F475988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 309 | 696 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300049705|Ga0501225_0048116|Ga0501225_0048116_255_1049 |
| Length | 264 |
| Sequence | MRCATLAFDIEGKCGTPGKFTSTFKSFHIMDRRKSLKTIAVGALSAGMLLDACKTDDKKKGDAKAAEPGAQLTLDRAEEEKLREKELLSTKFFTDHEMATITVLADIIIPRDDVSGSASDAKVPDFIEFMVKDRPENQIPMRGGLRWLDIQSLKRFEKSFVDCDAKQRLNIVDDIAYPEITYKDEKGNKVTKGKKPNPELAQGVAFFNLMRDLTASGFYTSEIGVKDIAYAGNTPNKWNGVPDDVLKQYGLAYSEREMKECAKY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 200 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 201 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 267 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 268 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 269 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 272 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 273 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 274 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 276 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 283 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 284 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 296 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 298 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 299 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 300 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 304 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 305 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 306 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 307 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 0.72 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.44 |
| Nodule | 0 |
| Rhizoplane | 1 |
| Rhizosphere | 90.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1009994 | 3300001904 | Bacteria | 1556 |
| 2 | JGI24736J21556_1017643 | 3300001904 | Unclassified | 1132 |
| 3 | JGI24740J21852_10016158 | 3300001979 | Bacteria | 2704 |
| 4 | JGI24737J22298_10010438 | 3300001990 | Bacteria | 3065 |
| 5 | JGI24751J29686_10002883 | 3300002459 | Bacteria | 3467 |
| 6 | rootH1_10018315 | 3300003316 | Bacteria | 2490 |
| 7 | rootH1_10026206 | 3300003316 | Bacteria | 9776 |
| 8 | rootH2_10005336 | 3300003320 | Bacteria | 90063 |
| 9 | rootH2_10013162 | 3300003320 | Bacteria | 43068 |
| 10 | rootH2_10019937 | 3300003320 | Bacteria | 1694 |
| 11 | rootH2_10150472 | 3300003320 | Bacteria | 1255 |
| 12 | rootH2_10181826 | 3300003320 | Bacteria | 1529 |
| 13 | rootL2_10057324 | 3300003322 | Unclassified | 2606 |
| 14 | rootL2_10075832 | 3300003322 | Bacteria | 2374 |
| 15 | rootL2_10153257 | 3300003322 | Bacteria | 1750 |
| 16 | rootL2_10173807 | 3300003322 | Bacteria | 2103 |
| 17 | rootL2_10251069 | 3300003322 | Bacteria | 1484 |
| 18 | rootL2_10363313 | 3300003322 | Bacteria | 1126 |
| 19 | rootH1_10015461 | 3300003323 | Bacteria | 18908 |
| 20 | rootH1_10176585 | 3300003323 | Bacteria | 4704 |
| 21 | rootH1_10197827 | 3300003323 | Bacteria | 1632 |
| 22 | Ga0058863_10172141 | 3300004799 | Bacteria | 4307 |
| 23 | Ga0058861_11885956 | 3300004800 | Bacteria | 3753 |
| 24 | Ga0058862_12637711 | 3300004803 | Bacteria | 3965 |
| 25 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 26 | Ga0070658_10000363 | 3300005327 | Bacteria | 39460 |
| 27 | Ga0070658_10032568 | 3300005327 | Bacteria | 4191 |
| 28 | Ga0070658_10039535 | 3300005327 | Bacteria | 3805 |
| 29 | Ga0070658_10057120 | 3300005327 | Bacteria | 3174 |
| 30 | Ga0070658_10063054 | 3300005327 | Bacteria | 3021 |
| 31 | Ga0070658_10341556 | 3300005327 | Bacteria | 1281 |
| 32 | Ga0070676_10000103 | 3300005328 | Bacteria | 30434 |
| 33 | Ga0070676_10013430 | 3300005328 | Bacteria | 4489 |
| 34 | Ga0070676_10167743 | 3300005328 | Bacteria | 1418 |
| 35 | Ga0070683_100053211 | 3300005329 | Bacteria | 3751 |
| 36 | Ga0070683_100060211 | 3300005329 | Bacteria | 3528 |
| 37 | Ga0070690_100061461 | 3300005330 | Unclassified | 2420 |
| 38 | Ga0070690_100516950 | 3300005330 | Bacteria | 895 |
| 39 | Ga0070670_100040709 | 3300005331 | Bacteria | 3994 |
| 40 | Ga0070670_100073976 | 3300005331 | Bacteria | 2926 |
| 41 | Ga0070677_10063330 | 3300005333 | Unclassified | 1533 |
| 42 | Ga0068869_100065844 | 3300005334 | Bacteria | 2668 |
| 43 | Ga0068869_100107275 | 3300005334 | Bacteria | 2120 |
| 44 | Ga0068869_100183454 | 3300005334 | Unclassified | 1642 |
| 45 | Ga0068869_100557115 | 3300005334 | Bacteria | 964 |
| 46 | Ga0070666_10009574 | 3300005335 | Bacteria | 6046 |
| 47 | Ga0070666_10031556 | 3300005335 | Bacteria | 3497 |
| 48 | Ga0070666_10563175 | 3300005335 | Unclassified | 829 |
| 49 | Ga0070680_100002416 | 3300005336 | Bacteria | 13834 |
| 50 | Ga0070680_100005626 | 3300005336 | Bacteria | 9493 |
| 51 | Ga0070680_100055462 | 3300005336 | Unclassified | 3238 |
| 52 | Ga0070680_100190324 | 3300005336 | Bacteria | 1729 |
| 53 | Ga0070680_100214903 | 3300005336 | Bacteria | 1622 |
| 54 | Ga0070680_100274768 | 3300005336 | Unclassified | 1427 |
| 55 | Ga0070682_100001222 | 3300005337 | Bacteria | 14625 |
| 56 | Ga0070682_100016869 | 3300005337 | Bacteria | 4251 |
| 57 | Ga0068868_100000358 | 3300005338 | Bacteria | 30970 |
| 58 | Ga0068868_100059709 | 3300005338 | Bacteria | 3017 |
| 59 | Ga0068868_100092748 | 3300005338 | Bacteria | 2434 |
| 60 | Ga0070660_100001037 | 3300005339 | Bacteria | 18678 |
| 61 | Ga0070660_100023582 | 3300005339 | Bacteria | 4559 |
| 62 | Ga0070660_100871196 | 3300005339 | Bacteria | 759 |
| 63 | Ga0070689_100654252 | 3300005340 | Bacteria | 914 |
| 64 | Ga0070691_10026361 | 3300005341 | Unclassified | 2709 |
| 65 | Ga0070687_100005535 | 3300005343 | Bacteria | 5121 |
| 66 | Ga0070661_100057865 | 3300005344 | Bacteria | 2840 |
| 67 | Ga0070661_100096260 | 3300005344 | Bacteria | 2196 |
| 68 | Ga0070668_100000308 | 3300005347 | Bacteria | 32201 |
| 69 | Ga0070668_100022823 | 3300005347 | Bacteria | 4730 |
| 70 | Ga0070668_100697232 | 3300005347 | Bacteria | 895 |
| 71 | Ga0070669_100126552 | 3300005353 | Bacteria | 1955 |
| 72 | Ga0070675_100015362 | 3300005354 | Bacteria | 6051 |
| 73 | Ga0070675_100081326 | 3300005354 | Bacteria | 2701 |
| 74 | Ga0070675_100409833 | 3300005354 | Bacteria | 1210 |
| 75 | Ga0070671_100031152 | 3300005355 | Bacteria | 4405 |
| 76 | Ga0070671_100087379 | 3300005355 | Unclassified | 2609 |
| 77 | Ga0070671_100255037 | 3300005355 | Bacteria | 1490 |
| 78 | Ga0070674_100048082 | 3300005356 | Bacteria | 2926 |
| 79 | Ga0070674_100322107 | 3300005356 | Bacteria | 1239 |
| 80 | Ga0070673_100000232 | 3300005364 | Bacteria | 27904 |
| 81 | Ga0070673_100051840 | 3300005364 | Bacteria | 3216 |
| 82 | Ga0070673_100330898 | 3300005364 | Bacteria | 1348 |
| 83 | Ga0070659_100012341 | 3300005366 | Bacteria | 6332 |
| 84 | Ga0070659_100060941 | 3300005366 | Bacteria | 2981 |
| 85 | Ga0070667_100000583 | 3300005367 | Bacteria | 36093 |
| 86 | Ga0070667_100071055 | 3300005367 | Unclassified | 2964 |
| 87 | Ga0070667_100164843 | 3300005367 | Bacteria | 1954 |
| 88 | Ga0070667_100223154 | 3300005367 | Bacteria | 1678 |
| 89 | Ga0070701_10081726 | 3300005438 | Bacteria | 1751 |
| 90 | Ga0070663_100088748 | 3300005455 | Bacteria | 2287 |
| 91 | Ga0070663_100296502 | 3300005455 | Bacteria | 1293 |
| 92 | Ga0070678_100010907 | 3300005456 | Bacteria | 5576 |
| 93 | Ga0070678_100061345 | 3300005456 | Bacteria | 2771 |
| 94 | Ga0070678_100094174 | 3300005456 | Unclassified | 2305 |
| 95 | Ga0070678_100170806 | 3300005456 | Bacteria | 1771 |
| 96 | Ga0070678_100250511 | 3300005456 | Bacteria | 1485 |
| 97 | Ga0070662_100000014 | 3300005457 | Bacteria | 110124 |
| 98 | Ga0070662_100002472 | 3300005457 | Bacteria | 11382 |
| 99 | Ga0070662_100003765 | 3300005457 | Bacteria | 9490 |
| 100 | Ga0070662_100140633 | 3300005457 | Unclassified | 1870 |
| 101 | Ga0070681_10014298 | 3300005458 | Bacteria | 7896 |
| 102 | Ga0070681_10220791 | 3300005458 | Unclassified | 1810 |
| 103 | Ga0070681_10498956 | 3300005458 | Bacteria | 1130 |
| 104 | Ga0068867_100047251 | 3300005459 | Unclassified | 3164 |
| 105 | Ga0070698_100027024 | 3300005471 | Bacteria | 5968 |
| 106 | Ga0070698_100157563 | 3300005471 | Bacteria | 2216 |
| 107 | Ga0070679_100006085 | 3300005530 | Bacteria | 11225 |
| 108 | Ga0070679_100015932 | 3300005530 | Bacteria | 7237 |
| 109 | Ga0070679_100056944 | 3300005530 | Bacteria | 3895 |
| 110 | Ga0070679_100192443 | 3300005530 | Bacteria | 2008 |
| 111 | Ga0070679_100249780 | 3300005530 | Bacteria | 1730 |
| 112 | Ga0070679_100301102 | 3300005530 | Bacteria | 1554 |
| 113 | Ga0070684_100000251 | 3300005535 | Bacteria | 37139 |
| 114 | Ga0070684_100056185 | 3300005535 | Bacteria | 3434 |
| 115 | Ga0068853_100015341 | 3300005539 | Bacteria | 6296 |
| 116 | Ga0068853_100028870 | 3300005539 | Bacteria | 4670 |
| 117 | Ga0068853_100053211 | 3300005539 | Bacteria | 3486 |
| 118 | Ga0068853_100225022 | 3300005539 | Bacteria | 1715 |
| 119 | Ga0068853_100597890 | 3300005539 | Unclassified | 1047 |
| 120 | Ga0068853_101089999 | 3300005539 | Bacteria | 770 |
| 121 | Ga0070672_100000345 | 3300005543 | Bacteria | 26753 |
| 122 | Ga0070672_100237554 | 3300005543 | Unclassified | 1532 |
| 123 | Ga0070686_100144738 | 3300005544 | Bacteria | 1658 |
| 124 | Ga0070693_100002663 | 3300005547 | Bacteria | 8220 |
| 125 | Ga0070693_100352257 | 3300005547 | Bacteria | 1008 |
| 126 | Ga0070665_100000032 | 3300005548 | Bacteria | 333352 |
| 127 | Ga0070665_100004255 | 3300005548 | Bacteria | 15056 |
| 128 | Ga0070665_100008316 | 3300005548 | Bacteria | 10494 |
| 129 | Ga0070665_100515444 | 3300005548 | Bacteria | 1207 |
| 130 | Ga0070665_100889998 | 3300005548 | Unclassified | 903 |
| 131 | Ga0068855_100000631 | 3300005563 | Bacteria | 43172 |
| 132 | Ga0068855_100004470 | 3300005563 | Bacteria | 17094 |
| 133 | Ga0068855_100015513 | 3300005563 | Bacteria | 9172 |
| 134 | Ga0068855_100046876 | 3300005563 | Bacteria | 5108 |
| 135 | Ga0068855_100156908 | 3300005563 | Bacteria | 2585 |
| 136 | Ga0068855_100196353 | 3300005563 | Bacteria | 2273 |
| 137 | Ga0068855_100404665 | 3300005563 | Bacteria | 1495 |
| 138 | Ga0068855_100413422 | 3300005563 | Bacteria | 1476 |
| 139 | Ga0068855_100713693 | 3300005563 | Bacteria | 1072 |
| 140 | Ga0070664_100123343 | 3300005564 | Bacteria | 2270 |
| 141 | Ga0070664_100440844 | 3300005564 | Unclassified | 1195 |
| 142 | Ga0068857_100018099 | 3300005577 | Bacteria | 6180 |
| 143 | Ga0068857_100057738 | 3300005577 | Bacteria | 3445 |
| 144 | Ga0068857_100114700 | 3300005577 | Bacteria | 2423 |
| 145 | Ga0068854_100209079 | 3300005578 | Bacteria | 1538 |
| 146 | Ga0068856_100037746 | 3300005614 | Bacteria | 4740 |
| 147 | Ga0068856_100058387 | 3300005614 | Bacteria | 3810 |
| 148 | Ga0068856_100126917 | 3300005614 | Bacteria | 2554 |
| 149 | Ga0068856_100277262 | 3300005614 | Bacteria | 1693 |
| 150 | Ga0068856_100292618 | 3300005614 | Bacteria | 1645 |
| 151 | Ga0068852_100007007 | 3300005616 | Bacteria | 8206 |
| 152 | Ga0068852_100099983 | 3300005616 | Bacteria | 2616 |
| 153 | Ga0068852_100458321 | 3300005616 | Bacteria | 1263 |
| 154 | Ga0068852_100659415 | 3300005616 | Bacteria | 1054 |
| 155 | Ga0068852_101156020 | 3300005616 | Unclassified | 795 |
| 156 | Ga0068859_100223243 | 3300005617 | Bacteria | 1972 |
| 157 | Ga0068864_100004460 | 3300005618 | Bacteria | 11503 |
| 158 | Ga0068864_100008678 | 3300005618 | Bacteria | 8387 |
| 159 | Ga0068864_100112719 | 3300005618 | Bacteria | 2424 |
| 160 | Ga0068864_100436712 | 3300005618 | Bacteria | 1250 |
| 161 | Ga0068866_10014051 | 3300005718 | Bacteria | 3526 |
| 162 | Ga0068866_10068426 | 3300005718 | Bacteria | 1867 |
| 163 | Ga0068861_100044777 | 3300005719 | Bacteria | 3329 |
| 164 | Ga0068861_100596444 | 3300005719 | Unclassified | 1013 |
| 165 | Ga0068851_10010581 | 3300005834 | Bacteria | 4308 |
| 166 | Ga0068851_10044146 | 3300005834 | Bacteria | 2249 |
| 167 | Ga0068851_10092301 | 3300005834 | Bacteria | 1595 |
| 168 | Ga0068870_10019937 | 3300005840 | Bacteria | 3258 |
| 169 | Ga0068870_10369972 | 3300005840 | Unclassified | 925 |
| 170 | Ga0068863_100001439 | 3300005841 | Bacteria | 23604 |
| 171 | Ga0068863_100105839 | 3300005841 | Bacteria | 2676 |
| 172 | Ga0068858_100005079 | 3300005842 | Bacteria | 12897 |
| 173 | Ga0068858_100486660 | 3300005842 | Bacteria | 1191 |
| 174 | Ga0068858_100744799 | 3300005842 | Unclassified | 954 |
| 175 | Ga0068860_100000662 | 3300005843 | Bacteria | 39938 |
| 176 | Ga0068860_100060978 | 3300005843 | Bacteria | 3584 |
| 177 | Ga0068860_100588533 | 3300005843 | Bacteria | 1117 |
| 178 | Ga0068862_100097194 | 3300005844 | Bacteria | 2571 |
| 179 | Ga0081539_10001220 | 3300005985 | Bacteria | 45919 |
| 180 | Ga0081539_10018402 | 3300005985 | Unclassified | 4850 |
| 181 | Ga0075366_10070576 | 3300006195 | Bacteria | 2081 |
| 182 | Ga0075366_10319867 | 3300006195 | Bacteria | 950 |
| 183 | Ga0097621_100000460 | 3300006237 | Bacteria | 28549 |
| 184 | Ga0097621_100002379 | 3300006237 | Bacteria | 12896 |
| 185 | Ga0068871_100000251 | 3300006358 | Bacteria | 37472 |
| 186 | Ga0068871_100020152 | 3300006358 | Bacteria | 5103 |
| 187 | Ga0068871_100028768 | 3300006358 | Bacteria | 4360 |
| 188 | Ga0068871_100101575 | 3300006358 | Bacteria | 2410 |
| 189 | Ga0068871_100242241 | 3300006358 | Bacteria | 1568 |
| 190 | Ga0075428_100014091 | 3300006844 | Bacteria | 8894 |
| 191 | Ga0075428_100030606 | 3300006844 | Bacteria | 5951 |
| 192 | Ga0075428_100542658 | 3300006844 | Bacteria | 1243 |
| 193 | Ga0075430_100143546 | 3300006846 | Bacteria | 1988 |
| 194 | Ga0075434_100064367 | 3300006871 | Bacteria | 3651 |
| 195 | Ga0075429_100002894 | 3300006880 | Bacteria | 14550 |
| 196 | Ga0075436_100113601 | 3300006914 | Bacteria | 1891 |
| 197 | Ga0097620_100223244 | 3300006931 | Bacteria | 1972 |
| 198 | Ga0105240_10018228 | 3300009093 | Bacteria | 9436 |
| 199 | Ga0105240_10018900 | 3300009093 | Bacteria | 9228 |
| 200 | Ga0105240_10098438 | 3300009093 | Bacteria | 3562 |
| 201 | Ga0105240_10116878 | 3300009093 | Bacteria | 3217 |
| 202 | Ga0105240_10297840 | 3300009093 | Bacteria | 1846 |
| 203 | Ga0105240_10629514 | 3300009093 | Bacteria | 1178 |
| 204 | Ga0111539_10001678 | 3300009094 | Bacteria | 29521 |
| 205 | Ga0111539_10006564 | 3300009094 | Bacteria | 14990 |
| 206 | Ga0111539_10193845 | 3300009094 | Bacteria | 2370 |
| 207 | Ga0105245_10315943 | 3300009098 | Unclassified | 1537 |
| 208 | Ga0105247_10024632 | 3300009101 | Bacteria | 3627 |
| 209 | Ga0114129_10005512 | 3300009147 | Bacteria | 17896 |
| 210 | Ga0114129_10729842 | 3300009147 | Bacteria | 1270 |
| 211 | Ga0105241_10003487 | 3300009174 | Bacteria | 11699 |
| 212 | Ga0105241_10015592 | 3300009174 | Bacteria | 5569 |
| 213 | Ga0105241_10107885 | 3300009174 | Bacteria | 2225 |
| 214 | Ga0105241_10152420 | 3300009174 | Unclassified | 1892 |
| 215 | Ga0105242_10014893 | 3300009176 | Bacteria | 6026 |
| 216 | Ga0105242_10369030 | 3300009176 | Bacteria | 1331 |
| 217 | Ga0105248_10026803 | 3300009177 | Bacteria | 6410 |
| 218 | Ga0105248_10274774 | 3300009177 | Bacteria | 1897 |
| 219 | Ga0105248_11103629 | 3300009177 | Bacteria | 897 |
| 220 | Ga0105248_11402990 | 3300009177 | Bacteria | 790 |
| 221 | Ga0105237_10000261 | 3300009545 | Bacteria | 74745 |
| 222 | Ga0105237_10009517 | 3300009545 | Bacteria | 10405 |
| 223 | Ga0105237_10138759 | 3300009545 | Unclassified | 2426 |
| 224 | Ga0105237_10566965 | 3300009545 | Bacteria | 1142 |
| 225 | Ga0105237_10883440 | 3300009545 | Unclassified | 901 |
| 226 | Ga0105238_10013714 | 3300009551 | Bacteria | 8187 |
| 227 | Ga0105238_10922743 | 3300009551 | Bacteria | 892 |
| 228 | Ga0105249_10000682 | 3300009553 | Bacteria | 30897 |
| 229 | Ga0105249_10002393 | 3300009553 | Bacteria | 16288 |
| 230 | Ga0105249_10014917 | 3300009553 | Bacteria | 6874 |
| 231 | Ga0105249_10170008 | 3300009553 | Bacteria | 2113 |
| 232 | Ga0105249_10384826 | 3300009553 | Unclassified | 1430 |
| 233 | Ga0105239_10008049 | 3300010375 | Bacteria | 12033 |
| 234 | Ga0105239_10014100 | 3300010375 | Bacteria | 8872 |
| 235 | Ga0105239_10093479 | 3300010375 | Bacteria | 3320 |
| 236 | Ga0105246_10031485 | 3300011119 | Bacteria | 3511 |
| 237 | Ga0105246_10062759 | 3300011119 | Bacteria | 2589 |
| 238 | Ga0105246_10180273 | 3300011119 | Bacteria | 1626 |
| 239 | Ga0157373_10000978 | 3300013100 | Bacteria | 22107 |
| 240 | Ga0157373_10004999 | 3300013100 | Bacteria | 9961 |
| 241 | Ga0157373_10015926 | 3300013100 | Bacteria | 5490 |
| 242 | Ga0157371_10001061 | 3300013102 | Bacteria | 30053 |
| 243 | Ga0157371_10001864 | 3300013102 | Bacteria | 21109 |
| 244 | Ga0157371_10007347 | 3300013102 | Bacteria | 8932 |
| 245 | Ga0157371_10015667 | 3300013102 | Bacteria | 5678 |
| 246 | Ga0157371_10028919 | 3300013102 | Bacteria | 4013 |
| 247 | Ga0157371_10098809 | 3300013102 | Bacteria | 2070 |
| 248 | Ga0157371_10649051 | 3300013102 | Bacteria | 787 |
| 249 | Ga0157370_10000405 | 3300013104 | Bacteria | 54383 |
| 250 | Ga0157370_10033633 | 3300013104 | Unclassified | 4998 |
| 251 | Ga0157370_10061449 | 3300013104 | Bacteria | 3566 |
| 252 | Ga0157370_10073871 | 3300013104 | Bacteria | 3217 |
| 253 | Ga0157370_10099357 | 3300013104 | Bacteria | 2728 |
| 254 | Ga0157370_10138332 | 3300013104 | Bacteria | 2269 |
| 255 | Ga0157370_10213393 | 3300013104 | Bacteria | 1789 |
| 256 | Ga0157370_10239682 | 3300013104 | Bacteria | 1678 |
| 257 | Ga0157370_10333429 | 3300013104 | Bacteria | 1398 |
| 258 | Ga0157369_10052946 | 3300013105 | Unclassified | 4389 |
| 259 | Ga0157369_10056016 | 3300013105 | Bacteria | 4254 |
| 260 | Ga0157369_10180026 | 3300013105 | Bacteria | 2224 |
| 261 | Ga0157369_10461817 | 3300013105 | Bacteria | 1315 |
| 262 | Ga0157369_11220519 | 3300013105 | Unclassified | 767 |
| 263 | Ga0157374_10000365 | 3300013296 | Bacteria | 41708 |
| 264 | Ga0157374_10000484 | 3300013296 | Bacteria | 36020 |
| 265 | Ga0157374_10008038 | 3300013296 | Bacteria | 9017 |
| 266 | Ga0157374_10064307 | 3300013296 | Bacteria | 3442 |
| 267 | Ga0157374_10089978 | 3300013296 | Bacteria | 2925 |
| 268 | Ga0157374_10171333 | 3300013296 | Bacteria | 2117 |
| 269 | Ga0157378_10005392 | 3300013297 | Bacteria | 11214 |
| 270 | Ga0157378_10009000 | 3300013297 | Bacteria | 8693 |
| 271 | Ga0157378_10012007 | 3300013297 | Bacteria | 7583 |
| 272 | Ga0157378_10017995 | 3300013297 | Bacteria | 6203 |
| 273 | Ga0157378_10031792 | 3300013297 | Bacteria | 4661 |
| 274 | Ga0157378_10040863 | 3300013297 | Bacteria | 4114 |
| 275 | Ga0157378_10065592 | 3300013297 | Bacteria | 3250 |
| 276 | Ga0157378_11404986 | 3300013297 | Bacteria | 741 |
| 277 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 278 | Ga0163162_10000484 | 3300013306 | Bacteria | 36942 |
| 279 | Ga0163162_10000628 | 3300013306 | Bacteria | 32760 |
| 280 | Ga0163162_10007383 | 3300013306 | Bacteria | 10689 |
| 281 | Ga0163162_10042174 | 3300013306 | Unclassified | 4566 |
| 282 | Ga0163162_10318361 | 3300013306 | Bacteria | 1688 |
| 283 | Ga0163162_10356335 | 3300013306 | Bacteria | 1596 |
| 284 | Ga0163162_10895910 | 3300013306 | Bacteria | 1000 |
| 285 | Ga0163162_10953408 | 3300013306 | Bacteria | 969 |
| 286 | Ga0157372_10000182 | 3300013307 | Bacteria | 69439 |
| 287 | Ga0157372_10016543 | 3300013307 | Bacteria | 7914 |
| 288 | Ga0157372_10031424 | 3300013307 | Bacteria | 5814 |
| 289 | Ga0157372_10051844 | 3300013307 | Unclassified | 4567 |
| 290 | Ga0157372_10059895 | 3300013307 | Bacteria | 4260 |
| 291 | Ga0157372_10084335 | 3300013307 | Bacteria | 3601 |
| 292 | Ga0157372_10100508 | 3300013307 | Bacteria | 3300 |
| 293 | Ga0157372_10139667 | 3300013307 | Bacteria | 2790 |
| 294 | Ga0157372_10157503 | 3300013307 | Bacteria | 2624 |
| 295 | Ga0157372_10178779 | 3300013307 | Unclassified | 2456 |
| 296 | Ga0157372_10193797 | 3300013307 | Bacteria | 2354 |
| 297 | Ga0157372_10254704 | 3300013307 | Bacteria | 2038 |
| 298 | Ga0157372_10415907 | 3300013307 | Unclassified | 1567 |
| 299 | Ga0157372_10654659 | 3300013307 | Bacteria | 1223 |
| 300 | Ga0157375_10000619 | 3300013308 | Bacteria | 31534 |
| 301 | Ga0157375_10002043 | 3300013308 | Bacteria | 17408 |
| 302 | Ga0157375_10004383 | 3300013308 | Bacteria | 12257 |
| 303 | Ga0157375_10034881 | 3300013308 | Bacteria | 4796 |
| 304 | Ga0157375_11366032 | 3300013308 | Bacteria | 834 |
| 305 | Ga0163163_10000499 | 3300014325 | Bacteria | 35349 |
| 306 | Ga0163163_10037722 | 3300014325 | Bacteria | 4703 |
| 307 | Ga0163163_10348328 | 3300014325 | Bacteria | 1537 |
| 308 | Ga0163163_10539952 | 3300014325 | Bacteria | 1228 |
| 309 | Ga0157380_10004725 | 3300014326 | Bacteria | 9480 |
| 310 | Ga0157380_10097921 | 3300014326 | Bacteria | 2435 |
| 311 | Ga0157380_10164705 | 3300014326 | Unclassified | 1931 |
| 312 | Ga0157377_10411294 | 3300014745 | Bacteria | 924 |
| 313 | Ga0157379_10002615 | 3300014968 | Bacteria | 15134 |
| 314 | Ga0157379_10038676 | 3300014968 | Unclassified | 4256 |
| 315 | Ga0157379_10100040 | 3300014968 | Unclassified | 2603 |
| 316 | Ga0157376_10000637 | 3300014969 | Bacteria | 22720 |
| 317 | Ga0157376_10000798 | 3300014969 | Bacteria | 20658 |
| 318 | Ga0157376_10316897 | 3300014969 | Bacteria | 1481 |
| 319 | Ga0163161_10000230 | 3300017792 | Bacteria | 51536 |
| 320 | Ga0163161_10004178 | 3300017792 | Bacteria | 10086 |
| 321 | Ga0163161_10097798 | 3300017792 | Unclassified | 2180 |
| 322 | Ga0206351_10160225 | 3300020077 | Bacteria | 932 |
| 323 | Ga0213872_10101251 | 3300021361 | Bacteria | 1284 |
| 324 | Ga0213876_10186190 | 3300021384 | Bacteria | 1104 |
| 325 | Ga0209646_1000837 | 3300025246 | Bacteria | 10362 |
| 326 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 327 | Ga0207697_10086330 | 3300025315 | Bacteria | 1326 |
| 328 | Ga0207697_10183104 | 3300025315 | Bacteria | 918 |
| 329 | Ga0207682_10243175 | 3300025893 | Bacteria | 837 |
| 330 | Ga0207642_10047437 | 3300025899 | Bacteria | 1920 |
| 331 | Ga0207642_10218472 | 3300025899 | Unclassified | 1064 |
| 332 | Ga0207710_10002155 | 3300025900 | Bacteria | 9259 |
| 333 | Ga0207688_10021329 | 3300025901 | Unclassified | 3538 |
| 334 | Ga0207688_10033949 | 3300025901 | Bacteria | 2823 |
| 335 | Ga0207688_10409916 | 3300025901 | Bacteria | 841 |
| 336 | Ga0207680_10011113 | 3300025903 | Bacteria | 4535 |
| 337 | Ga0207680_10080441 | 3300025903 | Bacteria | 2046 |
| 338 | Ga0207680_10575727 | 3300025903 | Bacteria | 805 |
| 339 | Ga0207647_10000045 | 3300025904 | Bacteria | 90413 |
| 340 | Ga0207647_10031534 | 3300025904 | Bacteria | 3410 |
| 341 | Ga0207647_10068299 | 3300025904 | Bacteria | 2152 |
| 342 | Ga0207647_10102849 | 3300025904 | Bacteria | 1694 |
| 343 | Ga0207647_10210896 | 3300025904 | Unclassified | 1122 |
| 344 | Ga0207645_10001476 | 3300025907 | Bacteria | 19223 |
| 345 | Ga0207645_10003649 | 3300025907 | Bacteria | 11612 |
| 346 | Ga0207645_10032044 | 3300025907 | Bacteria | 3380 |
| 347 | Ga0207643_10036158 | 3300025908 | Bacteria | 2769 |
| 348 | Ga0207705_10000107 | 3300025909 | Bacteria | 94984 |
| 349 | Ga0207705_10006001 | 3300025909 | Bacteria | 9039 |
| 350 | Ga0207705_10007688 | 3300025909 | Bacteria | 7925 |
| 351 | Ga0207705_10026729 | 3300025909 | Bacteria | 4114 |
| 352 | Ga0207705_10031050 | 3300025909 | Bacteria | 3812 |
| 353 | Ga0207705_10123331 | 3300025909 | Unclassified | 1924 |
| 354 | Ga0207705_10295049 | 3300025909 | Bacteria | 1242 |
| 355 | Ga0207705_10626479 | 3300025909 | Bacteria | 836 |
| 356 | Ga0207654_10001573 | 3300025911 | Bacteria | 11985 |
| 357 | Ga0207654_10038862 | 3300025911 | Bacteria | 2673 |
| 358 | Ga0207654_10172542 | 3300025911 | Unclassified | 1405 |
| 359 | Ga0207707_10001470 | 3300025912 | Bacteria | 21804 |
| 360 | Ga0207707_10178394 | 3300025912 | Bacteria | 1855 |
| 361 | Ga0207695_10009594 | 3300025913 | Bacteria | 11954 |
| 362 | Ga0207695_10021017 | 3300025913 | Bacteria | 7455 |
| 363 | Ga0207695_10031739 | 3300025913 | Bacteria | 5789 |
| 364 | Ga0207695_10115674 | 3300025913 | Bacteria | 2656 |
| 365 | Ga0207695_10436891 | 3300025913 | Bacteria | 1192 |
| 366 | Ga0207695_10486805 | 3300025913 | Bacteria | 1116 |
| 367 | Ga0207671_10003003 | 3300025914 | Bacteria | 17298 |
| 368 | Ga0207671_10010262 | 3300025914 | Bacteria | 7747 |
| 369 | Ga0207671_10263316 | 3300025914 | Unclassified | 1357 |
| 370 | Ga0207660_10002253 | 3300025917 | Bacteria | 12747 |
| 371 | Ga0207660_10004358 | 3300025917 | Bacteria | 9225 |
| 372 | Ga0207660_10046627 | 3300025917 | Bacteria | 3059 |
| 373 | Ga0207660_10136772 | 3300025917 | Bacteria | 1870 |
| 374 | Ga0207660_10319891 | 3300025917 | Bacteria | 1239 |
| 375 | Ga0207662_10421701 | 3300025918 | Unclassified | 908 |
| 376 | Ga0207657_10023759 | 3300025919 | Bacteria | 5700 |
| 377 | Ga0207657_10028070 | 3300025919 | Bacteria | 5142 |
| 378 | Ga0207657_10114354 | 3300025919 | Bacteria | 2225 |
| 379 | Ga0207657_10438199 | 3300025919 | Unclassified | 1026 |
| 380 | Ga0207657_10782507 | 3300025919 | Bacteria | 738 |
| 381 | Ga0207649_10251594 | 3300025920 | Bacteria | 1273 |
| 382 | Ga0207652_10000160 | 3300025921 | Bacteria | 72867 |
| 383 | Ga0207652_10001229 | 3300025921 | Bacteria | 22941 |
| 384 | Ga0207652_10001570 | 3300025921 | Bacteria | 20111 |
| 385 | Ga0207652_10005109 | 3300025921 | Bacteria | 10652 |
| 386 | Ga0207652_10064372 | 3300025921 | Bacteria | 3172 |
| 387 | Ga0207652_10486875 | 3300025921 | Bacteria | 1111 |
| 388 | Ga0207681_10459089 | 3300025923 | Bacteria | 1037 |
| 389 | Ga0207681_10481851 | 3300025923 | Unclassified | 1013 |
| 390 | Ga0207694_10027721 | 3300025924 | Bacteria | 4314 |
| 391 | Ga0207650_10072941 | 3300025925 | Bacteria | 2584 |
| 392 | Ga0207650_10380617 | 3300025925 | Unclassified | 1165 |
| 393 | Ga0207659_10359430 | 3300025926 | Bacteria | 1210 |
| 394 | Ga0207664_10234683 | 3300025929 | Bacteria | 1595 |
| 395 | Ga0207644_10005751 | 3300025931 | Bacteria | 8068 |
| 396 | Ga0207644_10025152 | 3300025931 | Unclassified | 4092 |
| 397 | Ga0207644_10331488 | 3300025931 | Bacteria | 1232 |
| 398 | Ga0207690_10017157 | 3300025932 | Bacteria | 4418 |
| 399 | Ga0207690_10060177 | 3300025932 | Bacteria | 2576 |
| 400 | Ga0207706_10000057 | 3300025933 | Bacteria | 112805 |
| 401 | Ga0207706_10015500 | 3300025933 | Bacteria | 6887 |
| 402 | Ga0207706_10023446 | 3300025933 | Bacteria | 5541 |
| 403 | Ga0207706_10108370 | 3300025933 | Bacteria | 2444 |
| 404 | Ga0207686_10246624 | 3300025934 | Unclassified | 1303 |
| 405 | Ga0207686_10251401 | 3300025934 | Bacteria | 1292 |
| 406 | Ga0207709_10030470 | 3300025935 | Bacteria | 3138 |
| 407 | Ga0207709_10305725 | 3300025935 | Bacteria | 1184 |
| 408 | Ga0207669_10157449 | 3300025937 | Bacteria | 1600 |
| 409 | Ga0207704_10233363 | 3300025938 | Unclassified | 1370 |
| 410 | Ga0207691_10000549 | 3300025940 | Bacteria | 37607 |
| 411 | Ga0207691_10231686 | 3300025940 | Unclassified | 1599 |
| 412 | Ga0207711_10022613 | 3300025941 | Bacteria | 5260 |
| 413 | Ga0207711_10952905 | 3300025941 | Unclassified | 797 |
| 414 | Ga0207689_10007988 | 3300025942 | Bacteria | 9244 |
| 415 | Ga0207689_10035131 | 3300025942 | Bacteria | 4164 |
| 416 | Ga0207689_10123931 | 3300025942 | Bacteria | 2126 |
| 417 | Ga0207689_10545644 | 3300025942 | Unclassified | 973 |
| 418 | Ga0207679_10133437 | 3300025945 | Bacteria | 1995 |
| 419 | Ga0207667_10000218 | 3300025949 | Bacteria | 80364 |
| 420 | Ga0207667_10013351 | 3300025949 | Bacteria | 9403 |
| 421 | Ga0207667_10015291 | 3300025949 | Bacteria | 8724 |
| 422 | Ga0207667_10018470 | 3300025949 | Bacteria | 7818 |
| 423 | Ga0207667_10033964 | 3300025949 | Bacteria | 5480 |
| 424 | Ga0207667_10072873 | 3300025949 | Bacteria | 3570 |
| 425 | Ga0207651_10000231 | 3300025960 | Bacteria | 24055 |
| 426 | Ga0207651_10141165 | 3300025960 | Bacteria | 1861 |
| 427 | Ga0207651_10461794 | 3300025960 | Bacteria | 1091 |
| 428 | Ga0207712_10001912 | 3300025961 | Bacteria | 13697 |
| 429 | Ga0207712_10012826 | 3300025961 | Bacteria | 5359 |
| 430 | Ga0207712_10149374 | 3300025961 | Bacteria | 1803 |
| 431 | Ga0207668_10000639 | 3300025972 | Bacteria | 21609 |
| 432 | Ga0207640_10180581 | 3300025981 | Bacteria | 1582 |
| 433 | Ga0207640_10584164 | 3300025981 | Unclassified | 943 |
| 434 | Ga0207658_10000942 | 3300025986 | Bacteria | 24008 |
| 435 | Ga0207658_10169489 | 3300025986 | Bacteria | 1797 |
| 436 | Ga0207658_10530000 | 3300025986 | Bacteria | 1052 |
| 437 | Ga0207677_10001537 | 3300026023 | Bacteria | 12210 |
| 438 | Ga0207677_10389101 | 3300026023 | Unclassified | 1179 |
| 439 | Ga0207703_10495775 | 3300026035 | Bacteria | 1146 |
| 440 | Ga0207639_10028395 | 3300026041 | Bacteria | 4084 |
| 441 | Ga0207639_10168375 | 3300026041 | Bacteria | 1853 |
| 442 | Ga0207639_10452397 | 3300026041 | Bacteria | 1166 |
| 443 | Ga0207678_10020363 | 3300026067 | Bacteria | 5820 |
| 444 | Ga0207678_10062988 | 3300026067 | Bacteria | 3187 |
| 445 | Ga0207678_10314757 | 3300026067 | Bacteria | 1346 |
| 446 | Ga0207708_10144733 | 3300026075 | Unclassified | 1867 |
| 447 | Ga0207702_10021847 | 3300026078 | Bacteria | 5299 |
| 448 | Ga0207702_10150742 | 3300026078 | Bacteria | 2115 |
| 449 | Ga0207702_10203202 | 3300026078 | Bacteria | 1838 |
| 450 | Ga0207702_10550843 | 3300026078 | Bacteria | 1128 |
| 451 | Ga0207641_10000890 | 3300026088 | Bacteria | 31183 |
| 452 | Ga0207641_10330686 | 3300026088 | Unclassified | 1447 |
| 453 | Ga0207641_10545316 | 3300026088 | Bacteria | 1130 |
| 454 | Ga0207648_10001186 | 3300026089 | Bacteria | 29157 |
| 455 | Ga0207648_10134661 | 3300026089 | Unclassified | 2176 |
| 456 | Ga0207676_10011544 | 3300026095 | Bacteria | 6318 |
| 457 | Ga0207676_10041594 | 3300026095 | Bacteria | 3529 |
| 458 | Ga0207676_10089828 | 3300026095 | Bacteria | 2519 |
| 459 | Ga0207674_10023207 | 3300026116 | Bacteria | 6649 |
| 460 | Ga0207674_10042476 | 3300026116 | Bacteria | 4696 |
| 461 | Ga0207674_10075512 | 3300026116 | Bacteria | 3380 |
| 462 | Ga0207674_10355615 | 3300026116 | Bacteria | 1416 |
| 463 | Ga0207674_10478069 | 3300026116 | Bacteria | 1204 |
| 464 | Ga0207675_100965560 | 3300026118 | Bacteria | 870 |
| 465 | Ga0207683_10003156 | 3300026121 | Bacteria | 14393 |
| 466 | Ga0207683_10085831 | 3300026121 | Bacteria | 2798 |
| 467 | Ga0207683_10123282 | 3300026121 | Unclassified | 2328 |
| 468 | Ga0207683_10465006 | 3300026121 | Unclassified | 1167 |
| 469 | Ga0207698_10005375 | 3300026142 | Bacteria | 7907 |
| 470 | Ga0207698_10049692 | 3300026142 | Bacteria | 3194 |
| 471 | Ga0207698_10210463 | 3300026142 | Unclassified | 1749 |
| 472 | Ga0207698_10238002 | 3300026142 | Bacteria | 1657 |
| 473 | Ga0207698_10381440 | 3300026142 | Bacteria | 1341 |
| 474 | Ga0207698_10597464 | 3300026142 | Bacteria | 1088 |
| 475 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 476 | Ga0268266_10169385 | 3300028379 | Bacteria | 1981 |
| 477 | Ga0268266_10421338 | 3300028379 | Bacteria | 1265 |
| 478 | Ga0268265_10575091 | 3300028380 | Bacteria | 1073 |
| 479 | Ga0268264_10001550 | 3300028381 | Bacteria | 21303 |
| 480 | Ga0268264_10037060 | 3300028381 | Bacteria | 4019 |
| 481 | Ga0268264_10374119 | 3300028381 | Bacteria | 1362 |
| 482 | Ga0307517_10000689 | 3300028786 | Bacteria | 58121 |
| 483 | Ga0307517_10001373 | 3300028786 | Bacteria | 40930 |
| 484 | Ga0307511_10018245 | 3300030521 | Bacteria | 6712 |
| 485 | Ga0265327_10030527 | 3300031251 | Bacteria | 3045 |
| 486 | Ga0307513_10117569 | 3300031456 | Bacteria | 2636 |
| 487 | Ga0307513_10250713 | 3300031456 | Bacteria | 1567 |
| 488 | Ga0307513_10415778 | 3300031456 | Bacteria | 1076 |
| 489 | Ga0307509_10043332 | 3300031507 | Bacteria | 4870 |
| 490 | Ga0307509_10189842 | 3300031507 | Unclassified | 1907 |
| 491 | Ga0307408_100011316 | 3300031548 | Bacteria | 5896 |
| 492 | Ga0307408_100732139 | 3300031548 | Bacteria | 892 |
| 493 | Ga0307508_10000490 | 3300031616 | Bacteria | 47664 |
| 494 | Ga0307516_10030336 | 3300031730 | Bacteria | 5457 |
| 495 | Ga0307405_10012150 | 3300031731 | Bacteria | 4545 |
| 496 | Ga0307413_10261263 | 3300031824 | Unclassified | 1291 |
| 497 | Ga0307413_10642091 | 3300031824 | Bacteria | 874 |
| 498 | Ga0307413_11058270 | 3300031824 | Bacteria | 698 |
| 499 | Ga0307410_10344346 | 3300031852 | Unclassified | 1189 |
| 500 | Ga0307410_10445653 | 3300031852 | Bacteria | 1055 |
| 501 | Ga0307406_10381909 | 3300031901 | Unclassified | 1111 |
| 502 | Ga0307407_10535202 | 3300031903 | Bacteria | 864 |
| 503 | Ga0307412_10017558 | 3300031911 | Unclassified | 4285 |
| 504 | Ga0307409_100023495 | 3300031995 | Unclassified | 4274 |
| 505 | Ga0307416_100013580 | 3300032002 | Bacteria | 5543 |
| 506 | Ga0307414_10994368 | 3300032004 | Bacteria | 772 |
| 507 | Ga0307411_10557105 | 3300032005 | Bacteria | 979 |
| 508 | Ga0307415_100008920 | 3300032126 | Bacteria | 5588 |
| 509 | Ga0307507_10249165 | 3300033179 | Bacteria | 1150 |
| 510 | Ga0307510_10001453 | 3300033180 | Bacteria | 26110 |
| 511 | Ga0373936_0235011 | 3300035113 | Bacteria | 816 |
| 512 | Ga0373941_0002433 | 3300035115 | Bacteria | 4098 |
| 513 | Ga0373947_0080417 | 3300035725 | Unclassified | 2016 |
| 514 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 515 | Ga0395899_0000272 | 3300037312 | Bacteria | 67722 |
| 516 | Ga0395899_0002241 | 3300037312 | Bacteria | 15831 |
| 517 | Ga0395899_0002489 | 3300037312 | Bacteria | 14953 |
| 518 | Ga0395899_0012002 | 3300037312 | Bacteria | 6638 |
| 519 | Ga0395899_0113259 | 3300037312 | Bacteria | 1948 |
| 520 | Ga0395899_0113264 | 3300037312 | Bacteria | 1948 |
| 521 | Ga0395899_0133951 | 3300037312 | Bacteria | 1767 |
| 522 | Ga0395899_0170733 | 3300037312 | Bacteria | 1531 |
| 523 | Ga0395900_0000143 | 3300037418 | Bacteria | 120234 |
| 524 | Ga0395900_0000284 | 3300037418 | Bacteria | 75852 |
| 525 | Ga0395900_0002996 | 3300037418 | Bacteria | 18376 |
| 526 | Ga0395900_0037187 | 3300037418 | Bacteria | 5020 |
| 527 | Ga0395900_0065294 | 3300037418 | Bacteria | 3739 |
| 528 | Ga0395900_0213375 | 3300037418 | Bacteria | 1948 |
| 529 | Ga0395900_0224964 | 3300037418 | Bacteria | 1889 |
| 530 | Ga0395900_0235202 | 3300037418 | Bacteria | 1840 |
| 531 | Ga0395900_0518093 | 3300037418 | Unclassified | 1141 |
| 532 | Ga0395900_0599043 | 3300037418 | Bacteria | 1043 |
| 533 | Ga0395898_0001675 | 3300037466 | Bacteria | 29715 |
| 534 | Ga0395898_0040570 | 3300037466 | Bacteria | 4602 |
| 535 | Ga0395898_0042281 | 3300037466 | Bacteria | 4497 |
| 536 | Ga0395898_0177691 | 3300037466 | Bacteria | 2034 |
| 537 | Ga0395898_0199535 | 3300037466 | Bacteria | 1910 |
| 538 | Ga0395898_0269051 | 3300037466 | Bacteria | 1625 |
| 539 | Ga0395898_0314505 | 3300037466 | Unclassified | 1494 |
| 540 | Ga0395898_0343107 | 3300037466 | Bacteria | 1424 |
| 541 | Ga0395905_0000045 | 3300037471 | Bacteria | 241370 |
| 542 | Ga0395905_0014794 | 3300037471 | Bacteria | 7440 |
| 543 | Ga0395905_0021697 | 3300037471 | Bacteria | 6075 |
| 544 | Ga0395905_0181426 | 3300037471 | Bacteria | 1976 |
| 545 | Ga0395905_0346240 | 3300037471 | Bacteria | 1378 |
| 546 | Ga0395905_0827533 | 3300037471 | Bacteria | 829 |
| 547 | Ga0395901_0041781 | 3300038443 | Unclassified | 4753 |
| 548 | Ga0395901_0051770 | 3300038443 | Bacteria | 4268 |
| 549 | Ga0395901_0095191 | 3300038443 | Bacteria | 3120 |
| 550 | Ga0395901_0181268 | 3300038443 | Bacteria | 2209 |
| 551 | Ga0436365_1199589 | 3300039437 | Bacteria | 1359 |
| 552 | Ga0436361_0924736 | 3300039447 | Bacteria | 22942 |
| 553 | Ga0439436_0000463 | 3300041404 | Bacteria | 10418 |
| 554 | Ga0439439_0034103 | 3300041406 | Bacteria | 1305 |
| 555 | Ga0451791_0915382 | 3300041451 | Bacteria | 843 |
| 556 | Ga0451802_1870795 | 3300041460 | Bacteria | 1269 |
| 557 | Ga0451853_0175003 | 3300041512 | Bacteria | 1508 |
| 558 | Ga0439441_051278 | 3300042001 | Unclassified | 850 |
| 559 | Ga0439449_0084860 | 3300042007 | Bacteria | 1168 |
| 560 | Ga0439460_0012132 | 3300042461 | Bacteria | 2231 |
| 561 | Ga0451577_0162586 | 3300042876 | Bacteria | 2011 |
| 562 | Ga0466969_0002735 | 3300044656 | Bacteria | 9431 |
| 563 | Ga0466969_0027918 | 3300044656 | Bacteria | 2888 |
| 564 | Ga0466972_0000183 | 3300044658 | Bacteria | 48447 |
| 565 | Ga0466972_0010220 | 3300044658 | Bacteria | 4714 |
| 566 | Ga0466966_0000053 | 3300044684 | Bacteria | 84809 |
| 567 | Ga0466966_0041874 | 3300044684 | Bacteria | 2942 |
| 568 | Ga0466966_0186204 | 3300044684 | Bacteria | 1258 |
| 569 | Ga0466961_0054835 | 3300044693 | Bacteria | 2542 |
| 570 | Ga0453684_0035341 | 3300044712 | Bacteria | 6910 |
| 571 | Ga0453684_0201178 | 3300044712 | Bacteria | 2322 |
| 572 | Ga0453684_0203900 | 3300044712 | Bacteria | 2303 |
| 573 | Ga0453684_0206171 | 3300044712 | Bacteria | 2288 |
| 574 | Ga0453684_0753453 | 3300044712 | Unclassified | 1054 |
| 575 | Ga0466968_0073890 | 3300044735 | Bacteria | 1488 |
| 576 | Ga0466970_0171737 | 3300044765 | Unclassified | 1202 |
| 577 | Ga0466957_0000361 | 3300044842 | Bacteria | 22366 |
| 578 | Ga0466957_0003621 | 3300044842 | Bacteria | 8515 |
| 579 | Ga0466960_0282646 | 3300044901 | Bacteria | 930 |
| 580 | Ga0466959_0000005 | 3300045049 | Bacteria | 213958 |
| 581 | Ga0466959_0027330 | 3300045049 | Bacteria | 4232 |
| 582 | Ga0466959_0108333 | 3300045049 | Bacteria | 1985 |
| 583 | Ga0451576_0809183 | 3300045051 | Bacteria | 984 |
| 584 | Ga0466958_0008209 | 3300045836 | Bacteria | 5783 |
| 585 | Ga0466967_0285040 | 3300045976 | Bacteria | 1586 |
| 586 | Ga0495580_0096192 | 3300046472 | Unclassified | 2059 |
| 587 | Ga0495596_0051164 | 3300046500 | Bacteria | 1618 |
| 588 | Ga0495583_0098522 | 3300046506 | Bacteria | 1250 |
| 589 | Ga0495630_0045267 | 3300046517 | Bacteria | 3288 |
| 590 | Ga0495630_0388317 | 3300046517 | Bacteria | 1069 |
| 591 | Ga0495631_0003227 | 3300046518 | Bacteria | 8972 |
| 592 | Ga0495665_0212687 | 3300046531 | Bacteria | 1001 |
| 593 | Ga0495645_0207332 | 3300046543 | Unclassified | 1326 |
| 594 | Ga0495668_0009186 | 3300046616 | Bacteria | 6085 |
| 595 | Ga0495625_0000486 | 3300046660 | Bacteria | 59478 |
| 596 | Ga0495625_0253327 | 3300046660 | Bacteria | 1142 |
| 597 | Ga0495635_0156487 | 3300046663 | Bacteria | 1551 |
| 598 | Ga0495647_0111774 | 3300046681 | Bacteria | 1141 |
| 599 | Ga0495669_0156570 | 3300046684 | Bacteria | 1080 |
| 600 | Ga0495649_0162274 | 3300046694 | Unclassified | 1171 |
| 601 | Ga0495674_0012685 | 3300047319 | Bacteria | 7941 |
| 602 | Ga0495672_0032936 | 3300047320 | Bacteria | 3216 |
| 603 | Ga0495672_0126708 | 3300047320 | Bacteria | 1349 |
| 604 | Ga0495672_0156931 | 3300047320 | Bacteria | 1174 |
| 605 | Ga0495687_006354 | 3300047443 | Bacteria | 7264 |
| 606 | Ga0495685_038486 | 3300047447 | Bacteria | 1639 |
| 607 | Ga0495681_0169620 | 3300047470 | Bacteria | 904 |
| 608 | Ga0495686_0000016 | 3300047472 | Bacteria | 443701 |
| 609 | Ga0495686_0011709 | 3300047472 | Bacteria | 6177 |
| 610 | Ga0495686_0038473 | 3300047472 | Bacteria | 3059 |
| 611 | Ga0496101_0211869 | 3300048904 | Unclassified | 1501 |
| 612 | Ga0496108_0016487 | 3300048911 | Bacteria | 6030 |
| 613 | Ga0496109_0111128 | 3300048912 | Bacteria | 2548 |
| 614 | Ga0496114_0108349 | 3300048917 | Unclassified | 2378 |
| 615 | Ga0496115_0161568 | 3300048918 | Bacteria | 1851 |
| 616 | Ga0496126_0744012 | 3300048929 | Viruses | 758 |
| 617 | Ga0501300_000687 | 3300049523 | Bacteria | 5069 |
| 618 | Ga0501031_0004805 | 3300049568 | Bacteria | 8776 |
| 619 | Ga0501032_0350526 | 3300049569 | Unclassified | 951 |
| 620 | Ga0501034_0104178 | 3300049571 | Bacteria | 2830 |
| 621 | Ga0501034_0326392 | 3300049571 | Bacteria | 1467 |
| 622 | Ga0501036_0029052 | 3300049572 | Bacteria | 4673 |
| 623 | Ga0501038_0015516 | 3300049574 | Bacteria | 6925 |
| 624 | Ga0501043_0009411 | 3300049579 | Bacteria | 7670 |
| 625 | Ga0501046_0250957 | 3300049580 | Unclassified | 1302 |
| 626 | Ga0501047_0049481 | 3300049581 | Bacteria | 4059 |
| 627 | Ga0501047_0093282 | 3300049581 | Bacteria | 2890 |
| 628 | Ga0501047_0315842 | 3300049581 | Unclassified | 1403 |
| 629 | Ga0501047_0629745 | 3300049581 | Bacteria | 893 |
| 630 | Ga0501048_0321824 | 3300049582 | Unclassified | 1102 |
| 631 | Ga0501067_0056979 | 3300049583 | Bacteria | 2164 |
| 632 | Ga0501068_0337583 | 3300049584 | Unclassified | 967 |
| 633 | Ga0501069_0079963 | 3300049585 | Unclassified | 1840 |
| 634 | Ga0501070_0163050 | 3300049586 | Bacteria | 1837 |
| 635 | Ga0501071_0090347 | 3300049587 | Bacteria | 2249 |
| 636 | Ga0501072_0179078 | 3300049588 | Unclassified | 1691 |
| 637 | Ga0501073_0009189 | 3300049589 | Bacteria | 7290 |
| 638 | Ga0501074_0088118 | 3300049590 | Unclassified | 2223 |
| 639 | Ga0501198_003043 | 3300049649 | Bacteria | 2281 |
| 640 | Ga0501201_011133 | 3300049651 | Bacteria | 887 |
| 641 | Ga0501206_016999 | 3300049653 | Bacteria | 1015 |
| 642 | Ga0501217_004320 | 3300049661 | Bacteria | 2915 |
| 643 | Ga0501222_012288 | 3300049662 | Bacteria | 1128 |
| 644 | Ga0501224_013143 | 3300049664 | Bacteria | 1223 |
| 645 | Ga0501235_001096 | 3300049669 | Bacteria | 5664 |
| 646 | Ga0501243_002332 | 3300049675 | Bacteria | 2772 |
| 647 | Ga0501247_002650 | 3300049677 | Bacteria | 1872 |
| 648 | Ga0501250_000629 | 3300049680 | Bacteria | 2502 |
| 649 | Ga0501252_000835 | 3300049682 | Bacteria | 2611 |
| 650 | Ga0501257_002236 | 3300049686 | Bacteria | 4054 |
| 651 | Ga0501259_002139 | 3300049688 | Bacteria | 3246 |
| 652 | Ga0501259_002416 | 3300049688 | Bacteria | 3034 |
| 653 | Ga0501219_000818 | 3300049703 | Bacteria | 4043 |
| 654 | Ga0501225_0008301 | 3300049705 | Bacteria | 2986 |
| 655 | Ga0501225_0048116 | 3300049705 | Bacteria | 1184 |
| 656 | Ga0501245_002571 | 3300049708 | Bacteria | 2430 |
| 657 | Ga0501083_0070947 | 3300049744 | Bacteria | 2316 |
| 658 | Ga0501083_0321259 | 3300049744 | Bacteria | 1007 |
| 659 | Ga0501263_013543 | 3300049760 | Bacteria | 1035 |
| 660 | Ga0501264_000244 | 3300049761 | Bacteria | 8791 |
| 661 | Ga0501266_001020 | 3300049763 | Bacteria | 3616 |
| 662 | Ga0501271_006979 | 3300049768 | Bacteria | 1130 |
| 663 | Ga0501035_0023385 | 3300049822 | Bacteria | 5669 |
| 664 | Ga0501044_0018948 | 3300049823 | Bacteria | 7369 |
| 665 | Ga0501044_0020539 | 3300049823 | Bacteria | 7052 |
| 666 | Ga0501044_0075714 | 3300049823 | Bacteria | 3417 |
| 667 | Ga0501284_00044 | 3300050005 | Bacteria | 49044 |
| 668 | nmdc:mga0k408_115890_c1 | 3300050493 | Unclassified | 1585 |
| 669 | nmdc:mga0k408_22_c2 | 3300050493 | Bacteria | 93033 |
| 670 | nmdc:mga0k408_406335_c1 | 3300050493 | Unclassified | 810 |
| 671 | nmdc:mga07m45_333161_c1 | 3300050496 | Unclassified | 882 |
| 672 | nmdc:mga09592_2911_c1 | 3300050508 | Bacteria | 13882 |
| 673 | nmdc:mga08y16_134651_c1 | 3300050511 | Bacteria | 2568 |
| 674 | nmdc:mga08y16_5136_c1 | 3300050511 | Bacteria | 13684 |
| 675 | nmdc:mga0n895_198258_c1 | 3300050512 | Bacteria | 2039 |
| 676 | nmdc:mga08x19_127677_c1 | 3300050514 | Bacteria | 1708 |
| 677 | Ga0500578_0000017 | 3300053086 | Bacteria | 178494 |
| 678 | Ga0500578_0175718 | 3300053086 | Bacteria | 1322 |
| 679 | Ga0500583_0000130 | 3300053092 | Bacteria | 34913 |
| 680 | Ga0500583_0000387 | 3300053092 | Bacteria | 14221 |
| 681 | Ga0500650_0189003 | 3300053098 | Bacteria | 941 |
| 682 | Ga0500608_016510 | 3300053122 | Bacteria | 3337 |
| 683 | Ga0500559_0088846 | 3300053136 | Bacteria | 1413 |
| 684 | Ga0500573_0164808 | 3300053140 | Unclassified | 1204 |
| 685 | Ga0500588_0007343 | 3300053146 | Bacteria | 2538 |
| 686 | Ga0500604_0001170 | 3300053151 | Bacteria | 7297 |
| 687 | Ga0500604_0081881 | 3300053151 | Bacteria | 1044 |
| 688 | Ga0500616_0012777 | 3300053153 | Bacteria | 4901 |
| 689 | Ga0500637_0129142 | 3300053178 | Bacteria | 1466 |
| 690 | Ga0500611_000054 | 3300053727 | Bacteria | 50397 |
| 691 | Ga0500611_001068 | 3300053727 | Bacteria | 2902 |
| 692 | Ga0500645_018744 | 3300053730 | Bacteria | 2158 |
| 693 | Ga0500587_009357 | 3300053739 | Bacteria | 1252 |
| 694 | Ga0587077_042960 | 3300059493 | Bacteria | 915 |
| 695 | Ga0501082_0420887 | 3300060353 | Unclassified | 1166 |
| 696 | Ga0466962_0083735 | 3300061719 | Bacteria | 1526 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10061449 | Ga0157370_100614493 | 181 |
| 2 | 3300028786 | Ga0307517_10000689 | Ga0307517_1000068911 | 189 |
| 3 | 3300044656 | Ga0466969_0027918 | Ga0466969_0027918_1406_2053 | 194 |
| 4 | 3300044684 | Ga0466966_0186204 | Ga0466966_0186204_186_833 | 194 |
| 5 | 3300044693 | Ga0466961_0054835 | Ga0466961_0054835_313_960 | 194 |
| 6 | 3300045049 | Ga0466959_0108333 | Ga0466959_0108333_344_991 | 194 |
| 7 | 3300045836 | Ga0466958_0008209 | Ga0466958_0008209_3496_4143 | 194 |
| 8 | 3300020077 | Ga0206351_10160225 | Ga0206351_101602251 | 195 |
| 9 | 3300013102 | Ga0157371_10007347 | Ga0157371_100073473 | 196 |
| 10 | 3300013307 | Ga0157372_10000182 | Ga0157372_1000018231 | 196 |
| 11 | 3300025981 | Ga0207640_10180581 | Ga0207640_101805812 | 196 |
| 12 | 3300049651 | Ga0501201_011133 | Ga0501201_011133_172_783 | 196 |
| 13 | 3300005563 | Ga0068855_100015513 | Ga0068855_1000155135 | 197 |
| 14 | 3300025949 | Ga0207667_10018470 | Ga0207667_100184702 | 197 |
| 15 | 3300037312 | Ga0395899_0000272 | Ga0395899_0000272_57265_57912 | 197 |
| 16 | 3300005458 | Ga0070681_10498956 | Ga0070681_104989561 | 198 |
| 17 | 3300041406 | Ga0439439_0034103 | Ga0439439_0034103_50_703 | 198 |
| 18 | 3300041451 | Ga0451791_0915382 | Ga0451791_0915382_179_832 | 198 |
| 19 | 3300050493 | nmdc:mga0k408_406335_c1 | nmdc:mga0k408_406335_c1_94_756 | 198 |
| 20 | 3300050496 | nmdc:mga07m45_333161_c1 | nmdc:mga07m45_333161_c1_14_628 | 198 |
| 21 | 3300053086 | Ga0500578_0175718 | Ga0500578_0175718_476_1183 | 198 |
| 22 | 3300053098 | Ga0500650_0189003 | Ga0500650_0189003_237_890 | 198 |
| 23 | 3300003316 | rootH1_10026206 | rootH1_100262068 | 199 |
| 24 | 3300003322 | rootL2_10075832 | rootL2_100758322 | 199 |
| 25 | 3300009553 | Ga0105249_10170008 | Ga0105249_101700083 | 199 |
| 26 | 3300013306 | Ga0163162_10007383 | Ga0163162_100073837 | 199 |
| 27 | 3300014325 | Ga0163163_10539952 | Ga0163163_105399521 | 199 |
| 28 | 3300025893 | Ga0207682_10243175 | Ga0207682_102431751 | 199 |
| 29 | 3300044842 | Ga0466957_0000361 | Ga0466957_0000361_2736_3401 | 199 |
| 30 | 3300003323 | rootH1_10176585 | rootH1_101765858 | 201 |
| 31 | 3300031507 | Ga0307509_10189842 | Ga0307509_101898422 | 201 |
| 32 | 3300053140 | Ga0500573_0164808 | Ga0500573_0164808_378_1085 | 201 |
| 33 | 3300041512 | Ga0451853_0175003 | Ga0451853_0175003_10_675 | 202 |
| 34 | 3300053092 | Ga0500583_0000130 | Ga0500583_0000130_4603_5304 | 202 |
| 35 | 3300053178 | Ga0500637_0129142 | Ga0500637_0129142_68_730 | 202 |
| 36 | 3300004799 | Ga0058863_10172141 | Ga0058863_101721413 | 203 |
| 37 | 3300004800 | Ga0058861_11885956 | Ga0058861_118859563 | 203 |
| 38 | 3300004803 | Ga0058862_12637711 | Ga0058862_126377112 | 203 |
| 39 | 3300005336 | Ga0070680_100005626 | Ga0070680_1000056267 | 203 |
| 40 | 3300005530 | Ga0070679_100249780 | Ga0070679_1002497801 | 203 |
| 41 | 3300009176 | Ga0105242_10369030 | Ga0105242_103690301 | 203 |
| 42 | 3300013297 | Ga0157378_10031792 | Ga0157378_100317926 | 203 |
| 43 | 3300025917 | Ga0207660_10046627 | Ga0207660_100466272 | 203 |
| 44 | 3300025921 | Ga0207652_10064372 | Ga0207652_100643723 | 203 |
| 45 | 3300025934 | Ga0207686_10251401 | Ga0207686_102514011 | 203 |
| 46 | 3300041460 | Ga0451802_1870795 | Ga0451802_1870795_495_1196 | 203 |
| 47 | 3300053092 | Ga0500583_0000387 | Ga0500583_0000387_7995_8696 | 203 |
| 48 | 3300053727 | Ga0500611_001068 | Ga0500611_001068_1345_2046 | 203 |
| 49 | 3300005548 | Ga0070665_100515444 | Ga0070665_1005154442 | 204 |
| 50 | 3300005563 | Ga0068855_100000631 | Ga0068855_10000063135 | 204 |
| 51 | 3300013100 | Ga0157373_10004999 | Ga0157373_100049992 | 204 |
| 52 | 3300017792 | Ga0163161_10000230 | Ga0163161_1000023016 | 204 |
| 53 | 3300017792 | Ga0163161_10097798 | Ga0163161_100977982 | 204 |
| 54 | 3300025949 | Ga0207667_10000218 | Ga0207667_1000021861 | 204 |
| 55 | 3300028379 | Ga0268266_10421338 | Ga0268266_104213382 | 204 |
| 56 | 3300005563 | Ga0068855_100413422 | Ga0068855_1004134222 | 205 |
| 57 | 3300013307 | Ga0157372_10051844 | Ga0157372_100518445 | 205 |
| 58 | 3300049571 | Ga0501034_0326392 | Ga0501034_0326392_733_1371 | 205 |
| 59 | 3300049580 | Ga0501046_0250957 | Ga0501046_0250957_436_1116 | 205 |
| 60 | 3300049581 | Ga0501047_0315842 | Ga0501047_0315842_550_1230 | 205 |
| 61 | 3300049583 | Ga0501067_0056979 | Ga0501067_0056979_1451_2131 | 205 |
| 62 | 3300049585 | Ga0501069_0079963 | Ga0501069_0079963_486_1166 | 205 |
| 63 | 3300060353 | Ga0501082_0420887 | Ga0501082_0420887_313_993 | 205 |
| 64 | 3300003323 | rootH1_10015461 | rootH1_100154615 | 206 |
| 65 | 3300046660 | Ga0495625_0000486 | Ga0495625_0000486_43459_44097 | 206 |
| 66 | 3300047320 | Ga0495672_0032936 | Ga0495672_0032936_1365_2066 | 206 |
| 67 | 3300050493 | nmdc:mga0k408_22_c2 | nmdc:mga0k408_22_c2_60482_61120 | 206 |
| 68 | 3300009094 | Ga0111539_10006564 | Ga0111539_1000656411 | 207 |
| 69 | 3300009147 | Ga0114129_10729842 | Ga0114129_107298422 | 207 |
| 70 | 3300037312 | Ga0395899_0000011 | Ga0395899_0000011_176313_176972 | 207 |
| 71 | 3300044684 | Ga0466966_0041874 | Ga0466966_0041874_560_1216 | 207 |
| 72 | 3300045049 | Ga0466959_0027330 | Ga0466959_0027330_500_1177 | 207 |
| 73 | 3300046500 | Ga0495596_0051164 | Ga0495596_0051164_88_768 | 207 |
| 74 | 3300061719 | Ga0466962_0083735 | Ga0466962_0083735_26_703 | 207 |
| 75 | 3300005327 | Ga0070658_10039535 | Ga0070658_100395352 | 208 |
| 76 | 3300005563 | Ga0068855_100404665 | Ga0068855_1004046652 | 208 |
| 77 | 3300005834 | Ga0068851_10092301 | Ga0068851_100923012 | 208 |
| 78 | 3300005985 | Ga0081539_10001220 | Ga0081539_100012202 | 208 |
| 79 | 3300025899 | Ga0207642_10218472 | Ga0207642_102184721 | 208 |
| 80 | 3300025909 | Ga0207705_10295049 | Ga0207705_102950492 | 208 |
| 81 | 3300037418 | Ga0395900_0518093 | Ga0395900_0518093_259_897 | 208 |
| 82 | 3300037466 | Ga0395898_0314505 | Ga0395898_0314505_780_1418 | 208 |
| 83 | 3300053151 | Ga0500604_0081881 | Ga0500604_0081881_101_802 | 208 |
| 84 | 3300053739 | Ga0500587_009357 | Ga0500587_009357_100_801 | 208 |
| 85 | 3300014325 | Ga0163163_10348328 | Ga0163163_103483282 | 209 |
| 86 | 3300028786 | Ga0307517_10001373 | Ga0307517_1000137319 | 209 |
| 87 | 3300037471 | Ga0395905_0346240 | Ga0395905_0346240_283_930 | 209 |
| 88 | 3300044765 | Ga0466970_0171737 | Ga0466970_0171737_200_847 | 209 |
| 89 | 3300005614 | Ga0068856_100277262 | Ga0068856_1002772622 | 210 |
| 90 | 3300025924 | Ga0207694_10027721 | Ga0207694_100277214 | 210 |
| 91 | 3300026078 | Ga0207702_10203202 | Ga0207702_102032022 | 210 |
| 92 | 3300042876 | Ga0451577_0162586 | Ga0451577_0162586_945_1613 | 210 |
| 93 | 3300044712 | Ga0453684_0035341 | Ga0453684_0035341_5917_6585 | 210 |
| 94 | 3300045051 | Ga0451576_0809183 | Ga0451576_0809183_290_958 | 210 |
| 95 | 3300049569 | Ga0501032_0350526 | Ga0501032_0350526_181_861 | 210 |
| 96 | 3300049582 | Ga0501048_0321824 | Ga0501048_0321824_54_734 | 210 |
| 97 | 3300049584 | Ga0501068_0337583 | Ga0501068_0337583_143_823 | 210 |
| 98 | 3300049586 | Ga0501070_0163050 | Ga0501070_0163050_33_713 | 210 |
| 99 | 3300049587 | Ga0501071_0090347 | Ga0501071_0090347_468_1148 | 210 |
| 100 | 3300049588 | Ga0501072_0179078 | Ga0501072_0179078_264_944 | 210 |
| 101 | 3300049589 | Ga0501073_0009189 | Ga0501073_0009189_1756_2436 | 210 |
| 102 | 3300049590 | Ga0501074_0088118 | Ga0501074_0088118_381_1061 | 210 |
| 103 | 3300049744 | Ga0501083_0070947 | Ga0501083_0070947_525_1205 | 210 |
| 104 | 3300049823 | Ga0501044_0075714 | Ga0501044_0075714_794_1474 | 210 |
| 105 | 3300005840 | Ga0068870_10369972 | Ga0068870_103699721 | 211 |
| 106 | 3300013297 | Ga0157378_10017995 | Ga0157378_100179957 | 211 |
| 107 | 3300013308 | Ga0157375_10034881 | Ga0157375_100348812 | 211 |
| 108 | 3300047447 | Ga0495685_038486 | Ga0495685_038486_223_897 | 211 |
| 109 | 3300047470 | Ga0495681_0169620 | Ga0495681_0169620_43_717 | 211 |
| 110 | iso_pu_bacteria | 2738541278 | 2738729407 | 212 |
| 111 | 3300003322 | rootL2_10173807 | rootL2_101738071 | 213 |
| 112 | 3300003322 | rootL2_10251069 | rootL2_102510692 | 213 |
| 113 | 3300005354 | Ga0070675_100015362 | Ga0070675_1000153623 | 213 |
| 114 | 3300006844 | Ga0075428_100542658 | Ga0075428_1005426582 | 213 |
| 115 | 3300009094 | Ga0111539_10001678 | Ga0111539_100016789 | 213 |
| 116 | 3300013297 | Ga0157378_11404986 | Ga0157378_114049861 | 213 |
| 117 | 3300013308 | Ga0157375_11366032 | Ga0157375_113660321 | 213 |
| 118 | 3300014326 | Ga0157380_10097921 | Ga0157380_100979212 | 213 |
| 119 | 3300021384 | Ga0213876_10186190 | Ga0213876_101861902 | 213 |
| 120 | 3300031824 | Ga0307413_11058270 | Ga0307413_110582701 | 213 |
| 121 | 3300039437 | Ga0436365_1199589 | Ga0436365_1199589_400_1053 | 213 |
| 122 | 3300044712 | Ga0453684_0753453 | Ga0453684_0753453_36_683 | 213 |
| 123 | 3300049649 | Ga0501198_003043 | Ga0501198_003043_97_765 | 213 |
| 124 | 3300049653 | Ga0501206_016999 | Ga0501206_016999_135_803 | 213 |
| 125 | 3300049664 | Ga0501224_013143 | Ga0501224_013143_135_803 | 213 |
| 126 | 3300049669 | Ga0501235_001096 | Ga0501235_001096_1741_2409 | 213 |
| 127 | 3300049675 | Ga0501243_002332 | Ga0501243_002332_426_1094 | 213 |
| 128 | 3300049682 | Ga0501252_000835 | Ga0501252_000835_1853_2521 | 213 |
| 129 | 3300049688 | Ga0501259_002139 | Ga0501259_002139_86_754 | 213 |
| 130 | 3300049705 | Ga0501225_0008301 | Ga0501225_0008301_329_997 | 213 |
| 131 | 3300049708 | Ga0501245_002571 | Ga0501245_002571_1146_1814 | 213 |
| 132 | 3300050511 | nmdc:mga08y16_5136_c1 | nmdc:mga08y16_5136_c1_9755_10411 | 213 |
| 133 | 3300053153 | Ga0500616_0012777 | Ga0500616_0012777_2153_2806 | 213 |
| 134 | 3300005548 | Ga0070665_100889998 | Ga0070665_1008899981 | 214 |
| 135 | 3300013306 | Ga0163162_10356335 | Ga0163162_103563352 | 214 |
| 136 | 3300031507 | Ga0307509_10043332 | Ga0307509_100433323 | 214 |
| 137 | 3300031731 | Ga0307405_10012150 | Ga0307405_100121503 | 214 |
| 138 | 3300031824 | Ga0307413_10261263 | Ga0307413_102612632 | 214 |
| 139 | 3300031824 | Ga0307413_10642091 | Ga0307413_106420912 | 214 |
| 140 | 3300031852 | Ga0307410_10344346 | Ga0307410_103443462 | 214 |
| 141 | 3300031901 | Ga0307406_10381909 | Ga0307406_103819092 | 214 |
| 142 | 3300031911 | Ga0307412_10017558 | Ga0307412_100175584 | 214 |
| 143 | 3300031995 | Ga0307409_100023495 | Ga0307409_1000234954 | 214 |
| 144 | 3300032002 | Ga0307416_100013580 | Ga0307416_1000135804 | 214 |
| 145 | 3300032004 | Ga0307414_10994368 | Ga0307414_109943681 | 214 |
| 146 | 3300032126 | Ga0307415_100008920 | Ga0307415_1000089203 | 214 |
| 147 | 3300044712 | Ga0453684_0203900 | Ga0453684_0203900_54_710 | 214 |
| 148 | 3300046616 | Ga0495668_0009186 | Ga0495668_0009186_520_1194 | 214 |
| 149 | 3300053151 | Ga0500604_0001170 | Ga0500604_0001170_6388_7062 | 214 |
| 150 | 3300003320 | rootH2_10013162 | rootH2_1001316226 | 215 |
| 151 | 3300003322 | rootL2_10153257 | rootL2_101532572 | 215 |
| 152 | 3300003322 | rootL2_10363313 | rootL2_103633132 | 215 |
| 153 | 3300005471 | Ga0070698_100027024 | Ga0070698_1000270245 | 215 |
| 154 | 3300005539 | Ga0068853_101089999 | Ga0068853_1010899991 | 215 |
| 155 | 3300009094 | Ga0111539_10193845 | Ga0111539_101938452 | 215 |
| 156 | 3300009553 | Ga0105249_10002393 | Ga0105249_100023938 | 215 |
| 157 | 3300013104 | Ga0157370_10073871 | Ga0157370_100738713 | 215 |
| 158 | 3300013306 | Ga0163162_10953408 | Ga0163162_109534082 | 215 |
| 159 | 3300014326 | Ga0157380_10004725 | Ga0157380_100047253 | 215 |
| 160 | 3300014326 | Ga0157380_10164705 | Ga0157380_101647052 | 215 |
| 161 | 3300025246 | Ga0209646_1000837 | Ga0209646_10008378 | 215 |
| 162 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006399 | 215 |
| 163 | 3300025901 | Ga0207688_10409916 | Ga0207688_104099161 | 215 |
| 164 | 3300025961 | Ga0207712_10001912 | Ga0207712_100019129 | 215 |
| 165 | 3300026088 | Ga0207641_10545316 | Ga0207641_105453162 | 215 |
| 166 | 3300031548 | Ga0307408_100011316 | Ga0307408_1000113162 | 215 |
| 167 | 3300031730 | Ga0307516_10030336 | Ga0307516_100303364 | 215 |
| 168 | 3300031852 | Ga0307410_10445653 | Ga0307410_104456532 | 215 |
| 169 | 3300032005 | Ga0307411_10557105 | Ga0307411_105571051 | 215 |
| 170 | 3300044658 | Ga0466972_0010220 | Ga0466972_0010220_2971_3672 | 215 |
| 171 | 3300047320 | Ga0495672_0126708 | Ga0495672_0126708_606_1265 | 215 |
| 172 | 3300048918 | Ga0496115_0161568 | Ga0496115_0161568_63_734 | 215 |
| 173 | 3300049523 | Ga0501300_000687 | Ga0501300_000687_16_672 | 215 |
| 174 | 3300049581 | Ga0501047_0049481 | Ga0501047_0049481_958_1662 | 215 |
| 175 | 3300049661 | Ga0501217_004320 | Ga0501217_004320_1806_2462 | 215 |
| 176 | 3300049662 | Ga0501222_012288 | Ga0501222_012288_418_1077 | 215 |
| 177 | 3300049677 | Ga0501247_002650 | Ga0501247_002650_181_837 | 215 |
| 178 | 3300049686 | Ga0501257_002236 | Ga0501257_002236_1775_2434 | 215 |
| 179 | 3300049761 | Ga0501264_000244 | Ga0501264_000244_3642_4301 | 215 |
| 180 | 3300049768 | Ga0501271_006979 | Ga0501271_006979_87_743 | 215 |
| 181 | 3300049823 | Ga0501044_0018948 | Ga0501044_0018948_395_1099 | 215 |
| 182 | 3300050511 | nmdc:mga08y16_134651_c1 | nmdc:mga08y16_134651_c1_464_1171 | 215 |
| 183 | 3300053086 | Ga0500578_0000017 | Ga0500578_0000017_74793_75494 | 215 |
| 184 | 3300053727 | Ga0500611_000054 | Ga0500611_000054_23989_24651 | 215 |
| 185 | 3300059493 | Ga0587077_042960 | Ga0587077_042960_178_879 | 215 |
| 186 | iso_pu_bacteria | 2910245624 | 2910247887 | 215 |
| 187 | 3300001904 | JGI24736J21556_1017643 | JGI24736J21556_10176432 | 216 |
| 188 | 3300003322 | rootL2_10057324 | rootL2_100573243 | 216 |
| 189 | 3300003323 | rootH1_10197827 | rootH1_101978272 | 216 |
| 190 | 3300005329 | Ga0070683_100053211 | Ga0070683_1000532113 | 216 |
| 191 | 3300005334 | Ga0068869_100557115 | Ga0068869_1005571151 | 216 |
| 192 | 3300005336 | Ga0070680_100190324 | Ga0070680_1001903241 | 216 |
| 193 | 3300005336 | Ga0070680_100274768 | Ga0070680_1002747682 | 216 |
| 194 | 3300005337 | Ga0070682_100016869 | Ga0070682_1000168692 | 216 |
| 195 | 3300005338 | Ga0068868_100092748 | Ga0068868_1000927481 | 216 |
| 196 | 3300005340 | Ga0070689_100654252 | Ga0070689_1006542522 | 216 |
| 197 | 3300005343 | Ga0070687_100005535 | Ga0070687_1000055351 | 216 |
| 198 | 3300005344 | Ga0070661_100096260 | Ga0070661_1000962602 | 216 |
| 199 | 3300005364 | Ga0070673_100051840 | Ga0070673_1000518403 | 216 |
| 200 | 3300005364 | Ga0070673_100330898 | Ga0070673_1003308982 | 216 |
| 201 | 3300005366 | Ga0070659_100012341 | Ga0070659_1000123414 | 216 |
| 202 | 3300005366 | Ga0070659_100060941 | Ga0070659_1000609413 | 216 |
| 203 | 3300005367 | Ga0070667_100071055 | Ga0070667_1000710551 | 216 |
| 204 | 3300005367 | Ga0070667_100223154 | Ga0070667_1002231542 | 216 |
| 205 | 3300005438 | Ga0070701_10081726 | Ga0070701_100817262 | 216 |
| 206 | 3300005456 | Ga0070678_100250511 | Ga0070678_1002505112 | 216 |
| 207 | 3300005457 | Ga0070662_100002472 | Ga0070662_10000247211 | 216 |
| 208 | 3300005459 | Ga0068867_100047251 | Ga0068867_1000472512 | 216 |
| 209 | 3300005471 | Ga0070698_100157563 | Ga0070698_1001575631 | 216 |
| 210 | 3300005530 | Ga0070679_100006085 | Ga0070679_1000060852 | 216 |
| 211 | 3300005530 | Ga0070679_100192443 | Ga0070679_1001924432 | 216 |
| 212 | 3300005535 | Ga0070684_100056185 | Ga0070684_1000561852 | 216 |
| 213 | 3300005539 | Ga0068853_100053211 | Ga0068853_1000532112 | 216 |
| 214 | 3300005547 | Ga0070693_100352257 | Ga0070693_1003522571 | 216 |
| 215 | 3300005563 | Ga0068855_100004470 | Ga0068855_10000447010 | 216 |
| 216 | 3300005564 | Ga0070664_100123343 | Ga0070664_1001233433 | 216 |
| 217 | 3300005564 | Ga0070664_100440844 | Ga0070664_1004408441 | 216 |
| 218 | 3300005577 | Ga0068857_100018099 | Ga0068857_1000180993 | 216 |
| 219 | 3300005577 | Ga0068857_100057738 | Ga0068857_1000577381 | 216 |
| 220 | 3300005577 | Ga0068857_100114700 | Ga0068857_1001147003 | 216 |
| 221 | 3300005614 | Ga0068856_100126917 | Ga0068856_1001269171 | 216 |
| 222 | 3300005616 | Ga0068852_100007007 | Ga0068852_1000070073 | 216 |
| 223 | 3300005616 | Ga0068852_100458321 | Ga0068852_1004583211 | 216 |
| 224 | 3300005834 | Ga0068851_10044146 | Ga0068851_100441462 | 216 |
| 225 | 3300005842 | Ga0068858_100744799 | Ga0068858_1007447991 | 216 |
| 226 | 3300005985 | Ga0081539_10018402 | Ga0081539_100184022 | 216 |
| 227 | 3300006195 | Ga0075366_10070576 | Ga0075366_100705762 | 216 |
| 228 | 3300006195 | Ga0075366_10319867 | Ga0075366_103198672 | 216 |
| 229 | 3300006358 | Ga0068871_100028768 | Ga0068871_1000287683 | 216 |
| 230 | 3300006871 | Ga0075434_100064367 | Ga0075434_1000643673 | 216 |
| 231 | 3300006914 | Ga0075436_100113601 | Ga0075436_1001136012 | 216 |
| 232 | 3300009093 | Ga0105240_10629514 | Ga0105240_106295141 | 216 |
| 233 | 3300009147 | Ga0114129_10005512 | Ga0114129_100055122 | 216 |
| 234 | 3300009174 | Ga0105241_10107885 | Ga0105241_101078852 | 216 |
| 235 | 3300009177 | Ga0105248_11103629 | Ga0105248_111036292 | 216 |
| 236 | 3300009177 | Ga0105248_11402990 | Ga0105248_114029901 | 216 |
| 237 | 3300009545 | Ga0105237_10566965 | Ga0105237_105669651 | 216 |
| 238 | 3300009545 | Ga0105237_10883440 | Ga0105237_108834401 | 216 |
| 239 | 3300010375 | Ga0105239_10014100 | Ga0105239_100141004 | 216 |
| 240 | 3300013100 | Ga0157373_10000978 | Ga0157373_100009782 | 216 |
| 241 | 3300013102 | Ga0157371_10001061 | Ga0157371_100010615 | 216 |
| 242 | 3300013104 | Ga0157370_10099357 | Ga0157370_100993572 | 216 |
| 243 | 3300013104 | Ga0157370_10333429 | Ga0157370_103334292 | 216 |
| 244 | 3300013105 | Ga0157369_10052946 | Ga0157369_100529464 | 216 |
| 245 | 3300013105 | Ga0157369_10056016 | Ga0157369_100560164 | 216 |
| 246 | 3300013296 | Ga0157374_10064307 | Ga0157374_100643072 | 216 |
| 247 | 3300013296 | Ga0157374_10089978 | Ga0157374_100899782 | 216 |
| 248 | 3300013297 | Ga0157378_10005392 | Ga0157378_100053922 | 216 |
| 249 | 3300013297 | Ga0157378_10040863 | Ga0157378_100408632 | 216 |
| 250 | 3300013306 | Ga0163162_10895910 | Ga0163162_108959101 | 216 |
| 251 | 3300013307 | Ga0157372_10193797 | Ga0157372_101937971 | 216 |
| 252 | 3300013307 | Ga0157372_10415907 | Ga0157372_104159072 | 216 |
| 253 | 3300014745 | Ga0157377_10411294 | Ga0157377_104112941 | 216 |
| 254 | 3300025901 | Ga0207688_10021329 | Ga0207688_100213293 | 216 |
| 255 | 3300025903 | Ga0207680_10080441 | Ga0207680_100804413 | 216 |
| 256 | 3300025903 | Ga0207680_10575727 | Ga0207680_105757271 | 216 |
| 257 | 3300025904 | Ga0207647_10000045 | Ga0207647_1000004597 | 216 |
| 258 | 3300025907 | Ga0207645_10032044 | Ga0207645_100320443 | 216 |
| 259 | 3300025909 | Ga0207705_10123331 | Ga0207705_101233312 | 216 |
| 260 | 3300025912 | Ga0207707_10178394 | Ga0207707_101783942 | 216 |
| 261 | 3300025913 | Ga0207695_10486805 | Ga0207695_104868052 | 216 |
| 262 | 3300025917 | Ga0207660_10319891 | Ga0207660_103198912 | 216 |
| 263 | 3300025918 | Ga0207662_10421701 | Ga0207662_104217011 | 216 |
| 264 | 3300025919 | Ga0207657_10023759 | Ga0207657_100237592 | 216 |
| 265 | 3300025919 | Ga0207657_10114354 | Ga0207657_101143542 | 216 |
| 266 | 3300025919 | Ga0207657_10438199 | Ga0207657_104381992 | 216 |
| 267 | 3300025921 | Ga0207652_10000160 | Ga0207652_1000016025 | 216 |
| 268 | 3300025931 | Ga0207644_10331488 | Ga0207644_103314882 | 216 |
| 269 | 3300025932 | Ga0207690_10017157 | Ga0207690_100171574 | 216 |
| 270 | 3300025932 | Ga0207690_10060177 | Ga0207690_100601772 | 216 |
| 271 | 3300025933 | Ga0207706_10015500 | Ga0207706_100155004 | 216 |
| 272 | 3300025937 | Ga0207669_10157449 | Ga0207669_101574491 | 216 |
| 273 | 3300025942 | Ga0207689_10545644 | Ga0207689_105456441 | 216 |
| 274 | 3300025945 | Ga0207679_10133437 | Ga0207679_101334372 | 216 |
| 275 | 3300025949 | Ga0207667_10015291 | Ga0207667_100152915 | 216 |
| 276 | 3300025960 | Ga0207651_10141165 | Ga0207651_101411653 | 216 |
| 277 | 3300025986 | Ga0207658_10530000 | Ga0207658_105300001 | 216 |
| 278 | 3300026041 | Ga0207639_10168375 | Ga0207639_101683753 | 216 |
| 279 | 3300026075 | Ga0207708_10144733 | Ga0207708_101447332 | 216 |
| 280 | 3300026089 | Ga0207648_10134661 | Ga0207648_101346611 | 216 |
| 281 | 3300026116 | Ga0207674_10023207 | Ga0207674_100232076 | 216 |
| 282 | 3300026116 | Ga0207674_10042476 | Ga0207674_100424764 | 216 |
| 283 | 3300026116 | Ga0207674_10075512 | Ga0207674_100755122 | 216 |
| 284 | 3300026116 | Ga0207674_10478069 | Ga0207674_104780692 | 216 |
| 285 | 3300026118 | Ga0207675_100965560 | Ga0207675_1009655601 | 216 |
| 286 | 3300026142 | Ga0207698_10005375 | Ga0207698_100053754 | 216 |
| 287 | 3300026142 | Ga0207698_10381440 | Ga0207698_103814402 | 216 |
| 288 | 3300031456 | Ga0307513_10117569 | Ga0307513_101175692 | 216 |
| 289 | 3300031903 | Ga0307407_10535202 | Ga0307407_105352021 | 216 |
| 290 | 3300037312 | Ga0395899_0002489 | Ga0395899_0002489_6940_7602 | 216 |
| 291 | 3300037312 | Ga0395899_0113259 | Ga0395899_0113259_447_1109 | 216 |
| 292 | 3300037312 | Ga0395899_0113264 | Ga0395899_0113264_841_1503 | 216 |
| 293 | 3300037312 | Ga0395899_0133951 | Ga0395899_0133951_1078_1740 | 216 |
| 294 | 3300037418 | Ga0395900_0002996 | Ga0395900_0002996_1193_1855 | 216 |
| 295 | 3300037418 | Ga0395900_0037187 | Ga0395900_0037187_3803_4465 | 216 |
| 296 | 3300037418 | Ga0395900_0213375 | Ga0395900_0213375_446_1108 | 216 |
| 297 | 3300037418 | Ga0395900_0235202 | Ga0395900_0235202_732_1394 | 216 |
| 298 | 3300037466 | Ga0395898_0001675 | Ga0395898_0001675_28564_29226 | 216 |
| 299 | 3300037466 | Ga0395898_0040570 | Ga0395898_0040570_2905_3567 | 216 |
| 300 | 3300037466 | Ga0395898_0042281 | Ga0395898_0042281_1299_1961 | 216 |
| 301 | 3300037466 | Ga0395898_0199535 | Ga0395898_0199535_815_1477 | 216 |
| 302 | 3300037471 | Ga0395905_0181426 | Ga0395905_0181426_449_1111 | 216 |
| 303 | 3300038443 | Ga0395901_0041781 | Ga0395901_0041781_447_1109 | 216 |
| 304 | 3300038443 | Ga0395901_0051770 | Ga0395901_0051770_2194_2856 | 216 |
| 305 | 3300038443 | Ga0395901_0095191 | Ga0395901_0095191_1479_2141 | 216 |
| 306 | 3300041404 | Ga0439436_0000463 | Ga0439436_0000463_5815_6477 | 216 |
| 307 | 3300042001 | Ga0439441_051278 | Ga0439441_051278_108_773 | 216 |
| 308 | 3300042007 | Ga0439449_0084860 | Ga0439449_0084860_431_1093 | 216 |
| 309 | 3300042461 | Ga0439460_0012132 | Ga0439460_0012132_21_686 | 216 |
| 310 | 3300044656 | Ga0466969_0002735 | Ga0466969_0002735_7224_7892 | 216 |
| 311 | 3300044658 | Ga0466972_0000183 | Ga0466972_0000183_30412_31071 | 216 |
| 312 | 3300044684 | Ga0466966_0000053 | Ga0466966_0000053_52067_52735 | 216 |
| 313 | 3300044735 | Ga0466968_0073890 | Ga0466968_0073890_475_1143 | 216 |
| 314 | 3300044842 | Ga0466957_0003621 | Ga0466957_0003621_6022_6726 | 216 |
| 315 | 3300045049 | Ga0466959_0000005 | Ga0466959_0000005_173743_174411 | 216 |
| 316 | 3300045976 | Ga0466967_0285040 | Ga0466967_0285040_147_899 | 216 |
| 317 | 3300046663 | Ga0495635_0156487 | Ga0495635_0156487_589_1299 | 216 |
| 318 | 3300047472 | Ga0495686_0011709 | Ga0495686_0011709_1059_1730 | 216 |
| 319 | 3300047472 | Ga0495686_0038473 | Ga0495686_0038473_2275_2949 | 216 |
| 320 | 3300049571 | Ga0501034_0104178 | Ga0501034_0104178_191_856 | 216 |
| 321 | 3300049680 | Ga0501250_000629 | Ga0501250_000629_27_689 | 216 |
| 322 | 3300049688 | Ga0501259_002416 | Ga0501259_002416_187_849 | 216 |
| 323 | 3300049705 | Ga0501225_0048116 | Ga0501225_0048116_255_1049 | 216 |
| 324 | 3300049760 | Ga0501263_013543 | Ga0501263_013543_40_702 | 216 |
| 325 | 3300049763 | Ga0501266_001020 | Ga0501266_001020_110_772 | 216 |
| 326 | 3300050493 | nmdc:mga0k408_115890_c1 | nmdc:mga0k408_115890_c1_430_1104 | 216 |
| 327 | 3300050512 | nmdc:mga0n895_198258_c1 | nmdc:mga0n895_198258_c1_454_1161 | 216 |
| 328 | 3300050514 | nmdc:mga08x19_127677_c1 | nmdc:mga08x19_127677_c1_725_1393 | 216 |
| 329 | 3300002459 | JGI24751J29686_10002883 | JGI24751J29686_100028835 | 217 |
| 330 | 3300005327 | Ga0070658_10000363 | Ga0070658_1000036315 | 217 |
| 331 | 3300005327 | Ga0070658_10057120 | Ga0070658_100571202 | 217 |
| 332 | 3300005328 | Ga0070676_10000103 | Ga0070676_100001034 | 217 |
| 333 | 3300005328 | Ga0070676_10167743 | Ga0070676_101677432 | 217 |
| 334 | 3300005329 | Ga0070683_100060211 | Ga0070683_1000602113 | 217 |
| 335 | 3300005330 | Ga0070690_100061461 | Ga0070690_1000614613 | 217 |
| 336 | 3300005331 | Ga0070670_100040709 | Ga0070670_1000407091 | 217 |
| 337 | 3300005334 | Ga0068869_100107275 | Ga0068869_1001072752 | 217 |
| 338 | 3300005335 | Ga0070666_10009574 | Ga0070666_100095745 | 217 |
| 339 | 3300005336 | Ga0070680_100002416 | Ga0070680_1000024166 | 217 |
| 340 | 3300005338 | Ga0068868_100000358 | Ga0068868_10000035815 | 217 |
| 341 | 3300005339 | Ga0070660_100871196 | Ga0070660_1008711961 | 217 |
| 342 | 3300005344 | Ga0070661_100057865 | Ga0070661_1000578652 | 217 |
| 343 | 3300005347 | Ga0070668_100000308 | Ga0070668_10000030815 | 217 |
| 344 | 3300005347 | Ga0070668_100697232 | Ga0070668_1006972321 | 217 |
| 345 | 3300005354 | Ga0070675_100409833 | Ga0070675_1004098332 | 217 |
| 346 | 3300005355 | Ga0070671_100255037 | Ga0070671_1002550372 | 217 |
| 347 | 3300005356 | Ga0070674_100322107 | Ga0070674_1003221071 | 217 |
| 348 | 3300005364 | Ga0070673_100000232 | Ga0070673_10000023211 | 217 |
| 349 | 3300005367 | Ga0070667_100000583 | Ga0070667_10000058314 | 217 |
| 350 | 3300005455 | Ga0070663_100088748 | Ga0070663_1000887482 | 217 |
| 351 | 3300005455 | Ga0070663_100296502 | Ga0070663_1002965022 | 217 |
| 352 | 3300005456 | Ga0070678_100061345 | Ga0070678_1000613453 | 217 |
| 353 | 3300005456 | Ga0070678_100170806 | Ga0070678_1001708062 | 217 |
| 354 | 3300005457 | Ga0070662_100003765 | Ga0070662_1000037659 | 217 |
| 355 | 3300005458 | Ga0070681_10014298 | Ga0070681_100142983 | 217 |
| 356 | 3300005535 | Ga0070684_100000251 | Ga0070684_10000025116 | 217 |
| 357 | 3300005539 | Ga0068853_100015341 | Ga0068853_1000153414 | 217 |
| 358 | 3300005543 | Ga0070672_100000345 | Ga0070672_10000034513 | 217 |
| 359 | 3300005548 | Ga0070665_100004255 | Ga0070665_1000042552 | 217 |
| 360 | 3300005563 | Ga0068855_100046876 | Ga0068855_1000468761 | 217 |
| 361 | 3300005563 | Ga0068855_100156908 | Ga0068855_1001569082 | 217 |
| 362 | 3300005614 | Ga0068856_100037746 | Ga0068856_1000377462 | 217 |
| 363 | 3300005614 | Ga0068856_100058387 | Ga0068856_1000583872 | 217 |
| 364 | 3300005616 | Ga0068852_100659415 | Ga0068852_1006594152 | 217 |
| 365 | 3300005616 | Ga0068852_101156020 | Ga0068852_1011560201 | 217 |
| 366 | 3300005618 | Ga0068864_100004460 | Ga0068864_1000044606 | 217 |
| 367 | 3300005618 | Ga0068864_100008678 | Ga0068864_1000086782 | 217 |
| 368 | 3300005618 | Ga0068864_100436712 | Ga0068864_1004367121 | 217 |
| 369 | 3300005834 | Ga0068851_10010581 | Ga0068851_100105813 | 217 |
| 370 | 3300005841 | Ga0068863_100001439 | Ga0068863_10000143910 | 217 |
| 371 | 3300005842 | Ga0068858_100005079 | Ga0068858_1000050799 | 217 |
| 372 | 3300005843 | Ga0068860_100000662 | Ga0068860_10000066214 | 217 |
| 373 | 3300006237 | Ga0097621_100002379 | Ga0097621_1000023793 | 217 |
| 374 | 3300006358 | Ga0068871_100101575 | Ga0068871_1001015753 | 217 |
| 375 | 3300006844 | Ga0075428_100014091 | Ga0075428_1000140916 | 217 |
| 376 | 3300006844 | Ga0075428_100030606 | Ga0075428_1000306062 | 217 |
| 377 | 3300006846 | Ga0075430_100143546 | Ga0075430_1001435462 | 217 |
| 378 | 3300006880 | Ga0075429_100002894 | Ga0075429_1000028946 | 217 |
| 379 | 3300009093 | Ga0105240_10098438 | Ga0105240_100984383 | 217 |
| 380 | 3300009177 | Ga0105248_10274774 | Ga0105248_102747742 | 217 |
| 381 | 3300009551 | Ga0105238_10922743 | Ga0105238_109227432 | 217 |
| 382 | 3300009553 | Ga0105249_10000682 | Ga0105249_1000068215 | 217 |
| 383 | 3300011119 | Ga0105246_10180273 | Ga0105246_101802732 | 217 |
| 384 | 3300013102 | Ga0157371_10015667 | Ga0157371_100156672 | 217 |
| 385 | 3300013102 | Ga0157371_10028919 | Ga0157371_100289192 | 217 |
| 386 | 3300013102 | Ga0157371_10649051 | Ga0157371_106490511 | 217 |
| 387 | 3300013104 | Ga0157370_10213393 | Ga0157370_102133932 | 217 |
| 388 | 3300013104 | Ga0157370_10239682 | Ga0157370_102396822 | 217 |
| 389 | 3300013105 | Ga0157369_11220519 | Ga0157369_112205191 | 217 |
| 390 | 3300013296 | Ga0157374_10000484 | Ga0157374_1000048414 | 217 |
| 391 | 3300013297 | Ga0157378_10012007 | Ga0157378_100120077 | 217 |
| 392 | 3300013306 | Ga0163162_10000484 | Ga0163162_1000048414 | 217 |
| 393 | 3300013306 | Ga0163162_10042174 | Ga0163162_100421742 | 217 |
| 394 | 3300013306 | Ga0163162_10318361 | Ga0163162_103183611 | 217 |
| 395 | 3300013307 | Ga0157372_10059895 | Ga0157372_100598954 | 217 |
| 396 | 3300013307 | Ga0157372_10139667 | Ga0157372_101396672 | 217 |
| 397 | 3300013307 | Ga0157372_10157503 | Ga0157372_101575033 | 217 |
| 398 | 3300013307 | Ga0157372_10178779 | Ga0157372_101787792 | 217 |
| 399 | 3300013307 | Ga0157372_10254704 | Ga0157372_102547042 | 217 |
| 400 | 3300013307 | Ga0157372_10654659 | Ga0157372_106546592 | 217 |
| 401 | 3300013308 | Ga0157375_10000619 | Ga0157375_1000061914 | 217 |
| 402 | 3300014325 | Ga0163163_10000499 | Ga0163163_1000049914 | 217 |
| 403 | 3300014968 | Ga0157379_10002615 | Ga0157379_1000261514 | 217 |
| 404 | 3300014968 | Ga0157379_10100040 | Ga0157379_101000402 | 217 |
| 405 | 3300014969 | Ga0157376_10000798 | Ga0157376_100007983 | 217 |
| 406 | 3300017792 | Ga0163161_10004178 | Ga0163161_100041786 | 217 |
| 407 | 3300025315 | Ga0207697_10086330 | Ga0207697_100863303 | 217 |
| 408 | 3300025903 | Ga0207680_10011113 | Ga0207680_100111133 | 217 |
| 409 | 3300025904 | Ga0207647_10068299 | Ga0207647_100682992 | 217 |
| 410 | 3300025904 | Ga0207647_10102849 | Ga0207647_101028492 | 217 |
| 411 | 3300025907 | Ga0207645_10001476 | Ga0207645_100014765 | 217 |
| 412 | 3300025909 | Ga0207705_10006001 | Ga0207705_100060014 | 217 |
| 413 | 3300025909 | Ga0207705_10007688 | Ga0207705_100076882 | 217 |
| 414 | 3300025909 | Ga0207705_10626479 | Ga0207705_106264792 | 217 |
| 415 | 3300025913 | Ga0207695_10115674 | Ga0207695_101156742 | 217 |
| 416 | 3300025917 | Ga0207660_10002253 | Ga0207660_100022532 | 217 |
| 417 | 3300025919 | Ga0207657_10782507 | Ga0207657_107825071 | 217 |
| 418 | 3300025920 | Ga0207649_10251594 | Ga0207649_102515943 | 217 |
| 419 | 3300025921 | Ga0207652_10001570 | Ga0207652_1000157011 | 217 |
| 420 | 3300025923 | Ga0207681_10459089 | Ga0207681_104590892 | 217 |
| 421 | 3300025925 | Ga0207650_10072941 | Ga0207650_100729413 | 217 |
| 422 | 3300025926 | Ga0207659_10359430 | Ga0207659_103594302 | 217 |
| 423 | 3300025929 | Ga0207664_10234683 | Ga0207664_102346832 | 217 |
| 424 | 3300025933 | Ga0207706_10023446 | Ga0207706_100234463 | 217 |
| 425 | 3300025935 | Ga0207709_10030470 | Ga0207709_100304702 | 217 |
| 426 | 3300025940 | Ga0207691_10000549 | Ga0207691_1000054914 | 217 |
| 427 | 3300025941 | Ga0207711_10952905 | Ga0207711_109529052 | 217 |
| 428 | 3300025942 | Ga0207689_10123931 | Ga0207689_101239313 | 217 |
| 429 | 3300025949 | Ga0207667_10033964 | Ga0207667_100339642 | 217 |
| 430 | 3300025949 | Ga0207667_10072873 | Ga0207667_100728731 | 217 |
| 431 | 3300025960 | Ga0207651_10000231 | Ga0207651_100002318 | 217 |
| 432 | 3300025961 | Ga0207712_10149374 | Ga0207712_101493742 | 217 |
| 433 | 3300025972 | Ga0207668_10000639 | Ga0207668_1000063912 | 217 |
| 434 | 3300025981 | Ga0207640_10584164 | Ga0207640_105841642 | 217 |
| 435 | 3300025986 | Ga0207658_10000942 | Ga0207658_1000094215 | 217 |
| 436 | 3300026023 | Ga0207677_10001537 | Ga0207677_100015374 | 217 |
| 437 | 3300026041 | Ga0207639_10028395 | Ga0207639_100283954 | 217 |
| 438 | 3300026067 | Ga0207678_10020363 | Ga0207678_100203635 | 217 |
| 439 | 3300026067 | Ga0207678_10314757 | Ga0207678_103147572 | 217 |
| 440 | 3300026078 | Ga0207702_10021847 | Ga0207702_100218475 | 217 |
| 441 | 3300026078 | Ga0207702_10150742 | Ga0207702_101507421 | 217 |
| 442 | 3300026088 | Ga0207641_10000890 | Ga0207641_1000089013 | 217 |
| 443 | 3300026095 | Ga0207676_10011544 | Ga0207676_100115449 | 217 |
| 444 | 3300026095 | Ga0207676_10041594 | Ga0207676_100415942 | 217 |
| 445 | 3300026116 | Ga0207674_10355615 | Ga0207674_103556152 | 217 |
| 446 | 3300026121 | Ga0207683_10085831 | Ga0207683_100858313 | 217 |
| 447 | 3300026121 | Ga0207683_10465006 | Ga0207683_104650062 | 217 |
| 448 | 3300026142 | Ga0207698_10210463 | Ga0207698_102104632 | 217 |
| 449 | 3300026142 | Ga0207698_10597464 | Ga0207698_105974642 | 217 |
| 450 | 3300028379 | Ga0268266_10169385 | Ga0268266_101693852 | 217 |
| 451 | 3300028381 | Ga0268264_10001550 | Ga0268264_1000155014 | 217 |
| 452 | 3300031456 | Ga0307513_10250713 | Ga0307513_102507132 | 217 |
| 453 | 3300031616 | Ga0307508_10000490 | Ga0307508_1000049043 | 217 |
| 454 | 3300033179 | Ga0307507_10249165 | Ga0307507_102491652 | 217 |
| 455 | 3300035113 | Ga0373936_0235011 | Ga0373936_0235011_70_741 | 217 |
| 456 | 3300035725 | Ga0373947_0080417 | Ga0373947_0080417_170_841 | 217 |
| 457 | 3300037312 | Ga0395899_0012002 | Ga0395899_0012002_5490_6155 | 217 |
| 458 | 3300037312 | Ga0395899_0170733 | Ga0395899_0170733_310_975 | 217 |
| 459 | 3300037418 | Ga0395900_0065294 | Ga0395900_0065294_1458_2126 | 217 |
| 460 | 3300037418 | Ga0395900_0224964 | Ga0395900_0224964_368_1033 | 217 |
| 461 | 3300037466 | Ga0395898_0177691 | Ga0395898_0177691_1080_1745 | 217 |
| 462 | 3300037466 | Ga0395898_0343107 | Ga0395898_0343107_711_1376 | 217 |
| 463 | 3300037471 | Ga0395905_0014794 | Ga0395905_0014794_5799_6467 | 217 |
| 464 | 3300037471 | Ga0395905_0021697 | Ga0395905_0021697_371_1039 | 217 |
| 465 | 3300037471 | Ga0395905_0827533 | Ga0395905_0827533_99_767 | 217 |
| 466 | 3300038443 | Ga0395901_0181268 | Ga0395901_0181268_1074_1739 | 217 |
| 467 | 3300044901 | Ga0466960_0282646 | Ga0466960_0282646_12_677 | 217 |
| 468 | 3300046472 | Ga0495580_0096192 | Ga0495580_0096192_1174_1845 | 217 |
| 469 | 3300046517 | Ga0495630_0045267 | Ga0495630_0045267_349_1020 | 217 |
| 470 | 3300046517 | Ga0495630_0388317 | Ga0495630_0388317_305_976 | 217 |
| 471 | 3300046531 | Ga0495665_0212687 | Ga0495665_0212687_199_870 | 217 |
| 472 | 3300046543 | Ga0495645_0207332 | Ga0495645_0207332_86_757 | 217 |
| 473 | 3300046681 | Ga0495647_0111774 | Ga0495647_0111774_310_981 | 217 |
| 474 | 3300046694 | Ga0495649_0162274 | Ga0495649_0162274_329_1000 | 217 |
| 475 | 3300047319 | Ga0495674_0012685 | Ga0495674_0012685_1060_1731 | 217 |
| 476 | 3300048911 | Ga0496108_0016487 | Ga0496108_0016487_2647_3318 | 217 |
| 477 | 3300048912 | Ga0496109_0111128 | Ga0496109_0111128_1212_1883 | 217 |
| 478 | 3300049581 | Ga0501047_0629745 | Ga0501047_0629745_71_739 | 217 |
| 479 | 3300049703 | Ga0501219_000818 | Ga0501219_000818_3339_4004 | 217 |
| 480 | 3300050005 | Ga0501284_00044 | Ga0501284_00044_24710_25375 | 217 |
| 481 | 3300050508 | nmdc:mga09592_2911_c1 | nmdc:mga09592_2911_c1_6364_7035 | 217 |
| 482 | 3300053146 | Ga0500588_0007343 | Ga0500588_0007343_1260_1931 | 217 |
| 483 | 3300001979 | JGI24740J21852_10016158 | JGI24740J21852_100161582 | 218 |
| 484 | 3300005327 | Ga0070658_10032568 | Ga0070658_100325682 | 218 |
| 485 | 3300005327 | Ga0070658_10063054 | Ga0070658_100630542 | 218 |
| 486 | 3300005336 | Ga0070680_100214903 | Ga0070680_1002149032 | 218 |
| 487 | 3300005339 | Ga0070660_100001037 | Ga0070660_10000103714 | 218 |
| 488 | 3300005530 | Ga0070679_100056944 | Ga0070679_1000569442 | 218 |
| 489 | 3300005539 | Ga0068853_100028870 | Ga0068853_1000288702 | 218 |
| 490 | 3300005544 | Ga0070686_100144738 | Ga0070686_1001447382 | 218 |
| 491 | 3300005563 | Ga0068855_100196353 | Ga0068855_1001963532 | 218 |
| 492 | 3300005578 | Ga0068854_100209079 | Ga0068854_1002090792 | 218 |
| 493 | 3300005616 | Ga0068852_100099983 | Ga0068852_1000999833 | 218 |
| 494 | 3300005618 | Ga0068864_100112719 | Ga0068864_1001127192 | 218 |
| 495 | 3300005843 | Ga0068860_100060978 | Ga0068860_1000609784 | 218 |
| 496 | 3300005843 | Ga0068860_100588533 | Ga0068860_1005885331 | 218 |
| 497 | 3300009101 | Ga0105247_10024632 | Ga0105247_100246322 | 218 |
| 498 | 3300009545 | Ga0105237_10009517 | Ga0105237_100095173 | 218 |
| 499 | 3300010375 | Ga0105239_10008049 | Ga0105239_100080498 | 218 |
| 500 | 3300013102 | Ga0157371_10001864 | Ga0157371_100018642 | 218 |
| 501 | 3300013104 | Ga0157370_10138332 | Ga0157370_101383323 | 218 |
| 502 | 3300013105 | Ga0157369_10461817 | Ga0157369_104618172 | 218 |
| 503 | 3300013307 | Ga0157372_10016543 | Ga0157372_100165437 | 218 |
| 504 | 3300013307 | Ga0157372_10084335 | Ga0157372_100843352 | 218 |
| 505 | 3300013307 | Ga0157372_10100508 | Ga0157372_101005082 | 218 |
| 506 | 3300014325 | Ga0163163_10037722 | Ga0163163_100377226 | 218 |
| 507 | 3300025900 | Ga0207710_10002155 | Ga0207710_100021552 | 218 |
| 508 | 3300025904 | Ga0207647_10210896 | Ga0207647_102108962 | 218 |
| 509 | 3300025909 | Ga0207705_10026729 | Ga0207705_100267294 | 218 |
| 510 | 3300025909 | Ga0207705_10031050 | Ga0207705_100310502 | 218 |
| 511 | 3300025914 | Ga0207671_10263316 | Ga0207671_102633162 | 218 |
| 512 | 3300025917 | Ga0207660_10136772 | Ga0207660_101367722 | 218 |
| 513 | 3300025919 | Ga0207657_10028070 | Ga0207657_100280701 | 218 |
| 514 | 3300025921 | Ga0207652_10005109 | Ga0207652_100051096 | 218 |
| 515 | 3300026067 | Ga0207678_10062988 | Ga0207678_100629882 | 218 |
| 516 | 3300026078 | Ga0207702_10550843 | Ga0207702_105508432 | 218 |
| 517 | 3300026095 | Ga0207676_10089828 | Ga0207676_100898282 | 218 |
| 518 | 3300026142 | Ga0207698_10049692 | Ga0207698_100496923 | 218 |
| 519 | 3300026142 | Ga0207698_10238002 | Ga0207698_102380022 | 218 |
| 520 | 3300028380 | Ga0268265_10575091 | Ga0268265_105750911 | 218 |
| 521 | 3300047320 | Ga0495672_0156931 | Ga0495672_0156931_331_999 | 218 |
| 522 | 3300048929 | Ga0496126_0744012 | Ga0496126_0744012_37_735 | 218 |
| 523 | 3300005330 | Ga0070690_100516950 | Ga0070690_1005169501 | 219 |
| 524 | 3300005335 | Ga0070666_10563175 | Ga0070666_105631751 | 219 |
| 525 | 3300005355 | Ga0070671_100087379 | Ga0070671_1000873791 | 219 |
| 526 | 3300005367 | Ga0070667_100164843 | Ga0070667_1001648432 | 219 |
| 527 | 3300005456 | Ga0070678_100094174 | Ga0070678_1000941742 | 219 |
| 528 | 3300005718 | Ga0068866_10068426 | Ga0068866_100684262 | 219 |
| 529 | 3300005841 | Ga0068863_100105839 | Ga0068863_1001058392 | 219 |
| 530 | 3300006237 | Ga0097621_100000460 | Ga0097621_1000004605 | 219 |
| 531 | 3300006358 | Ga0068871_100000251 | Ga0068871_10000025122 | 219 |
| 532 | 3300009177 | Ga0105248_10026803 | Ga0105248_100268037 | 219 |
| 533 | 3300013104 | Ga0157370_10000405 | Ga0157370_1000040534 | 219 |
| 534 | 3300013297 | Ga0157378_10009000 | Ga0157378_100090004 | 219 |
| 535 | 3300013306 | Ga0163162_10000628 | Ga0163162_100006288 | 219 |
| 536 | 3300013308 | Ga0157375_10004383 | Ga0157375_100043839 | 219 |
| 537 | 3300014968 | Ga0157379_10038676 | Ga0157379_100386762 | 219 |
| 538 | 3300014969 | Ga0157376_10000637 | Ga0157376_100006378 | 219 |
| 539 | 3300014969 | Ga0157376_10316897 | Ga0157376_103168972 | 219 |
| 540 | 3300025921 | Ga0207652_10486875 | Ga0207652_104868751 | 219 |
| 541 | 3300025931 | Ga0207644_10025152 | Ga0207644_100251522 | 219 |
| 542 | 3300025986 | Ga0207658_10169489 | Ga0207658_101694891 | 219 |
| 543 | 3300026035 | Ga0207703_10495775 | Ga0207703_104957752 | 219 |
| 544 | 3300026088 | Ga0207641_10330686 | Ga0207641_103306862 | 219 |
| 545 | 3300026121 | Ga0207683_10123282 | Ga0207683_101232822 | 219 |
| 546 | 3300031251 | Ga0265327_10030527 | Ga0265327_100305274 | 219 |
| 547 | 3300044712 | Ga0453684_0201178 | Ga0453684_0201178_1627_2304 | 219 |
| 548 | 3300044712 | Ga0453684_0206171 | Ga0453684_0206171_283_951 | 219 |
| 549 | 3300047472 | Ga0495686_0000016 | Ga0495686_0000016_175122_175805 | 219 |
| 550 | 3300048904 | Ga0496101_0211869 | Ga0496101_0211869_103_783 | 219 |
| 551 | 3300048917 | Ga0496114_0108349 | Ga0496114_0108349_956_1636 | 219 |
| 552 | 3300003320 | rootH2_10019937 | rootH2_100199372 | 220 |
| 553 | 3300003320 | rootH2_10150472 | rootH2_101504722 | 220 |
| 554 | 3300005328 | Ga0070676_10013430 | Ga0070676_100134303 | 220 |
| 555 | 3300005331 | Ga0070670_100073976 | Ga0070670_1000739763 | 220 |
| 556 | 3300005333 | Ga0070677_10063330 | Ga0070677_100633302 | 220 |
| 557 | 3300005334 | Ga0068869_100065844 | Ga0068869_1000658442 | 220 |
| 558 | 3300005334 | Ga0068869_100183454 | Ga0068869_1001834542 | 220 |
| 559 | 3300005335 | Ga0070666_10031556 | Ga0070666_100315563 | 220 |
| 560 | 3300005336 | Ga0070680_100055462 | Ga0070680_1000554623 | 220 |
| 561 | 3300005337 | Ga0070682_100001222 | Ga0070682_10000122211 | 220 |
| 562 | 3300005338 | Ga0068868_100059709 | Ga0068868_1000597092 | 220 |
| 563 | 3300005341 | Ga0070691_10026361 | Ga0070691_100263612 | 220 |
| 564 | 3300005347 | Ga0070668_100022823 | Ga0070668_1000228232 | 220 |
| 565 | 3300005353 | Ga0070669_100126552 | Ga0070669_1001265522 | 220 |
| 566 | 3300005354 | Ga0070675_100081326 | Ga0070675_1000813262 | 220 |
| 567 | 3300005356 | Ga0070674_100048082 | Ga0070674_1000480822 | 220 |
| 568 | 3300005456 | Ga0070678_100010907 | Ga0070678_1000109074 | 220 |
| 569 | 3300005457 | Ga0070662_100140633 | Ga0070662_1001406332 | 220 |
| 570 | 3300005458 | Ga0070681_10220791 | Ga0070681_102207912 | 220 |
| 571 | 3300005530 | Ga0070679_100015932 | Ga0070679_1000159323 | 220 |
| 572 | 3300005539 | Ga0068853_100597890 | Ga0068853_1005978901 | 220 |
| 573 | 3300005543 | Ga0070672_100237554 | Ga0070672_1002375542 | 220 |
| 574 | 3300005547 | Ga0070693_100002663 | Ga0070693_1000026635 | 220 |
| 575 | 3300005548 | Ga0070665_100008316 | Ga0070665_10000831610 | 220 |
| 576 | 3300005617 | Ga0068859_100223243 | Ga0068859_1002232432 | 220 |
| 577 | 3300005718 | Ga0068866_10014051 | Ga0068866_100140513 | 220 |
| 578 | 3300005719 | Ga0068861_100044777 | Ga0068861_1000447772 | 220 |
| 579 | 3300005719 | Ga0068861_100596444 | Ga0068861_1005964441 | 220 |
| 580 | 3300005840 | Ga0068870_10019937 | Ga0068870_100199374 | 220 |
| 581 | 3300005844 | Ga0068862_100097194 | Ga0068862_1000971942 | 220 |
| 582 | 3300006358 | Ga0068871_100020152 | Ga0068871_1000201522 | 220 |
| 583 | 3300006358 | Ga0068871_100242241 | Ga0068871_1002422411 | 220 |
| 584 | 3300006931 | Ga0097620_100223244 | Ga0097620_1002232442 | 220 |
| 585 | 3300009093 | Ga0105240_10018228 | Ga0105240_100182285 | 220 |
| 586 | 3300009098 | Ga0105245_10315943 | Ga0105245_103159432 | 220 |
| 587 | 3300009174 | Ga0105241_10003487 | Ga0105241_100034874 | 220 |
| 588 | 3300009174 | Ga0105241_10152420 | Ga0105241_101524202 | 220 |
| 589 | 3300009176 | Ga0105242_10014893 | Ga0105242_100148936 | 220 |
| 590 | 3300009545 | Ga0105237_10138759 | Ga0105237_101387592 | 220 |
| 591 | 3300009553 | Ga0105249_10014917 | Ga0105249_100149172 | 220 |
| 592 | 3300009553 | Ga0105249_10384826 | Ga0105249_103848262 | 220 |
| 593 | 3300011119 | Ga0105246_10031485 | Ga0105246_100314854 | 220 |
| 594 | 3300013104 | Ga0157370_10033633 | Ga0157370_100336332 | 220 |
| 595 | 3300013296 | Ga0157374_10171333 | Ga0157374_101713332 | 220 |
| 596 | 3300013297 | Ga0157378_10065592 | Ga0157378_100655923 | 220 |
| 597 | 3300025315 | Ga0207697_10183104 | Ga0207697_101831042 | 220 |
| 598 | 3300025899 | Ga0207642_10047437 | Ga0207642_100474372 | 220 |
| 599 | 3300025901 | Ga0207688_10033949 | Ga0207688_100339493 | 220 |
| 600 | 3300025907 | Ga0207645_10003649 | Ga0207645_100036496 | 220 |
| 601 | 3300025908 | Ga0207643_10036158 | Ga0207643_100361582 | 220 |
| 602 | 3300025911 | Ga0207654_10001573 | Ga0207654_100015739 | 220 |
| 603 | 3300025911 | Ga0207654_10172542 | Ga0207654_101725422 | 220 |
| 604 | 3300025912 | Ga0207707_10001470 | Ga0207707_100014707 | 220 |
| 605 | 3300025913 | Ga0207695_10031739 | Ga0207695_100317394 | 220 |
| 606 | 3300025917 | Ga0207660_10004358 | Ga0207660_100043583 | 220 |
| 607 | 3300025921 | Ga0207652_10001229 | Ga0207652_100012299 | 220 |
| 608 | 3300025923 | Ga0207681_10481851 | Ga0207681_104818511 | 220 |
| 609 | 3300025925 | Ga0207650_10380617 | Ga0207650_103806172 | 220 |
| 610 | 3300025934 | Ga0207686_10246624 | Ga0207686_102466242 | 220 |
| 611 | 3300025935 | Ga0207709_10305725 | Ga0207709_103057252 | 220 |
| 612 | 3300025938 | Ga0207704_10233363 | Ga0207704_102333632 | 220 |
| 613 | 3300025940 | Ga0207691_10231686 | Ga0207691_102316862 | 220 |
| 614 | 3300025942 | Ga0207689_10007988 | Ga0207689_100079885 | 220 |
| 615 | 3300025942 | Ga0207689_10035131 | Ga0207689_100351313 | 220 |
| 616 | 3300025961 | Ga0207712_10012826 | Ga0207712_100128265 | 220 |
| 617 | 3300026023 | Ga0207677_10389101 | Ga0207677_103891011 | 220 |
| 618 | 3300026089 | Ga0207648_10001186 | Ga0207648_1000118621 | 220 |
| 619 | 3300026121 | Ga0207683_10003156 | Ga0207683_100031568 | 220 |
| 620 | 3300028381 | Ga0268264_10037060 | Ga0268264_100370602 | 220 |
| 621 | 3300031456 | Ga0307513_10415778 | Ga0307513_104157781 | 220 |
| 622 | 3300031548 | Ga0307408_100732139 | Ga0307408_1007321392 | 220 |
| 623 | 3300049744 | Ga0501083_0321259 | Ga0501083_0321259_35_703 | 220 |
| 624 | 3300005327 | Ga0070658_10000014 | Ga0070658_10000014155 | 221 |
| 625 | 3300005339 | Ga0070660_100023582 | Ga0070660_1000235825 | 221 |
| 626 | 3300005530 | Ga0070679_100301102 | Ga0070679_1003011022 | 221 |
| 627 | 3300005539 | Ga0068853_100225022 | Ga0068853_1002250222 | 221 |
| 628 | 3300009545 | Ga0105237_10000261 | Ga0105237_1000026136 | 221 |
| 629 | 3300025909 | Ga0207705_10000107 | Ga0207705_1000010712 | 221 |
| 630 | 3300025914 | Ga0207671_10003003 | Ga0207671_100030038 | 221 |
| 631 | 3300025960 | Ga0207651_10461794 | Ga0207651_104617941 | 221 |
| 632 | 3300026041 | Ga0207639_10452397 | Ga0207639_104523972 | 221 |
| 633 | 3300028381 | Ga0268264_10374119 | Ga0268264_103741192 | 221 |
| 634 | 3300033180 | Ga0307510_10001453 | Ga0307510_100014538 | 221 |
| 635 | 3300035115 | Ga0373941_0002433 | Ga0373941_0002433_935_1609 | 221 |
| 636 | 3300046684 | Ga0495669_0156570 | Ga0495669_0156570_290_964 | 221 |
| 637 | 3300049568 | Ga0501031_0004805 | Ga0501031_0004805_7271_7939 | 221 |
| 638 | 3300049572 | Ga0501036_0029052 | Ga0501036_0029052_2057_2725 | 221 |
| 639 | 3300049574 | Ga0501038_0015516 | Ga0501038_0015516_2817_3485 | 221 |
| 640 | 3300049579 | Ga0501043_0009411 | Ga0501043_0009411_6876_7544 | 221 |
| 641 | 3300049581 | Ga0501047_0093282 | Ga0501047_0093282_682_1350 | 221 |
| 642 | 3300049822 | Ga0501035_0023385 | Ga0501035_0023385_3537_4205 | 221 |
| 643 | 3300049823 | Ga0501044_0020539 | Ga0501044_0020539_553_1221 | 221 |
| 644 | 3300053136 | Ga0500559_0088846 | Ga0500559_0088846_272_949 | 221 |
| 645 | 3300053730 | Ga0500645_018744 | Ga0500645_018744_1159_1839 | 221 |
| 646 | 3300003316 | rootH1_10018315 | rootH1_100183153 | 222 |
| 647 | 3300005563 | Ga0068855_100713693 | Ga0068855_1007136931 | 222 |
| 648 | 3300009093 | Ga0105240_10297840 | Ga0105240_102978402 | 222 |
| 649 | 3300013296 | Ga0157374_10008038 | Ga0157374_100080389 | 222 |
| 650 | 3300025913 | Ga0207695_10436891 | Ga0207695_104368911 | 222 |
| 651 | 3300025941 | Ga0207711_10022613 | Ga0207711_100226132 | 222 |
| 652 | 3300001904 | JGI24736J21556_1009994 | JGI24736J21556_10099942 | 223 |
| 653 | 3300001990 | JGI24737J22298_10010438 | JGI24737J22298_100104383 | 223 |
| 654 | 3300003320 | rootH2_10005336 | rootH2_1000533686 | 223 |
| 655 | 3300003320 | rootH2_10181826 | rootH2_101818261 | 223 |
| 656 | 3300005327 | Ga0070658_10341556 | Ga0070658_103415562 | 223 |
| 657 | 3300005355 | Ga0070671_100031152 | Ga0070671_1000311524 | 223 |
| 658 | 3300005457 | Ga0070662_100000014 | Ga0070662_10000001470 | 223 |
| 659 | 3300005548 | Ga0070665_100000032 | Ga0070665_100000032178 | 223 |
| 660 | 3300005614 | Ga0068856_100292618 | Ga0068856_1002926182 | 223 |
| 661 | 3300005842 | Ga0068858_100486660 | Ga0068858_1004866602 | 223 |
| 662 | 3300009093 | Ga0105240_10018900 | Ga0105240_100189007 | 223 |
| 663 | 3300009093 | Ga0105240_10116878 | Ga0105240_101168783 | 223 |
| 664 | 3300009174 | Ga0105241_10015592 | Ga0105241_100155926 | 223 |
| 665 | 3300009551 | Ga0105238_10013714 | Ga0105238_100137145 | 223 |
| 666 | 3300010375 | Ga0105239_10093479 | Ga0105239_100934794 | 223 |
| 667 | 3300011119 | Ga0105246_10062759 | Ga0105246_100627592 | 223 |
| 668 | 3300013100 | Ga0157373_10015926 | Ga0157373_100159267 | 223 |
| 669 | 3300013102 | Ga0157371_10098809 | Ga0157371_100988092 | 223 |
| 670 | 3300013105 | Ga0157369_10180026 | Ga0157369_101800261 | 223 |
| 671 | 3300013296 | Ga0157374_10000365 | Ga0157374_1000036534 | 223 |
| 672 | 3300013306 | Ga0163162_10000010 | Ga0163162_10000010283 | 223 |
| 673 | 3300013307 | Ga0157372_10031424 | Ga0157372_100314245 | 223 |
| 674 | 3300013308 | Ga0157375_10002043 | Ga0157375_100020438 | 223 |
| 675 | 3300021361 | Ga0213872_10101251 | Ga0213872_101012511 | 223 |
| 676 | 3300025904 | Ga0207647_10031534 | Ga0207647_100315342 | 223 |
| 677 | 3300025911 | Ga0207654_10038862 | Ga0207654_100388622 | 223 |
| 678 | 3300025913 | Ga0207695_10009594 | Ga0207695_1000959410 | 223 |
| 679 | 3300025913 | Ga0207695_10021017 | Ga0207695_100210176 | 223 |
| 680 | 3300025914 | Ga0207671_10010262 | Ga0207671_100102625 | 223 |
| 681 | 3300025931 | Ga0207644_10005751 | Ga0207644_100057512 | 223 |
| 682 | 3300025933 | Ga0207706_10000057 | Ga0207706_1000005766 | 223 |
| 683 | 3300025933 | Ga0207706_10108370 | Ga0207706_101083702 | 223 |
| 684 | 3300025949 | Ga0207667_10013351 | Ga0207667_100133512 | 223 |
| 685 | 3300028379 | Ga0268266_10000030 | Ga0268266_10000030152 | 223 |
| 686 | 3300030521 | Ga0307511_10018245 | Ga0307511_100182452 | 223 |
| 687 | 3300037312 | Ga0395899_0002241 | Ga0395899_0002241_14845_15525 | 223 |
| 688 | 3300037418 | Ga0395900_0000143 | Ga0395900_0000143_29755_30435 | 223 |
| 689 | 3300037418 | Ga0395900_0000284 | Ga0395900_0000284_11832_12512 | 223 |
| 690 | 3300037418 | Ga0395900_0599043 | Ga0395900_0599043_37_717 | 223 |
| 691 | 3300037466 | Ga0395898_0269051 | Ga0395898_0269051_221_901 | 223 |
| 692 | 3300037471 | Ga0395905_0000045 | Ga0395905_0000045_240477_241157 | 223 |
| 693 | 3300039447 | Ga0436361_0924736 | Ga0436361_0924736_6139_6819 | 223 |
| 694 | 3300046506 | Ga0495583_0098522 | Ga0495583_0098522_247_927 | 223 |
| 695 | 3300046518 | Ga0495631_0003227 | Ga0495631_0003227_6755_7435 | 223 |
| 696 | 3300046660 | Ga0495625_0253327 | Ga0495625_0253327_359_1039 | 223 |
| 697 | 3300047443 | Ga0495687_006354 | Ga0495687_006354_3582_4262 | 223 |
| 698 | 3300053122 | Ga0500608_016510 | Ga0500608_016510_1707_2387 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rag-assembly2.cif.gz_B | crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 | 0.3645 | 104 | 177 |
| 3a5z-assembly2.cif.gz_G | crystal structure of escherichia coli genx in complex with elongation factor p | 0.3404 | 118 | 168 |
| 3rag-assembly1.cif.gz_A | crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 | 0.3212 | 87 | 177 |
| 5eys-assembly1.cif.gz_A | crystal structure of murine neuroglobin mutant f106w at ambient pressure | 0.2802 | 51 | 172 |
| 5eet-assembly1.cif.gz_A | crystal structure of murine neuroglobin at ambient pressure | 0.2736 | 51 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1Z856_198_303_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.328 | 92 | 174 | 1.10.287.70 |
| af_P0A769_38_384_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.2893 | 51 | 188 | 1.20.1740.10 |
| af_Q12981_1_132_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.2861 | 47 | 183 | 1.20.58.70 |
| af_A1Z856_198_303_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.273 | 92 | 174 | 1.10.287.70 |
| af_Q4CNP1_460_605_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.2696 | 48 | 172 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9KGY0-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9182 | 59 | 190 |
|
| AF-A0A2V9IIK3-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.896 | 88 | 189 |
|
| AF-A0A2E0N6S3-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8957 | 60 | 189 |
|
| AF-A0A2V9QQB0-F1-model_v4 | Transcriptional initiation protein Tat | 0.8949 | 63 | 197 |
|
| AF-A0A2E1P5L9-F1-model_v4 | Uncharacterized protein | 0.8908 | 46 | 191 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar