3300005457 | Ga0070662_100147745 | Ga0070662_1001477452 | 431 |
| 401 | 3300005458 | Ga0070681_10041961 | Ga0070681_100419612 | 431 |
| 402 | 3300005468 | Ga0070707_100004141 | Ga0070707_1000041418 | 431 |
| 403 | 3300005536 | Ga0070697_100000726 | Ga0070697_1000007268 | 431 |
| 404 | 3300005544 | Ga0070686_100015305 | Ga0070686_1000153053 | 431 |
| 405 | 3300005544 | Ga0070686_100072163 | Ga0070686_1000721631 | 431 |
| 406 | 3300005546 | Ga0070696_100059126 | Ga0070696_1000591261 | 431 |
| 407 | 3300005549 | Ga0070704_100040495 | Ga0070704_1000404952 | 431 |
| 408 | 3300005563 | Ga0068855_100000220 | Ga0068855_10000022050 | 431 |
| 409 | 3300005563 | Ga0068855_100106818 | Ga0068855_1001068182 | 431 |
| 410 | 3300005577 | Ga0068857_100041485 | Ga0068857_1000414851 | 431 |
| 411 | 3300005614 | Ga0068856_100050059 | Ga0068856_1000500593 | 431 |
| 412 | 3300005617 | Ga0068859_100025593 | Ga0068859_1000255932 | 431 |
| 413 | 3300005617 | Ga0068859_100111261 | Ga0068859_1001112612 | 431 |
| 414 | 3300005834 | Ga0068851_10041992 | Ga0068851_100419921 | 431 |
| 415 | 3300005841 | Ga0068863_100234167 | Ga0068863_1002341671 | 431 |
| 416 | 3300005842 | Ga0068858_100072488 | Ga0068858_1000724882 | 431 |
| 417 | 3300005842 | Ga0068858_100186564 | Ga0068858_1001865641 | 431 |
| 418 | 3300005844 | Ga0068862_100007428 | Ga0068862_1000074287 | 431 |
| 419 | 3300005844 | Ga0068862_100016113 | Ga0068862_1000161134 | 431 |
| 420 | 3300006353 | Ga0075370_10024202 | Ga0075370_100242022 | 431 |
| 421 | 3300006844 | Ga0075428_100058779 | Ga0075428_1000587792 | 431 |
| 422 | 3300006880 | Ga0075429_100082543 | Ga0075429_1000825432 | 431 |
| 423 | 3300006931 | Ga0097620_100025593 | Ga0097620_1000255932 | 431 |
| 424 | 3300006931 | Ga0097620_100111266 | Ga0097620_1001112662 | 431 |
| 425 | 3300006946 | Ga0079104_1008607 | Ga0079104_10086072 | 431 |
| 426 | 3300009036 | Ga0105244_10001244 | Ga0105244_1000124415 | 431 |
| 427 | 3300009094 | Ga0111539_10005248 | Ga0111539_1000524810 | 431 |
| 428 | 3300009094 | Ga0111539_10109397 | Ga0111539_101093972 | 431 |
| 429 | 3300009148 | Ga0105243_10000051 | Ga0105243_1000005127 | 431 |
| 430 | 3300009148 | Ga0105243_10185181 | Ga0105243_101851812 | 431 |
| 431 | 3300009176 | Ga0105242_10000379 | Ga0105242_1000037920 | 431 |
| 432 | 3300009176 | Ga0105242_10000777 | Ga0105242_100007775 | 431 |
| 433 | 3300009177 | Ga0105248_10044594 | Ga0105248_100445942 | 431 |
| 434 | 3300009545 | Ga0105237_10106902 | Ga0105237_101069022 | 431 |
| 435 | 3300011119 | Ga0105246_10079775 | Ga0105246_100797751 | 431 |
| 436 | 3300013297 | Ga0157378_10318209 | Ga0157378_103182091 | 431 |
| 437 | 3300013306 | Ga0163162_10131565 | Ga0163162_101315652 | 431 |
| 438 | 3300013306 | Ga0163162_10260306 | Ga0163162_102603062 | 431 |
| 439 | 3300013308 | Ga0157375_10009288 | Ga0157375_100092882 | 431 |
| 440 | 3300014326 | Ga0157380_10007546 | Ga0157380_100075463 | 431 |
| 441 | 3300014326 | Ga0157380_10013708 | Ga0157380_100137084 | 431 |
| 442 | 3300015261 | Ga0182006_1000008 | Ga0182006_100000899 | 431 |
| 443 | 3300015265 | Ga0182005_1000022 | Ga0182005_1000022123 | 431 |
| 444 | 3300017792 | Ga0163161_10015004 | Ga0163161_100150042 | 431 |
| 445 | 3300021384 | Ga0213876_10000078 | Ga0213876_1000007844 | 431 |
| 446 | 3300021384 | Ga0213876_10000741 | Ga0213876_100007417 | 431 |
| 447 | 3300025230 | Ga0209563_100003 | Ga0209563_1000031650 | 431 |
| 448 | 3300025245 | Ga0207425_1002130 | Ga0207425_10021305 | 431 |
| 449 | 3300025254 | Ga0209148_1000817 | Ga0209148_100081721 | 431 |
| 450 | 3300025294 | Ga0209025_1002805 | Ga0209025_100280510 | 431 |
| 451 | 3300025297 | Ga0209758_1000515 | Ga0209758_100051511 | 431 |
| 452 | 3300025321 | Ga0207656_10028251 | Ga0207656_100282512 | 431 |
| 453 | 3300025885 | Ga0207653_10000247 | Ga0207653_1000024713 | 431 |
| 454 | 3300025908 | Ga0207643_10000274 | Ga0207643_100002747 | 431 |
| 455 | 3300025908 | Ga0207643_10104818 | Ga0207643_101048181 | 431 |
| 456 | 3300025919 | Ga0207657_10001032 | Ga0207657_1000103216 | 431 |
| 457 | 3300025922 | Ga0207646_10007766 | Ga0207646_100077668 | 431 |
| 458 | 3300025927 | Ga0207687_10208179 | Ga0207687_102081791 | 431 |
| 459 | 3300025931 | Ga0207644_10002534 | Ga0207644_100025343 | 431 |
| 460 | 3300025932 | Ga0207690_10065585 | Ga0207690_100655852 | 431 |
| 461 | 3300025934 | Ga0207686_10000022 | Ga0207686_1000002275 | 431 |
| 462 | 3300025934 | Ga0207686_10004880 | Ga0207686_100048802 | 431 |
| 463 | 3300025934 | Ga0207686_10009833 | Ga0207686_100098332 | 431 |
| 464 | 3300025935 | Ga0207709_10000056 | Ga0207709_1000005675 | 431 |
| 465 | 3300025949 | Ga0207667_10000044 | Ga0207667_1000004499 | 431 |
| 466 | 3300025949 | Ga0207667_10027431 | Ga0207667_100274312 | 431 |
| 467 | 3300025949 | Ga0207667_10075798 | Ga0207667_100757982 | 431 |
| 468 | 3300025961 | Ga0207712_10013477 | Ga0207712_100134772 | 431 |
| 469 | 3300025961 | Ga0207712_10044240 | Ga0207712_100442402 | 431 |
| 470 | 3300026035 | Ga0207703_10044294 | Ga0207703_100442942 | 431 |
| 471 | 3300026075 | Ga0207708_10003060 | Ga0207708_100030604 | 431 |
| 472 | 3300026078 | Ga0207702_10035657 | Ga0207702_100356572 | 431 |
| 473 | 3300026078 | Ga0207702_10214066 | Ga0207702_102140662 | 431 |
| 474 | 3300026088 | Ga0207641_10119298 | Ga0207641_101192981 | 431 |
| 475 | 3300026116 | Ga0207674_10068641 | Ga0207674_100686411 | 431 |
| 476 | 3300026116 | Ga0207674_10081328 | Ga0207674_100813282 | 431 |
| 477 | 3300026118 | Ga0207675_100081266 | Ga0207675_1000812662 | 431 |
| 478 | 3300027111 | Ga0209281_1011147 | Ga0209281_10111472 | 431 |
| 479 | 3300027907 | Ga0207428_10007378 | Ga0207428_100073783 | 431 |
| 480 | 3300028380 | Ga0268265_10007809 | Ga0268265_100078093 | 431 |
| 481 | 3300028380 | Ga0268265_10035430 | Ga0268265_100354303 | 431 |
| 482 | 3300028381 | Ga0268264_10076573 | Ga0268264_100765732 | 431 |
| 483 | 3300028794 | Ga0307515_10168092 | Ga0307515_101680922 | 431 |
| 484 | 3300031548 | Ga0307408_100000023 | Ga0307408_100000023153 | 431 |
| 485 | 3300032004 | Ga0307414_10080493 | Ga0307414_100804931 | 431 |
| 486 | 3300032005 | Ga0307411_10000141 | Ga0307411_100001419 | 431 |
| 487 | 3300035114 | Ga0373939_0000107 | Ga0373939_0000107_20191_21489 | 431 |
| 488 | 3300035242 | Ga0373962_0004162 | Ga0373962_0004162_1933_3231 | 431 |
| 489 | 3300035691 | Ga0373931_0000226 | Ga0373931_0000226_20412_21710 | 431 |
| 490 | 3300037312 | Ga0395899_0000012 | Ga0395899_0000012_27625_28920 | 431 |
| 491 | 3300037312 | Ga0395899_0002976 | Ga0395899_0002976_10817_12112 | 431 |
| 492 | 3300037312 | Ga0395899_0017747 | Ga0395899_0017747_1374_2669 | 431 |
| 493 | 3300037312 | Ga0395899_0065133 | Ga0395899_0065133_455_1750 | 431 |
| 494 | 3300037312 | Ga0395899_0083320 | Ga0395899_0083320_1016_2311 | 431 |
| 495 | 3300037312 | Ga0395899_0174683 | Ga0395899_0174683_168_1463 | 431 |
| 496 | 3300037418 | Ga0395900_0000426 | Ga0395900_0000426_45773_47107 | 431 |
| 497 | 3300037418 | Ga0395900_0008926 | Ga0395900_0008926_305_1600 | 431 |
| 498 | 3300037418 | Ga0395900_0009371 | Ga0395900_0009371_2621_3916 | 431 |
| 499 | 3300037418 | Ga0395900_0037192 | Ga0395900_0037192_3451_4746 | 431 |
| 500 | 3300037418 | Ga0395900_0055166 | Ga0395900_0055166_80_1375 | 431 |
| 501 | 3300037418 | Ga0395900_0221967 | Ga0395900_0221967_450_1799 | 431 |
| 502 | 3300037466 | Ga0395898_0091347 | Ga0395898_0091347_1426_2721 | 431 |
| 503 | 3300037471 | Ga0395905_0078616 | Ga0395905_0078616_1534_2829 | 431 |
| 504 | 3300037471 | Ga0395905_0111047 | Ga0395905_0111047_727_2022 | 431 |
| 505 | 3300037471 | Ga0395905_0225131 | Ga0395905_0225131_177_1472 | 431 |
| 506 | 3300038443 | Ga0395901_0000345 | Ga0395901_0000345_20217_21512 | 431 |
| 507 | 3300038443 | Ga0395901_0048652 | Ga0395901_0048652_155_1450 | 431 |
| 508 | 3300038443 | Ga0395901_0117245 | Ga0395901_0117245_1106_2401 | 431 |
| 509 | 3300038443 | Ga0395901_0148614 | Ga0395901_0148614_999_2342 | 431 |
| 510 | 3300038443 | Ga0395901_0164250 | Ga0395901_0164250_209_1504 | 431 |
| 511 | 3300039437 | Ga0436365_0012618 | Ga0436365_0012618_40747_42048 | 431 |
| 512 | 3300039437 | Ga0436365_1660809 | Ga0436365_1660809_37965_39266 | 431 |
| 513 | 3300042008 | Ga0439450_004606 | Ga0439450_004606_178_1473 | 431 |
| 514 | 3300044658 | Ga0466972_0001589 | Ga0466972_0001589_2323_3618 | 431 |
| 515 | 3300044683 | Ga0466965_0022718 | Ga0466965_0022718_36_1331 | 431 |
| 516 | 3300044683 | Ga0466965_0029512 | Ga0466965_0029512_987_2282 | 431 |
| 517 | 3300044684 | Ga0466966_0031487 | Ga0466966_0031487_173_1468 | 431 |
| 518 | 3300044706 | Ga0466964_0000328 | Ga0466964_0000328_2408_3703 | 431 |
| 519 | 3300044735 | Ga0466968_0000248 | Ga0466968_0000248_13442_14737 | 431 |
| 520 | 3300044842 | Ga0466957_0103911 | Ga0466957_0103911_392_1687 | 431 |
| 521 | 3300045836 | Ga0466958_0050341 | Ga0466958_0050341_356_1651 | 431 |
| 522 | 3300046452 | Ga0495617_000130 | Ga0495617_000130_9693_10988 | 431 |
| 523 | 3300046453 | Ga0495627_000001 | Ga0495627_000001_305302_306663 | 431 |
| 524 | 3300046457 | Ga0495590_0026312 | Ga0495590_0026312_408_1703 | 431 |
| 525 | 3300046460 | Ga0495638_0006451 | Ga0495638_0006451_2751_4046 | 431 |
| 526 | 3300046460 | Ga0495638_0027306 | Ga0495638_0027306_2225_3520 | 431 |
| 527 | 3300046471 | Ga0495650_0000001 | Ga0495650_0000001_126323_127618 | 431 |
| 528 | 3300046471 | Ga0495650_0000827 | Ga0495650_0000827_15811_17106 | 431 |
| 529 | 3300046474 | Ga0495605_0000073 | Ga0495605_0000073_38008_39303 | 431 |
| 530 | 3300046474 | Ga0495605_0000104 | Ga0495605_0000104_69417_70712 | 431 |
| 531 | 3300046474 | Ga0495605_0009955 | Ga0495605_0009955_1539_2834 | 431 |
| 532 | 3300046474 | Ga0495605_0078900 | Ga0495605_0078900_99_1394 | 431 |
| 533 | 3300046491 | Ga0495584_0000002 | Ga0495584_0000002_283416_284711 | 431 |
| 534 | 3300046491 | Ga0495584_0000034 | Ga0495584_0000034_1945_3288 | 431 |
| 535 | 3300046491 | Ga0495584_0000317 | Ga0495584_0000317_11607_12902 | 431 |
| 536 | 3300046491 | Ga0495584_0000793 | Ga0495584_0000793_667_1962 | 431 |
| 537 | 3300046491 | Ga0495584_0048895 | Ga0495584_0048895_181_1476 | 431 |
| 538 | 3300046492 | Ga0495585_0000002 | Ga0495585_0000002_63302_64597 | 431 |
| 539 | 3300046492 | Ga0495585_0000346 | Ga0495585_0000346_864_2207 | 431 |
| 540 | 3300046492 | Ga0495585_0000735 | Ga0495585_0000735_26932_28242 | 431 |
| 541 | 3300046492 | Ga0495585_0001180 | Ga0495585_0001180_18852_20147 | 431 |
| 542 | 3300046500 | Ga0495596_0000017 | Ga0495596_0000017_259_1554 | 431 |
| 543 | 3300046501 | Ga0495607_0001142 | Ga0495607_0001142_15200_16495 | 431 |
| 544 | 3300046501 | Ga0495607_0002148 | Ga0495607_0002148_14938_16233 | 431 |
| 545 | 3300046501 | Ga0495607_0005357 | Ga0495607_0005357_1424_2719 | 431 |
| 546 | 3300046501 | Ga0495607_0007948 | Ga0495607_0007948_5890_7185 | 431 |
| 547 | 3300046506 | Ga0495583_0000009 | Ga0495583_0000009_357019_358329 | 431 |
| 548 | 3300046506 | Ga0495583_0000053 | Ga0495583_0000053_63892_65187 | 431 |
| 549 | 3300046506 | Ga0495583_0022838 | Ga0495583_0022838_324_1625 | 431 |
| 550 | 3300046507 | Ga0495606_0000049 | Ga0495606_0000049_97366_98661 | 431 |
| 551 | 3300046507 | Ga0495606_0000152 | Ga0495606_0000152_51709_53067 | 431 |
| 552 | 3300046507 | Ga0495606_0002108 | Ga0495606_0002108_7060_8355 | 431 |
| 553 | 3300046507 | Ga0495606_0050333 | Ga0495606_0050333_577_1872 | 431 |
| 554 | 3300046507 | Ga0495606_0091549 | Ga0495606_0091549_98_1393 | 431 |
| 555 | 3300046507 | Ga0495606_0133202 | Ga0495606_0133202_27_1322 | 431 |
| 556 | 3300046512 | Ga0495610_0003130 | Ga0495610_0003130_7292_8587 | 431 |
| 557 | 3300046512 | Ga0495610_0023015 | Ga0495610_0023015_1996_3291 | 431 |
| 558 | 3300046513 | Ga0495616_0000034 | Ga0495616_0000034_10798_12093 | 431 |
| 559 | 3300046513 | Ga0495616_0000705 | Ga0495616_0000705_20133_21428 | 431 |
| 560 | 3300046513 | Ga0495616_0001810 | Ga0495616_0001810_4655_5950 | 431 |
| 561 | 3300046513 | Ga0495616_0002630 | Ga0495616_0002630_28_1323 | 431 |
| 562 | 3300046513 | Ga0495616_0012678 | Ga0495616_0012678_3334_4677 | 431 |
| 563 | 3300046513 | Ga0495616_0078286 | Ga0495616_0078286_94_1389 | 431 |
| 564 | 3300046513 | Ga0495616_0092085 | Ga0495616_0092085_84_1379 | 431 |
| 565 | 3300046515 | Ga0495620_0014632 | Ga0495620_0014632_2077_3387 | 431 |
| 566 | 3300046518 | Ga0495631_0002821 | Ga0495631_0002821_1373_2668 | 431 |
| 567 | 3300046518 | Ga0495631_0009263 | Ga0495631_0009263_2720_4015 | 431 |
| 568 | 3300046518 | Ga0495631_0031476 | Ga0495631_0031476_978_2273 | 431 |
| 569 | 3300046519 | Ga0495632_0000018 | Ga0495632_0000018_84419_85714 | 431 |
| 570 | 3300046519 | Ga0495632_0000029 | Ga0495632_0000029_48968_50269 | 431 |
| 571 | 3300046519 | Ga0495632_0017149 | Ga0495632_0017149_214_1509 | 431 |
| 572 | 3300046519 | Ga0495632_0028528 | Ga0495632_0028528_564_1859 | 431 |
| 573 | 3300046520 | Ga0495637_0000051 | Ga0495637_0000051_58414_59709 | 431 |
| 574 | 3300046520 | Ga0495637_0016198 | Ga0495637_0016198_1113_2408 | 431 |
| 575 | 3300046522 | Ga0495643_0004446 | Ga0495643_0004446_5507_6802 | 431 |
| 576 | 3300046522 | Ga0495643_0033501 | Ga0495643_0033501_1378_2673 | 431 |
| 577 | 3300046522 | Ga0495643_0090982 | Ga0495643_0090982_99_1394 | 431 |
| 578 | 3300046523 | Ga0495644_0000478 | Ga0495644_0000478_11663_12958 | 431 |
| 579 | 3300046523 | Ga0495644_0000862 | Ga0495644_0000862_6995_8290 | 431 |
| 580 | 3300046524 | Ga0495648_0000027 | Ga0495648_0000027_63302_64597 | 431 |
| 581 | 3300046524 | Ga0495648_0000401 | Ga0495648_0000401_42092_43387 | 431 |
| 582 | 3300046525 | Ga0495663_0008229 | Ga0495663_0008229_605_1900 | 431 |
| 583 | 3300046528 | Ga0495642_0000349 | Ga0495642_0000349_15075_16370 | 431 |
| 584 | 3300046528 | Ga0495642_0009462 | Ga0495642_0009462_641_1942 | 431 |
| 585 | 3300046528 | Ga0495642_0021212 | Ga0495642_0021212_407_1717 | 431 |
| 586 | 3300046528 | Ga0495642_0051457 | Ga0495642_0051457_389_1684 | 431 |
| 587 | 3300046529 | Ga0495652_0001226 | Ga0495652_0001226_12467_13762 | 431 |
| 588 | 3300046530 | Ga0495654_0000011 | Ga0495654_0000011_102868_104163 | 431 |
| 589 | 3300046537 | Ga0495598_0021857 | Ga0495598_0021857_96_1397 | 431 |
| 590 | 3300046538 | Ga0495609_0000095 | Ga0495609_0000095_44611_45906 | 431 |
| 591 | 3300046538 | Ga0495609_0000180 | Ga0495609_0000180_24830_26125 | 431 |
| 592 | 3300046538 | Ga0495609_0000653 | Ga0495609_0000653_23363_24724 | 431 |
| 593 | 3300046538 | Ga0495609_0025937 | Ga0495609_0025937_233_1528 | 431 |
| 594 | 3300046542 | Ga0495597_0000073 | Ga0495597_0000073_29142_30437 | 431 |
| 595 | 3300046542 | Ga0495597_0000102 | Ga0495597_0000102_12831_14126 | 431 |
| 596 | 3300046542 | Ga0495597_0008250 | Ga0495597_0008250_101_1396 | 431 |
| 597 | 3300046543 | Ga0495645_0134659 | Ga0495645_0134659_177_1472 | 431 |
| 598 | 3300046543 | Ga0495645_0150077 | Ga0495645_0150077_12_1307 | 431 |
| 599 | 3300046557 | Ga0495622_0000001 | Ga0495622_0000001_355777_357072 | 431 |
| 600 | 3300046558 | Ga0495633_0000091 | Ga0495633_0000091_42456_43847 | 431 |
| 601 | 3300046558 | Ga0495633_0003288 | Ga0495633_0003288_14_1309 | 431 |
| 602 | 3300046558 | Ga0495633_0010266 | Ga0495633_0010266_437_1780 | 431 |
| 603 | 3300046558 | Ga0495633_0021080 | Ga0495633_0021080_904_2199 | 431 |
| 604 | 3300046558 | Ga0495633_0023181 | Ga0495633_0023181_171_1472 | 431 |
| 605 | 3300046558 | Ga0495633_0054745 | Ga0495633_0054745_432_1727 | 431 |
| 606 | 3300046615 | Ga0495656_0011500 | Ga0495656_0011500_699_1994 | 431 |
| 607 | 3300046616 | Ga0495668_0000077 | Ga0495668_0000077_97319_98614 | 431 |
| 608 | 3300046616 | Ga0495668_0031385 | Ga0495668_0031385_611_1906 | 431 |
| 609 | 3300046616 | Ga0495668_0087447 | Ga0495668_0087447_13_1308 | 431 |
| 610 | 3300046648 | Ga0495611_0002992 | Ga0495611_0002992_5351_6646 | 431 |
| 611 | 3300046648 | Ga0495611_0013349 | Ga0495611_0013349_887_2182 | 431 |
| 612 | 3300046648 | Ga0495611_0016737 | Ga0495611_0016737_99_1394 | 431 |
| 613 | 3300046660 | Ga0495625_0000631 | Ga0495625_0000631_26360_27655 | 431 |
| 614 | 3300046660 | Ga0495625_0016043 | Ga0495625_0016043_1536_2831 | 431 |
| 615 | 3300046660 | Ga0495625_0028909 | Ga0495625_0028909_83_1378 | 431 |
| 616 | 3300046660 | Ga0495625_0143185 | Ga0495625_0143185_83_1378 | 431 |
| 617 | 3300046664 | Ga0495659_0036098 | Ga0495659_0036098_159_1454 | 431 |
| 618 | 3300046665 | Ga0495661_0000012 | Ga0495661_0000012_216608_217903 | 431 |
| 619 | 3300046665 | Ga0495661_0001746 | Ga0495661_0001746_14490_15785 | 431 |
| 620 | 3300046665 | Ga0495661_0019019 | Ga0495661_0019019_811_2106 | 431 |
| 621 | 3300046665 | Ga0495661_0053449 | Ga0495661_0053449_399_1694 | 431 |
| 622 | 3300046665 | Ga0495661_0065632 | Ga0495661_0065632_60_1355 | 431 |
| 623 | 3300046674 | Ga0495588_0000099 | Ga0495588_0000099_92812_94107 | 431 |
| 624 | 3300046674 | Ga0495588_0000118 | Ga0495588_0000118_68070_69365 | 431 |
| 625 | 3300046674 | Ga0495588_0009889 | Ga0495588_0009889_711_2012 | 431 |
| 626 | 3300046680 | Ga0495646_0001427 | Ga0495646_0001427_9476_10771 | 431 |
| 627 | 3300046691 | Ga0495670_0000155 | Ga0495670_0000155_7835_9145 | 431 |
| 628 | 3300046691 | Ga0495670_0035838 | Ga0495670_0035838_84_1379 | 431 |
| 629 | 3300046692 | Ga0495671_0000594 | Ga0495671_0000594_20752_22053 | 431 |
| 630 | 3300046692 | Ga0495671_0069604 | Ga0495671_0069604_352_1647 | 431 |
| 631 | 3300046794 | Ga0495589_0000007 | Ga0495589_0000007_216248_217543 | 431 |
| 632 | 3300046794 | Ga0495589_0000082 | Ga0495589_0000082_16655_17950 | 431 |
| 633 | 3300046794 | Ga0495589_0000091 | Ga0495589_0000091_69431_70726 | 431 |
| 634 | 3300046794 | Ga0495589_0050394 | Ga0495589_0050394_716_2017 | 431 |
| 635 | 3300046810 | Ga0495660_0000024 | Ga0495660_0000024_36690_37985 | 431 |
| 636 | 3300046810 | Ga0495660_0000050 | Ga0495660_0000050_17505_18800 | 431 |
| 637 | 3300046810 | Ga0495660_0027636 | Ga0495660_0027636_1673_3034 | 431 |
| 638 | 3300046810 | Ga0495660_0031527 | Ga0495660_0031527_211_1512 | 431 |
| 639 | 3300046810 | Ga0495660_0092150 | Ga0495660_0092150_146_1456 | 431 |
| 640 | 3300047320 | Ga0495672_0000091 | Ga0495672_0000091_53145_54440 | 431 |
| 641 | 3300047320 | Ga0495672_0000222 | Ga0495672_0000222_60054_61349 | 431 |
| 642 | 3300047320 | Ga0495672_0013311 | Ga0495672_0013311_4329_5624 | 431 |
| 643 | 3300047323 | Ga0495683_0000308 | Ga0495683_0000308_20077_21420 | 431 |
| 644 | 3300047323 | Ga0495683_0051662 | Ga0495683_0051662_356_1666 | 431 |
| 645 | 3300047323 | Ga0495683_0060964 | Ga0495683_0060964_233_1528 | 431 |
| 646 | 3300047323 | Ga0495683_0067748 | Ga0495683_0067748_278_1573 | 431 |
| 647 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_804211_805518 | 431 |
| 648 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_342288_343583 | 431 |
| 649 | 3300047443 | Ga0495687_000016 | Ga0495687_000016_27204_28499 | 431 |
| 650 | 3300047443 | Ga0495687_000097 | Ga0495687_000097_104082_105377 | 431 |
| 651 | 3300047443 | Ga0495687_057798 | Ga0495687_057798_234_1529 | 431 |
| 652 | 3300047443 | Ga0495687_057804 | Ga0495687_057804_234_1529 | 431 |
| 653 | 3300047445 | Ga0495677_0000005 | Ga0495677_0000005_59124_60419 | 431 |
| 654 | 3300047445 | Ga0495677_0002148 | Ga0495677_0002148_130_1425 | 431 |
| 655 | 3300047445 | Ga0495677_0013348 | Ga0495677_0013348_1461_2756 | 431 |
| 656 | 3300047447 | Ga0495685_000447 | Ga0495685_000447_7351_8646 | 431 |
| 657 | 3300047470 | Ga0495681_0000016 | Ga0495681_0000016_90004_91299 | 431 |
| 658 | 3300047470 | Ga0495681_0007932 | Ga0495681_0007932_64_1374 | 431 |
| 659 | 3300047472 | Ga0495686_0008350 | Ga0495686_0008350_1206_2501 | 431 |
| 660 | 3300047472 | Ga0495686_0114997 | Ga0495686_0114997_42_1340 | 431 |
| 661 | 3300048088 | Ga0495602_0014236 | Ga0495602_0014236_4342_5637 | 431 |
| 662 | 3300048091 | Ga0495626_0000081 | Ga0495626_0000081_62826_64121 | 431 |
| 663 | 3300048091 | Ga0495626_0001744 | Ga0495626_0001744_14936_16231 | 431 |
| 664 | 3300048091 | Ga0495626_0003375 | Ga0495626_0003375_4472_5767 | 431 |
| 665 | 3300048091 | Ga0495626_0004562 | Ga0495626_0004562_6196_7491 | 431 |
| 666 | 3300048091 | Ga0495626_0034585 | Ga0495626_0034585_186_1481 | 431 |
| 667 | 3300048905 | Ga0496102_0201436 | Ga0496102_0201436_421_1716 | 431 |
| 668 | 3300048906 | Ga0496103_0026892 | Ga0496103_0026892_1474_2769 | 431 |
| 669 | 3300048908 | Ga0496105_0171219 | Ga0496105_0171219_368_1663 | 431 |
| 670 | 3300048909 | Ga0496106_0001179 | Ga0496106_0001179_9957_11252 | 431 |
| 671 | 3300048910 | Ga0496107_0141721 | Ga0496107_0141721_106_1443 | 431 |
| 672 | 3300048916 | Ga0496113_0017117 | Ga0496113_0017117_3398_4693 | 431 |
| 673 | 3300048916 | Ga0496113_0023277 | Ga0496113_0023277_417_1712 | 431 |
| 674 | 3300048916 | Ga0496113_0238502 | Ga0496113_0238502_87_1382 | 431 |
| 675 | 3300048917 | Ga0496114_0109096 | Ga0496114_0109096_16_1311 | 431 |
| 676 | 3300048917 | Ga0496114_0144274 | Ga0496114_0144274_288_1583 | 431 |
| 677 | 3300048925 | Ga0496122_0000509 | Ga0496122_0000509_18954_20249 | 431 |
| 678 | 3300048925 | Ga0496122_0010223 | Ga0496122_0010223_4029_5324 | 431 |
| 679 | 3300048925 | Ga0496122_0012279 | Ga0496122_0012279_187_1482 | 431 |
| 680 | 3300048926 | Ga0496123_0004540 | Ga0496123_0004540_3017_4312 | 431 |
| 681 | 3300048926 | Ga0496123_0024929 | Ga0496123_0024929_1986_3281 | 431 |
| 682 | 3300048927 | Ga0496124_0013135 | Ga0496124_0013135_4757_6052 | 431 |
| 683 | 3300048928 | Ga0496125_0003043 | Ga0496125_0003043_14086_15381 | 431 |
| 684 | 3300049459 | Ga0495678_000002 | Ga0495678_000002_243236_244531 | 431 |
| 685 | 3300049459 | Ga0495678_000060 | Ga0495678_000060_139043_140344 | 431 |
| 686 | 3300049459 | Ga0495678_001312 | Ga0495678_001312_2487_3788 | 431 |
| 687 | 3300049460 | Ga0495682_0000035 | Ga0495682_0000035_37445_38746 | 431 |
| 688 | 3300049460 | Ga0495682_0000041 | Ga0495682_0000041_95894_97189 | 431 |
| 689 | 3300049460 | Ga0495682_0007543 | Ga0495682_0007543_422_1717 | 431 |
| 690 | 3300049460 | Ga0495682_0019415 | Ga0495682_0019415_696_1991 | 431 |
| 691 | 3300049460 | Ga0495682_0054819 | Ga0495682_0054819_69_1364 | 431 |
| 692 | 3300049766 | Ga0501269_000021 | Ga0501269_000021_25589_26884 | 431 |
| 693 | 3300049823 | Ga0501044_0062689 | Ga0501044_0062689_14_1309 | 431 |
| 694 | 3300050496 | nmdc:mga07m45_1152_c1 | nmdc:mga07m45_1152_c1_10328_11626 | 431 |
| 695 | 3300050508 | nmdc:mga09592_153689_c1 | nmdc:mga09592_153689_c1_435_1736 | 431 |
| 696 | 3300050511 | nmdc:mga08y16_262434_c1 | nmdc:mga08y16_262434_c1_234_1535 | 431 |
| 697 | 3300053125 | Ga0500618_000052 | Ga0500618_000052_79058_80353 | 431 |
| 698 | 3300053125 | Ga0500618_000149 | Ga0500618_000149_52312_53607 | 431 |
| 699 | 3300061719 | Ga0466962_0011993 | Ga0466962_0011993_1933_3228 | 431 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iud-assembly1.cif.gz_C | cu2+-bound form of pseudomonas stutzeri l-rhamnose isomerase | 0.9468 | 2 | 423 |
| 3itt-assembly1.cif.gz_C | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329k in complex with l-rhamnose | 0.9447 | 4 | 423 |
| 3m0y-assembly1.cif.gz_D | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose | 0.9442 | 2 | 421 |
| 3m0y-assembly1.cif.gz_D | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose | 0.942 | 2 | 421 |
| 4gjj-assembly1.cif.gz_B | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose | 0.9397 | 4 | 424 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m0vD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9301 | 2 | 431 | 3.20.20.150 |
| 3m0vD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.928 | 2 | 431 | 3.20.20.150 |
| 3ktcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8318 | 49 | 385 | 3.20.20.150 |
| 3ktcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8105 | 49 | 385 | 3.20.20.150 |
| 3uvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7717 | 24 | 419 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1K3D3-F1-model_v4 | Sugar isomerase | 0.9637 | 1 | 174 |
GO:0016853
|
| AF-A0A3S1VD68-F1-model_v4 | deleted | 0.9632 | 1 | 125 |
|
| AF-A0A3D0Q3Y4-F1-model_v4 | Sugar isomerase | 0.9607 | 1 | 193 |
GO:0016853
|
| AF-A0A529HK39-F1-model_v4 | deleted | 0.9606 | 73 | 224 |
|
| AF-A0A3S1SYS7-F1-model_v4 | Sugar isomerase | 0.9594 | 1 | 204 |
GO:0016853
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar