F475988

General Info

Members Datasets Scaffolds Average Seq Length
698 309 696 223

Family's Representative Sequence

Representative Sequence 3300049705|Ga0501225_0048116|Ga0501225_0048116_255_1049
Length 264
Sequence MRCATLAFDIEGKCGTPGKFTSTFKSFHIMDRRKSLKTIAVGALSAGMLLDACKTDDKKKGDAKAAEPGAQLTLDRAEEEKLREKELLSTKFFTDHEMATITVLADIIIPRDDVSGSASDAKVPDFIEFMVKDRPENQIPMRGGLRWLDIQSLKRFEKSFVDCDAKQRLNIVDDIAYPEITYKDEKGNKVTKGKKPNPELAQGVAFFNLMRDLTASGFYTSEIGVKDIAYAGNTPNKWNGVPDDVLKQYGLAYSEREMKECAKY

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
265 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
266 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
267 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
268 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
269 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
270 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
271 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
272 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
273 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
274 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
277 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
282 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
283 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
284 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
296 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
300 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
304 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
307 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.72
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.44
Nodule 0
Rhizoplane 1
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009994 3300001904 Bacteria 1556
2 JGI24736J21556_1017643 3300001904 Unclassified 1132
3 JGI24740J21852_10016158 3300001979 Bacteria 2704
4 JGI24737J22298_10010438 3300001990 Bacteria 3065
5 JGI24751J29686_10002883 3300002459 Bacteria 3467
6 rootH1_10018315 3300003316 Bacteria 2490
7 rootH1_10026206 3300003316 Bacteria 9776
8 rootH2_10005336 3300003320 Bacteria 90063
9 rootH2_10013162 3300003320 Bacteria 43068
10 rootH2_10019937 3300003320 Bacteria 1694
11 rootH2_10150472 3300003320 Bacteria 1255
12 rootH2_10181826 3300003320 Bacteria 1529
13 rootL2_10057324 3300003322 Unclassified 2606
14 rootL2_10075832 3300003322 Bacteria 2374
15 rootL2_10153257 3300003322 Bacteria 1750
16 rootL2_10173807 3300003322 Bacteria 2103
17 rootL2_10251069 3300003322 Bacteria 1484
18 rootL2_10363313 3300003322 Bacteria 1126
19 rootH1_10015461 3300003323 Bacteria 18908
20 rootH1_10176585 3300003323 Bacteria 4704
21 rootH1_10197827 3300003323 Bacteria 1632
22 Ga0058863_10172141 3300004799 Bacteria 4307
23 Ga0058861_11885956 3300004800 Bacteria 3753
24 Ga0058862_12637711 3300004803 Bacteria 3965
25 Ga0070658_10000014 3300005327 Bacteria 244978
26 Ga0070658_10000363 3300005327 Bacteria 39460
27 Ga0070658_10032568 3300005327 Bacteria 4191
28 Ga0070658_10039535 3300005327 Bacteria 3805
29 Ga0070658_10057120 3300005327 Bacteria 3174
30 Ga0070658_10063054 3300005327 Bacteria 3021
31 Ga0070658_10341556 3300005327 Bacteria 1281
32 Ga0070676_10000103 3300005328 Bacteria 30434
33 Ga0070676_10013430 3300005328 Bacteria 4489
34 Ga0070676_10167743 3300005328 Bacteria 1418
35 Ga0070683_100053211 3300005329 Bacteria 3751
36 Ga0070683_100060211 3300005329 Bacteria 3528
37 Ga0070690_100061461 3300005330 Unclassified 2420
38 Ga0070690_100516950 3300005330 Bacteria 895
39 Ga0070670_100040709 3300005331 Bacteria 3994
40 Ga0070670_100073976 3300005331 Bacteria 2926
41 Ga0070677_10063330 3300005333 Unclassified 1533
42 Ga0068869_100065844 3300005334 Bacteria 2668
43 Ga0068869_100107275 3300005334 Bacteria 2120
44 Ga0068869_100183454 3300005334 Unclassified 1642
45 Ga0068869_100557115 3300005334 Bacteria 964
46 Ga0070666_10009574 3300005335 Bacteria 6046
47 Ga0070666_10031556 3300005335 Bacteria 3497
48 Ga0070666_10563175 3300005335 Unclassified 829
49 Ga0070680_100002416 3300005336 Bacteria 13834
50 Ga0070680_100005626 3300005336 Bacteria 9493
51 Ga0070680_100055462 3300005336 Unclassified 3238
52 Ga0070680_100190324 3300005336 Bacteria 1729
53 Ga0070680_100214903 3300005336 Bacteria 1622
54 Ga0070680_100274768 3300005336 Unclassified 1427
55 Ga0070682_100001222 3300005337 Bacteria 14625
56 Ga0070682_100016869 3300005337 Bacteria 4251
57 Ga0068868_100000358 3300005338 Bacteria 30970
58 Ga0068868_100059709 3300005338 Bacteria 3017
59 Ga0068868_100092748 3300005338 Bacteria 2434
60 Ga0070660_100001037 3300005339 Bacteria 18678
61 Ga0070660_100023582 3300005339 Bacteria 4559
62 Ga0070660_100871196 3300005339 Bacteria 759
63 Ga0070689_100654252 3300005340 Bacteria 914
64 Ga0070691_10026361 3300005341 Unclassified 2709
65 Ga0070687_100005535 3300005343 Bacteria 5121
66 Ga0070661_100057865 3300005344 Bacteria 2840
67 Ga0070661_100096260 3300005344 Bacteria 2196
68 Ga0070668_100000308 3300005347 Bacteria 32201
69 Ga0070668_100022823 3300005347 Bacteria 4730
70 Ga0070668_100697232 3300005347 Bacteria 895
71 Ga0070669_100126552 3300005353 Bacteria 1955
72 Ga0070675_100015362 3300005354 Bacteria 6051
73 Ga0070675_100081326 3300005354 Bacteria 2701
74 Ga0070675_100409833 3300005354 Bacteria 1210
75 Ga0070671_100031152 3300005355 Bacteria 4405
76 Ga0070671_100087379 3300005355 Unclassified 2609
77 Ga0070671_100255037 3300005355 Bacteria 1490
78 Ga0070674_100048082 3300005356 Bacteria 2926
79 Ga0070674_100322107 3300005356 Bacteria 1239
80 Ga0070673_100000232 3300005364 Bacteria 27904
81 Ga0070673_100051840 3300005364 Bacteria 3216
82 Ga0070673_100330898 3300005364 Bacteria 1348
83 Ga0070659_100012341 3300005366 Bacteria 6332
84 Ga0070659_100060941 3300005366 Bacteria 2981
85 Ga0070667_100000583 3300005367 Bacteria 36093
86 Ga0070667_100071055 3300005367 Unclassified 2964
87 Ga0070667_100164843 3300005367 Bacteria 1954
88 Ga0070667_100223154 3300005367 Bacteria 1678
89 Ga0070701_10081726 3300005438 Bacteria 1751
90 Ga0070663_100088748 3300005455 Bacteria 2287
91 Ga0070663_100296502 3300005455 Bacteria 1293
92 Ga0070678_100010907 3300005456 Bacteria 5576
93 Ga0070678_100061345 3300005456 Bacteria 2771
94 Ga0070678_100094174 3300005456 Unclassified 2305
95 Ga0070678_100170806 3300005456 Bacteria 1771
96 Ga0070678_100250511 3300005456 Bacteria 1485
97 Ga0070662_100000014 3300005457 Bacteria 110124
98 Ga0070662_100002472 3300005457 Bacteria 11382
99 Ga0070662_100003765 3300005457 Bacteria 9490
100 Ga0070662_100140633 3300005457 Unclassified 1870
101 Ga0070681_10014298 3300005458 Bacteria 7896
102 Ga0070681_10220791 3300005458 Unclassified 1810
103 Ga0070681_10498956 3300005458 Bacteria 1130
104 Ga0068867_100047251 3300005459 Unclassified 3164
105 Ga0070698_100027024 3300005471 Bacteria 5968
106 Ga0070698_100157563 3300005471 Bacteria 2216
107 Ga0070679_100006085 3300005530 Bacteria 11225
108 Ga0070679_100015932 3300005530 Bacteria 7237
109 Ga0070679_100056944 3300005530 Bacteria 3895
110 Ga0070679_100192443 3300005530 Bacteria 2008
111 Ga0070679_100249780 3300005530 Bacteria 1730
112 Ga0070679_100301102 3300005530 Bacteria 1554
113 Ga0070684_100000251 3300005535 Bacteria 37139
114 Ga0070684_100056185 3300005535 Bacteria 3434
115 Ga0068853_100015341 3300005539 Bacteria 6296
116 Ga0068853_100028870 3300005539 Bacteria 4670
117 Ga0068853_100053211 3300005539 Bacteria 3486
118 Ga0068853_100225022 3300005539 Bacteria 1715
119 Ga0068853_100597890 3300005539 Unclassified 1047
120 Ga0068853_101089999 3300005539 Bacteria 770
121 Ga0070672_100000345 3300005543 Bacteria 26753
122 Ga0070672_100237554 3300005543 Unclassified 1532
123 Ga0070686_100144738 3300005544 Bacteria 1658
124 Ga0070693_100002663 3300005547 Bacteria 8220
125 Ga0070693_100352257 3300005547 Bacteria 1008
126 Ga0070665_100000032 3300005548 Bacteria 333352
127 Ga0070665_100004255 3300005548 Bacteria 15056
128 Ga0070665_100008316 3300005548 Bacteria 10494
129 Ga0070665_100515444 3300005548 Bacteria 1207
130 Ga0070665_100889998 3300005548 Unclassified 903
131 Ga0068855_100000631 3300005563 Bacteria 43172
132 Ga0068855_100004470 3300005563 Bacteria 17094
133 Ga0068855_100015513 3300005563 Bacteria 9172
134 Ga0068855_100046876 3300005563 Bacteria 5108
135 Ga0068855_100156908 3300005563 Bacteria 2585
136 Ga0068855_100196353 3300005563 Bacteria 2273
137 Ga0068855_100404665 3300005563 Bacteria 1495
138 Ga0068855_100413422 3300005563 Bacteria 1476
139 Ga0068855_100713693 3300005563 Bacteria 1072
140 Ga0070664_100123343 3300005564 Bacteria 2270
141 Ga0070664_100440844 3300005564 Unclassified 1195
142 Ga0068857_100018099 3300005577 Bacteria 6180
143 Ga0068857_100057738 3300005577 Bacteria 3445
144 Ga0068857_100114700 3300005577 Bacteria 2423
145 Ga0068854_100209079 3300005578 Bacteria 1538
146 Ga0068856_100037746 3300005614 Bacteria 4740
147 Ga0068856_100058387 3300005614 Bacteria 3810
148 Ga0068856_100126917 3300005614 Bacteria 2554
149 Ga0068856_100277262 3300005614 Bacteria 1693
150 Ga0068856_100292618 3300005614 Bacteria 1645
151 Ga0068852_100007007 3300005616 Bacteria 8206
152 Ga0068852_100099983 3300005616 Bacteria 2616
153 Ga0068852_100458321 3300005616 Bacteria 1263
154 Ga0068852_100659415 3300005616 Bacteria 1054
155 Ga0068852_101156020 3300005616 Unclassified 795
156 Ga0068859_100223243 3300005617 Bacteria 1972
157 Ga0068864_100004460 3300005618 Bacteria 11503
158 Ga0068864_100008678 3300005618 Bacteria 8387
159 Ga0068864_100112719 3300005618 Bacteria 2424
160 Ga0068864_100436712 3300005618 Bacteria 1250
161 Ga0068866_10014051 3300005718 Bacteria 3526
162 Ga0068866_10068426 3300005718 Bacteria 1867
163 Ga0068861_100044777 3300005719 Bacteria 3329
164 Ga0068861_100596444 3300005719 Unclassified 1013
165 Ga0068851_10010581 3300005834 Bacteria 4308
166 Ga0068851_10044146 3300005834 Bacteria 2249
167 Ga0068851_10092301 3300005834 Bacteria 1595
168 Ga0068870_10019937 3300005840 Bacteria 3258
169 Ga0068870_10369972 3300005840 Unclassified 925
170 Ga0068863_100001439 3300005841 Bacteria 23604
171 Ga0068863_100105839 3300005841 Bacteria 2676
172 Ga0068858_100005079 3300005842 Bacteria 12897
173 Ga0068858_100486660 3300005842 Bacteria 1191
174 Ga0068858_100744799 3300005842 Unclassified 954
175 Ga0068860_100000662 3300005843 Bacteria 39938
176 Ga0068860_100060978 3300005843 Bacteria 3584
177 Ga0068860_100588533 3300005843 Bacteria 1117
178 Ga0068862_100097194 3300005844 Bacteria 2571
179 Ga0081539_10001220 3300005985 Bacteria 45919
180 Ga0081539_10018402 3300005985 Unclassified 4850
181 Ga0075366_10070576 3300006195 Bacteria 2081
182 Ga0075366_10319867 3300006195 Bacteria 950
183 Ga0097621_100000460 3300006237 Bacteria 28549
184 Ga0097621_100002379 3300006237 Bacteria 12896
185 Ga0068871_100000251 3300006358 Bacteria 37472
186 Ga0068871_100020152 3300006358 Bacteria 5103
187 Ga0068871_100028768 3300006358 Bacteria 4360
188 Ga0068871_100101575 3300006358 Bacteria 2410
189 Ga0068871_100242241 3300006358 Bacteria 1568
190 Ga0075428_100014091 3300006844 Bacteria 8894
191 Ga0075428_100030606 3300006844 Bacteria 5951
192 Ga0075428_100542658 3300006844 Bacteria 1243
193 Ga0075430_100143546 3300006846 Bacteria 1988
194 Ga0075434_100064367 3300006871 Bacteria 3651
195 Ga0075429_100002894 3300006880 Bacteria 14550
196 Ga0075436_100113601 3300006914 Bacteria 1891
197 Ga0097620_100223244 3300006931 Bacteria 1972
198 Ga0105240_10018228 3300009093 Bacteria 9436
199 Ga0105240_10018900 3300009093 Bacteria 9228
200 Ga0105240_10098438 3300009093 Bacteria 3562
201 Ga0105240_10116878 3300009093 Bacteria 3217
202 Ga0105240_10297840 3300009093 Bacteria 1846
203 Ga0105240_10629514 3300009093 Bacteria 1178
204 Ga0111539_10001678 3300009094 Bacteria 29521
205 Ga0111539_10006564 3300009094 Bacteria 14990
206 Ga0111539_10193845 3300009094 Bacteria 2370
207 Ga0105245_10315943 3300009098 Unclassified 1537
208 Ga0105247_10024632 3300009101 Bacteria 3627
209 Ga0114129_10005512 3300009147 Bacteria 17896
210 Ga0114129_10729842 3300009147 Bacteria 1270
211 Ga0105241_10003487 3300009174 Bacteria 11699
212 Ga0105241_10015592 3300009174 Bacteria 5569
213 Ga0105241_10107885 3300009174 Bacteria 2225
214 Ga0105241_10152420 3300009174 Unclassified 1892
215 Ga0105242_10014893 3300009176 Bacteria 6026
216 Ga0105242_10369030 3300009176 Bacteria 1331
217 Ga0105248_10026803 3300009177 Bacteria 6410
218 Ga0105248_10274774 3300009177 Bacteria 1897
219 Ga0105248_11103629 3300009177 Bacteria 897
220 Ga0105248_11402990 3300009177 Bacteria 790
221 Ga0105237_10000261 3300009545 Bacteria 74745
222 Ga0105237_10009517 3300009545 Bacteria 10405
223 Ga0105237_10138759 3300009545 Unclassified 2426
224 Ga0105237_10566965 3300009545 Bacteria 1142
225 Ga0105237_10883440 3300009545 Unclassified 901
226 Ga0105238_10013714 3300009551 Bacteria 8187
227 Ga0105238_10922743 3300009551 Bacteria 892
228 Ga0105249_10000682 3300009553 Bacteria 30897
229 Ga0105249_10002393 3300009553 Bacteria 16288
230 Ga0105249_10014917 3300009553 Bacteria 6874
231 Ga0105249_10170008 3300009553 Bacteria 2113
232 Ga0105249_10384826 3300009553 Unclassified 1430
233 Ga0105239_10008049 3300010375 Bacteria 12033
234 Ga0105239_10014100 3300010375 Bacteria 8872
235 Ga0105239_10093479 3300010375 Bacteria 3320
236 Ga0105246_10031485 3300011119 Bacteria 3511
237 Ga0105246_10062759 3300011119 Bacteria 2589
238 Ga0105246_10180273 3300011119 Bacteria 1626
239 Ga0157373_10000978 3300013100 Bacteria 22107
240 Ga0157373_10004999 3300013100 Bacteria 9961
241 Ga0157373_10015926 3300013100 Bacteria 5490
242 Ga0157371_10001061 3300013102 Bacteria 30053
243 Ga0157371_10001864 3300013102 Bacteria 21109
244 Ga0157371_10007347 3300013102 Bacteria 8932
245 Ga0157371_10015667 3300013102 Bacteria 5678
246 Ga0157371_10028919 3300013102 Bacteria 4013
247 Ga0157371_10098809 3300013102 Bacteria 2070
248 Ga0157371_10649051 3300013102 Bacteria 787
249 Ga0157370_10000405 3300013104 Bacteria 54383
250 Ga0157370_10033633 3300013104 Unclassified 4998
251 Ga0157370_10061449 3300013104 Bacteria 3566
252 Ga0157370_10073871 3300013104 Bacteria 3217
253 Ga0157370_10099357 3300013104 Bacteria 2728
254 Ga0157370_10138332 3300013104 Bacteria 2269
255 Ga0157370_10213393 3300013104 Bacteria 1789
256 Ga0157370_10239682 3300013104 Bacteria 1678
257 Ga0157370_10333429 3300013104 Bacteria 1398
258 Ga0157369_10052946 3300013105 Unclassified 4389
259 Ga0157369_10056016 3300013105 Bacteria 4254
260 Ga0157369_10180026 3300013105 Bacteria 2224
261 Ga0157369_10461817 3300013105 Bacteria 1315
262 Ga0157369_11220519 3300013105 Unclassified 767
263 Ga0157374_10000365 3300013296 Bacteria 41708
264 Ga0157374_10000484 3300013296 Bacteria 36020
265 Ga0157374_10008038 3300013296 Bacteria 9017
266 Ga0157374_10064307 3300013296 Bacteria 3442
267 Ga0157374_10089978 3300013296 Bacteria 2925
268 Ga0157374_10171333 3300013296 Bacteria 2117
269 Ga0157378_10005392 3300013297 Bacteria 11214
270 Ga0157378_10009000 3300013297 Bacteria 8693
271 Ga0157378_10012007 3300013297 Bacteria 7583
272 Ga0157378_10017995 3300013297 Bacteria 6203
273 Ga0157378_10031792 3300013297 Bacteria 4661
274 Ga0157378_10040863 3300013297 Bacteria 4114
275 Ga0157378_10065592 3300013297 Bacteria 3250
276 Ga0157378_11404986 3300013297 Bacteria 741
277 Ga0163162_10000010 3300013306 Bacteria 302032
278 Ga0163162_10000484 3300013306 Bacteria 36942
279 Ga0163162_10000628 3300013306 Bacteria 32760
280 Ga0163162_10007383 3300013306 Bacteria 10689
281 Ga0163162_10042174 3300013306 Unclassified 4566
282 Ga0163162_10318361 3300013306 Bacteria 1688
283 Ga0163162_10356335 3300013306 Bacteria 1596
284 Ga0163162_10895910 3300013306 Bacteria 1000
285 Ga0163162_10953408 3300013306 Bacteria 969
286 Ga0157372_10000182 3300013307 Bacteria 69439
287 Ga0157372_10016543 3300013307 Bacteria 7914
288 Ga0157372_10031424 3300013307 Bacteria 5814
289 Ga0157372_10051844 3300013307 Unclassified 4567
290 Ga0157372_10059895 3300013307 Bacteria 4260
291 Ga0157372_10084335 3300013307 Bacteria 3601
292 Ga0157372_10100508 3300013307 Bacteria 3300
293 Ga0157372_10139667 3300013307 Bacteria 2790
294 Ga0157372_10157503 3300013307 Bacteria 2624
295 Ga0157372_10178779 3300013307 Unclassified 2456
296 Ga0157372_10193797 3300013307 Bacteria 2354
297 Ga0157372_10254704 3300013307 Bacteria 2038
298 Ga0157372_10415907 3300013307 Unclassified 1567
299 Ga0157372_10654659 3300013307 Bacteria 1223
300 Ga0157375_10000619 3300013308 Bacteria 31534
301 Ga0157375_10002043 3300013308 Bacteria 17408
302 Ga0157375_10004383 3300013308 Bacteria 12257
303 Ga0157375_10034881 3300013308 Bacteria 4796
304 Ga0157375_11366032 3300013308 Bacteria 834
305 Ga0163163_10000499 3300014325 Bacteria 35349
306 Ga0163163_10037722 3300014325 Bacteria 4703
307 Ga0163163_10348328 3300014325 Bacteria 1537
308 Ga0163163_10539952 3300014325 Bacteria 1228
309 Ga0157380_10004725 3300014326 Bacteria 9480
310 Ga0157380_10097921 3300014326 Bacteria 2435
311 Ga0157380_10164705 3300014326 Unclassified 1931
312 Ga0157377_10411294 3300014745 Bacteria 924
313 Ga0157379_10002615 3300014968 Bacteria 15134
314 Ga0157379_10038676 3300014968 Unclassified 4256
315 Ga0157379_10100040 3300014968 Unclassified 2603
316 Ga0157376_10000637 3300014969 Bacteria 22720
317 Ga0157376_10000798 3300014969 Bacteria 20658
318 Ga0157376_10316897 3300014969 Bacteria 1481
319 Ga0163161_10000230 3300017792 Bacteria 51536
320 Ga0163161_10004178 3300017792 Bacteria 10086
321 Ga0163161_10097798 3300017792 Unclassified 2180
322 Ga0206351_10160225 3300020077 Bacteria 932
323 Ga0213872_10101251 3300021361 Bacteria 1284
324 Ga0213876_10186190 3300021384 Bacteria 1104
325 Ga0209646_1000837 3300025246 Bacteria 10362
326 Ga0209257_1000006 3300025304 Bacteria 1570111
327 Ga0207697_10086330 3300025315 Bacteria 1326
328 Ga0207697_10183104 3300025315 Bacteria 918
329 Ga0207682_10243175 3300025893 Bacteria 837
330 Ga0207642_10047437 3300025899 Bacteria 1920
331 Ga0207642_10218472 3300025899 Unclassified 1064
332 Ga0207710_10002155 3300025900 Bacteria 9259
333 Ga0207688_10021329 3300025901 Unclassified 3538
334 Ga0207688_10033949 3300025901 Bacteria 2823
335 Ga0207688_10409916 3300025901 Bacteria 841
336 Ga0207680_10011113 3300025903 Bacteria 4535
337 Ga0207680_10080441 3300025903 Bacteria 2046
338 Ga0207680_10575727 3300025903 Bacteria 805
339 Ga0207647_10000045 3300025904 Bacteria 90413
340 Ga0207647_10031534 3300025904 Bacteria 3410
341 Ga0207647_10068299 3300025904 Bacteria 2152
342 Ga0207647_10102849 3300025904 Bacteria 1694
343 Ga0207647_10210896 3300025904 Unclassified 1122
344 Ga0207645_10001476 3300025907 Bacteria 19223
345 Ga0207645_10003649 3300025907 Bacteria 11612
346 Ga0207645_10032044 3300025907 Bacteria 3380
347 Ga0207643_10036158 3300025908 Bacteria 2769
348 Ga0207705_10000107 3300025909 Bacteria 94984
349 Ga0207705_10006001 3300025909 Bacteria 9039
350 Ga0207705_10007688 3300025909 Bacteria 7925
351 Ga0207705_10026729 3300025909 Bacteria 4114
352 Ga0207705_10031050 3300025909 Bacteria 3812
353 Ga0207705_10123331 3300025909 Unclassified 1924
354 Ga0207705_10295049 3300025909 Bacteria 1242
355 Ga0207705_10626479 3300025909 Bacteria 836
356 Ga0207654_10001573 3300025911 Bacteria 11985
357 Ga0207654_10038862 3300025911 Bacteria 2673
358 Ga0207654_10172542 3300025911 Unclassified 1405
359 Ga0207707_10001470 3300025912 Bacteria 21804
360 Ga0207707_10178394 3300025912 Bacteria 1855
361 Ga0207695_10009594 3300025913 Bacteria 11954
362 Ga0207695_10021017 3300025913 Bacteria 7455
363 Ga0207695_10031739 3300025913 Bacteria 5789
364 Ga0207695_10115674 3300025913 Bacteria 2656
365 Ga0207695_10436891 3300025913 Bacteria 1192
366 Ga0207695_10486805 3300025913 Bacteria 1116
367 Ga0207671_10003003 3300025914 Bacteria 17298
368 Ga0207671_10010262 3300025914 Bacteria 7747
369 Ga0207671_10263316 3300025914 Unclassified 1357
370 Ga0207660_10002253 3300025917 Bacteria 12747
371 Ga0207660_10004358 3300025917 Bacteria 9225
372 Ga0207660_10046627 3300025917 Bacteria 3059
373 Ga0207660_10136772 3300025917 Bacteria 1870
374 Ga0207660_10319891 3300025917 Bacteria 1239
375 Ga0207662_10421701 3300025918 Unclassified 908
376 Ga0207657_10023759 3300025919 Bacteria 5700
377 Ga0207657_10028070 3300025919 Bacteria 5142
378 Ga0207657_10114354 3300025919 Bacteria 2225
379 Ga0207657_10438199 3300025919 Unclassified 1026
380 Ga0207657_10782507 3300025919 Bacteria 738
381 Ga0207649_10251594 3300025920 Bacteria 1273
382 Ga0207652_10000160 3300025921 Bacteria 72867
383 Ga0207652_10001229 3300025921 Bacteria 22941
384 Ga0207652_10001570 3300025921 Bacteria 20111
385 Ga0207652_10005109 3300025921 Bacteria 10652
386 Ga0207652_10064372 3300025921 Bacteria 3172
387 Ga0207652_10486875 3300025921 Bacteria 1111
388 Ga0207681_10459089 3300025923 Bacteria 1037
389 Ga0207681_10481851 3300025923 Unclassified 1013
390 Ga0207694_10027721 3300025924 Bacteria 4314
391 Ga0207650_10072941 3300025925 Bacteria 2584
392 Ga0207650_10380617 3300025925 Unclassified 1165
393 Ga0207659_10359430 3300025926 Bacteria 1210
394 Ga0207664_10234683 3300025929 Bacteria 1595
395 Ga0207644_10005751 3300025931 Bacteria 8068
396 Ga0207644_10025152 3300025931 Unclassified 4092
397 Ga0207644_10331488 3300025931 Bacteria 1232
398 Ga0207690_10017157 3300025932 Bacteria 4418
399 Ga0207690_10060177 3300025932 Bacteria 2576
400 Ga0207706_10000057 3300025933 Bacteria 112805
401 Ga0207706_10015500 3300025933 Bacteria 6887
402 Ga0207706_10023446 3300025933 Bacteria 5541
403 Ga0207706_10108370 3300025933 Bacteria 2444
404 Ga0207686_10246624 3300025934 Unclassified 1303
405 Ga0207686_10251401 3300025934 Bacteria 1292
406 Ga0207709_10030470 3300025935 Bacteria 3138
407 Ga0207709_10305725 3300025935 Bacteria 1184
408 Ga0207669_10157449 3300025937 Bacteria 1600
409 Ga0207704_10233363 3300025938 Unclassified 1370
410 Ga0207691_10000549 3300025940 Bacteria 37607
411 Ga0207691_10231686 3300025940 Unclassified 1599
412 Ga0207711_10022613 3300025941 Bacteria 5260
413 Ga0207711_10952905 3300025941 Unclassified 797
414 Ga0207689_10007988 3300025942 Bacteria 9244
415 Ga0207689_10035131 3300025942 Bacteria 4164
416 Ga0207689_10123931 3300025942 Bacteria 2126
417 Ga0207689_10545644 3300025942 Unclassified 973
418 Ga0207679_10133437 3300025945 Bacteria 1995
419 Ga0207667_10000218 3300025949 Bacteria 80364
420 Ga0207667_10013351 3300025949 Bacteria 9403
421 Ga0207667_10015291 3300025949 Bacteria 8724
422 Ga0207667_10018470 3300025949 Bacteria 7818
423 Ga0207667_10033964 3300025949 Bacteria 5480
424 Ga0207667_10072873 3300025949 Bacteria 3570
425 Ga0207651_10000231 3300025960 Bacteria 24055
426 Ga0207651_10141165 3300025960 Bacteria 1861
427 Ga0207651_10461794 3300025960 Bacteria 1091
428 Ga0207712_10001912 3300025961 Bacteria 13697
429 Ga0207712_10012826 3300025961 Bacteria 5359
430 Ga0207712_10149374 3300025961 Bacteria 1803
431 Ga0207668_10000639 3300025972 Bacteria 21609
432 Ga0207640_10180581 3300025981 Bacteria 1582
433 Ga0207640_10584164 3300025981 Unclassified 943
434 Ga0207658_10000942 3300025986 Bacteria 24008
435 Ga0207658_10169489 3300025986 Bacteria 1797
436 Ga0207658_10530000 3300025986 Bacteria 1052
437 Ga0207677_10001537 3300026023 Bacteria 12210
438 Ga0207677_10389101 3300026023 Unclassified 1179
439 Ga0207703_10495775 3300026035 Bacteria 1146
440 Ga0207639_10028395 3300026041 Bacteria 4084
441 Ga0207639_10168375 3300026041 Bacteria 1853
442 Ga0207639_10452397 3300026041 Bacteria 1166
443 Ga0207678_10020363 3300026067 Bacteria 5820
444 Ga0207678_10062988 3300026067 Bacteria 3187
445 Ga0207678_10314757 3300026067 Bacteria 1346
446 Ga0207708_10144733 3300026075 Unclassified 1867
447 Ga0207702_10021847 3300026078 Bacteria 5299
448 Ga0207702_10150742 3300026078 Bacteria 2115
449 Ga0207702_10203202 3300026078 Bacteria 1838
450 Ga0207702_10550843 3300026078 Bacteria 1128
451 Ga0207641_10000890 3300026088 Bacteria 31183
452 Ga0207641_10330686 3300026088 Unclassified 1447
453 Ga0207641_10545316 3300026088 Bacteria 1130
454 Ga0207648_10001186 3300026089 Bacteria 29157
455 Ga0207648_10134661 3300026089 Unclassified 2176
456 Ga0207676_10011544 3300026095 Bacteria 6318
457 Ga0207676_10041594 3300026095 Bacteria 3529
458 Ga0207676_10089828 3300026095 Bacteria 2519
459 Ga0207674_10023207 3300026116 Bacteria 6649
460 Ga0207674_10042476 3300026116 Bacteria 4696
461 Ga0207674_10075512 3300026116 Bacteria 3380
462 Ga0207674_10355615 3300026116 Bacteria 1416
463 Ga0207674_10478069 3300026116 Bacteria 1204
464 Ga0207675_100965560 3300026118 Bacteria 870
465 Ga0207683_10003156 3300026121 Bacteria 14393
466 Ga0207683_10085831 3300026121 Bacteria 2798
467 Ga0207683_10123282 3300026121 Unclassified 2328
468 Ga0207683_10465006 3300026121 Unclassified 1167
469 Ga0207698_10005375 3300026142 Bacteria 7907
470 Ga0207698_10049692 3300026142 Bacteria 3194
471 Ga0207698_10210463 3300026142 Unclassified 1749
472 Ga0207698_10238002 3300026142 Bacteria 1657
473 Ga0207698_10381440 3300026142 Bacteria 1341
474 Ga0207698_10597464 3300026142 Bacteria 1088
475 Ga0268266_10000030 3300028379 Bacteria 417120
476 Ga0268266_10169385 3300028379 Bacteria 1981
477 Ga0268266_10421338 3300028379 Bacteria 1265
478 Ga0268265_10575091 3300028380 Bacteria 1073
479 Ga0268264_10001550 3300028381 Bacteria 21303
480 Ga0268264_10037060 3300028381 Bacteria 4019
481 Ga0268264_10374119 3300028381 Bacteria 1362
482 Ga0307517_10000689 3300028786 Bacteria 58121
483 Ga0307517_10001373 3300028786 Bacteria 40930
484 Ga0307511_10018245 3300030521 Bacteria 6712
485 Ga0265327_10030527 3300031251 Bacteria 3045
486 Ga0307513_10117569 3300031456 Bacteria 2636
487 Ga0307513_10250713 3300031456 Bacteria 1567
488 Ga0307513_10415778 3300031456 Bacteria 1076
489 Ga0307509_10043332 3300031507 Bacteria 4870
490 Ga0307509_10189842 3300031507 Unclassified 1907
491 Ga0307408_100011316 3300031548 Bacteria 5896
492 Ga0307408_100732139 3300031548 Bacteria 892
493 Ga0307508_10000490 3300031616 Bacteria 47664
494 Ga0307516_10030336 3300031730 Bacteria 5457
495 Ga0307405_10012150 3300031731 Bacteria 4545
496 Ga0307413_10261263 3300031824 Unclassified 1291
497 Ga0307413_10642091 3300031824 Bacteria 874
498 Ga0307413_11058270 3300031824 Bacteria 698
499 Ga0307410_10344346 3300031852 Unclassified 1189
500 Ga0307410_10445653 3300031852 Bacteria 1055
501 Ga0307406_10381909 3300031901 Unclassified 1111
502 Ga0307407_10535202 3300031903 Bacteria 864
503 Ga0307412_10017558 3300031911 Unclassified 4285
504 Ga0307409_100023495 3300031995 Unclassified 4274
505 Ga0307416_100013580 3300032002 Bacteria 5543
506 Ga0307414_10994368 3300032004 Bacteria 772
507 Ga0307411_10557105 3300032005 Bacteria 979
508 Ga0307415_100008920 3300032126 Bacteria 5588
509 Ga0307507_10249165 3300033179 Bacteria 1150
510 Ga0307510_10001453 3300033180 Bacteria 26110
511 Ga0373936_0235011 3300035113 Bacteria 816
512 Ga0373941_0002433 3300035115 Bacteria 4098
513 Ga0373947_0080417 3300035725 Unclassified 2016
514 Ga0395899_0000011 3300037312 Bacteria 521331
515 Ga0395899_0000272 3300037312 Bacteria 67722
516 Ga0395899_0002241 3300037312 Bacteria 15831
517 Ga0395899_0002489 3300037312 Bacteria 14953
518 Ga0395899_0012002 3300037312 Bacteria 6638
519 Ga0395899_0113259 3300037312 Bacteria 1948
520 Ga0395899_0113264 3300037312 Bacteria 1948
521 Ga0395899_0133951 3300037312 Bacteria 1767
522 Ga0395899_0170733 3300037312 Bacteria 1531
523 Ga0395900_0000143 3300037418 Bacteria 120234
524 Ga0395900_0000284 3300037418 Bacteria 75852
525 Ga0395900_0002996 3300037418 Bacteria 18376
526 Ga0395900_0037187 3300037418 Bacteria 5020
527 Ga0395900_0065294 3300037418 Bacteria 3739
528 Ga0395900_0213375 3300037418 Bacteria 1948
529 Ga0395900_0224964 3300037418 Bacteria 1889
530 Ga0395900_0235202 3300037418 Bacteria 1840
531 Ga0395900_0518093 3300037418 Unclassified 1141
532 Ga0395900_0599043 3300037418 Bacteria 1043
533 Ga0395898_0001675 3300037466 Bacteria 29715
534 Ga0395898_0040570 3300037466 Bacteria 4602
535 Ga0395898_0042281 3300037466 Bacteria 4497
536 Ga0395898_0177691 3300037466 Bacteria 2034
537 Ga0395898_0199535 3300037466 Bacteria 1910
538 Ga0395898_0269051 3300037466 Bacteria 1625
539 Ga0395898_0314505 3300037466 Unclassified 1494
540 Ga0395898_0343107 3300037466 Bacteria 1424
541 Ga0395905_0000045 3300037471 Bacteria 241370
542 Ga0395905_0014794 3300037471 Bacteria 7440
543 Ga0395905_0021697 3300037471 Bacteria 6075
544 Ga0395905_0181426 3300037471 Bacteria 1976
545 Ga0395905_0346240 3300037471 Bacteria 1378
546 Ga0395905_0827533 3300037471 Bacteria 829
547 Ga0395901_0041781 3300038443 Unclassified 4753
548 Ga0395901_0051770 3300038443 Bacteria 4268
549 Ga0395901_0095191 3300038443 Bacteria 3120
550 Ga0395901_0181268 3300038443 Bacteria 2209
551 Ga0436365_1199589 3300039437 Bacteria 1359
552 Ga0436361_0924736 3300039447 Bacteria 22942
553 Ga0439436_0000463 3300041404 Bacteria 10418
554 Ga0439439_0034103 3300041406 Bacteria 1305
555 Ga0451791_0915382 3300041451 Bacteria 843
556 Ga0451802_1870795 3300041460 Bacteria 1269
557 Ga0451853_0175003 3300041512 Bacteria 1508
558 Ga0439441_051278 3300042001 Unclassified 850
559 Ga0439449_0084860 3300042007 Bacteria 1168
560 Ga0439460_0012132 3300042461 Bacteria 2231
561 Ga0451577_0162586 3300042876 Bacteria 2011
562 Ga0466969_0002735 3300044656 Bacteria 9431
563 Ga0466969_0027918 3300044656 Bacteria 2888
564 Ga0466972_0000183 3300044658 Bacteria 48447
565 Ga0466972_0010220 3300044658 Bacteria 4714
566 Ga0466966_0000053 3300044684 Bacteria 84809
567 Ga0466966_0041874 3300044684 Bacteria 2942
568 Ga0466966_0186204 3300044684 Bacteria 1258
569 Ga0466961_0054835 3300044693 Bacteria 2542
570 Ga0453684_0035341 3300044712 Bacteria 6910
571 Ga0453684_0201178 3300044712 Bacteria 2322
572 Ga0453684_0203900 3300044712 Bacteria 2303
573 Ga0453684_0206171 3300044712 Bacteria 2288
574 Ga0453684_0753453 3300044712 Unclassified 1054
575 Ga0466968_0073890 3300044735 Bacteria 1488
576 Ga0466970_0171737 3300044765 Unclassified 1202
577 Ga0466957_0000361 3300044842 Bacteria 22366
578 Ga0466957_0003621 3300044842 Bacteria 8515
579 Ga0466960_0282646 3300044901 Bacteria 930
580 Ga0466959_0000005 3300045049 Bacteria 213958
581 Ga0466959_0027330 3300045049 Bacteria 4232
582 Ga0466959_0108333 3300045049 Bacteria 1985
583 Ga0451576_0809183 3300045051 Bacteria 984
584 Ga0466958_0008209 3300045836 Bacteria 5783
585 Ga0466967_0285040 3300045976 Bacteria 1586
586 Ga0495580_0096192 3300046472 Unclassified 2059
587 Ga0495596_0051164 3300046500 Bacteria 1618
588 Ga0495583_0098522 3300046506 Bacteria 1250
589 Ga0495630_0045267 3300046517 Bacteria 3288
590 Ga0495630_0388317 3300046517 Bacteria 1069
591 Ga0495631_0003227 3300046518 Bacteria 8972
592 Ga0495665_0212687 3300046531 Bacteria 1001
593 Ga0495645_0207332 3300046543 Unclassified 1326
594 Ga0495668_0009186 3300046616 Bacteria 6085
595 Ga0495625_0000486 3300046660 Bacteria 59478
596 Ga0495625_0253327 3300046660 Bacteria 1142
597 Ga0495635_0156487 3300046663 Bacteria 1551
598 Ga0495647_0111774 3300046681 Bacteria 1141
599 Ga0495669_0156570 3300046684 Bacteria 1080
600 Ga0495649_0162274 3300046694 Unclassified 1171
601 Ga0495674_0012685 3300047319 Bacteria 7941
602 Ga0495672_0032936 3300047320 Bacteria 3216
603 Ga0495672_0126708 3300047320 Bacteria 1349
604 Ga0495672_0156931 3300047320 Bacteria 1174
605 Ga0495687_006354 3300047443 Bacteria 7264
606 Ga0495685_038486 3300047447 Bacteria 1639
607 Ga0495681_0169620 3300047470 Bacteria 904
608 Ga0495686_0000016 3300047472 Bacteria 443701
609 Ga0495686_0011709 3300047472 Bacteria 6177
610 Ga0495686_0038473 3300047472 Bacteria 3059
611 Ga0496101_0211869 3300048904 Unclassified 1501
612 Ga0496108_0016487 3300048911 Bacteria 6030
613 Ga0496109_0111128 3300048912 Bacteria 2548
614 Ga0496114_0108349 3300048917 Unclassified 2378
615 Ga0496115_0161568 3300048918 Bacteria 1851
616 Ga0496126_0744012 3300048929 Viruses 758
617 Ga0501300_000687 3300049523 Bacteria 5069
618 Ga0501031_0004805 3300049568 Bacteria 8776
619 Ga0501032_0350526 3300049569 Unclassified 951
620 Ga0501034_0104178 3300049571 Bacteria 2830
621 Ga0501034_0326392 3300049571 Bacteria 1467
622 Ga0501036_0029052 3300049572 Bacteria 4673
623 Ga0501038_0015516 3300049574 Bacteria 6925
624 Ga0501043_0009411 3300049579 Bacteria 7670
625 Ga0501046_0250957 3300049580 Unclassified 1302
626 Ga0501047_0049481 3300049581 Bacteria 4059
627 Ga0501047_0093282 3300049581 Bacteria 2890
628 Ga0501047_0315842 3300049581 Unclassified 1403
629 Ga0501047_0629745 3300049581 Bacteria 893
630 Ga0501048_0321824 3300049582 Unclassified 1102
631 Ga0501067_0056979 3300049583 Bacteria 2164
632 Ga0501068_0337583 3300049584 Unclassified 967
633 Ga0501069_0079963 3300049585 Unclassified 1840
634 Ga0501070_0163050 3300049586 Bacteria 1837
635 Ga0501071_0090347 3300049587 Bacteria 2249
636 Ga0501072_0179078 3300049588 Unclassified 1691
637 Ga0501073_0009189 3300049589 Bacteria 7290
638 Ga0501074_0088118 3300049590 Unclassified 2223
639 Ga0501198_003043 3300049649 Bacteria 2281
640 Ga0501201_011133 3300049651 Bacteria 887
641 Ga0501206_016999 3300049653 Bacteria 1015
642 Ga0501217_004320 3300049661 Bacteria 2915
643 Ga0501222_012288 3300049662 Bacteria 1128
644 Ga0501224_013143 3300049664 Bacteria 1223
645 Ga0501235_001096 3300049669 Bacteria 5664
646 Ga0501243_002332 3300049675 Bacteria 2772
647 Ga0501247_002650 3300049677 Bacteria 1872
648 Ga0501250_000629 3300049680 Bacteria 2502
649 Ga0501252_000835 3300049682 Bacteria 2611
650 Ga0501257_002236 3300049686 Bacteria 4054
651 Ga0501259_002139 3300049688 Bacteria 3246
652 Ga0501259_002416 3300049688 Bacteria 3034
653 Ga0501219_000818 3300049703 Bacteria 4043
654 Ga0501225_0008301 3300049705 Bacteria 2986
655 Ga0501225_0048116 3300049705 Bacteria 1184
656 Ga0501245_002571 3300049708 Bacteria 2430
657 Ga0501083_0070947 3300049744 Bacteria 2316
658 Ga0501083_0321259 3300049744 Bacteria 1007
659 Ga0501263_013543 3300049760 Bacteria 1035
660 Ga0501264_000244 3300049761 Bacteria 8791
661 Ga0501266_001020 3300049763 Bacteria 3616
662 Ga0501271_006979 3300049768 Bacteria 1130
663 Ga0501035_0023385 3300049822 Bacteria 5669
664 Ga0501044_0018948 3300049823 Bacteria 7369
665 Ga0501044_0020539 3300049823 Bacteria 7052
666 Ga0501044_0075714 3300049823 Bacteria 3417
667 Ga0501284_00044 3300050005 Bacteria 49044
668 nmdc:mga0k408_115890_c1 3300050493 Unclassified 1585
669 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
670 nmdc:mga0k408_406335_c1 3300050493 Unclassified 810
671 nmdc:mga07m45_333161_c1 3300050496 Unclassified 882
672 nmdc:mga09592_2911_c1 3300050508 Bacteria 13882
673 nmdc:mga08y16_134651_c1 3300050511 Bacteria 2568
674 nmdc:mga08y16_5136_c1 3300050511 Bacteria 13684
675 nmdc:mga0n895_198258_c1 3300050512 Bacteria 2039
676 nmdc:mga08x19_127677_c1 3300050514 Bacteria 1708
677 Ga0500578_0000017 3300053086 Bacteria 178494
678 Ga0500578_0175718 3300053086 Bacteria 1322
679 Ga0500583_0000130 3300053092 Bacteria 34913
680 Ga0500583_0000387 3300053092 Bacteria 14221
681 Ga0500650_0189003 3300053098 Bacteria 941
682 Ga0500608_016510 3300053122 Bacteria 3337
683 Ga0500559_0088846 3300053136 Bacteria 1413
684 Ga0500573_0164808 3300053140 Unclassified 1204
685 Ga0500588_0007343 3300053146 Bacteria 2538
686 Ga0500604_0001170 3300053151 Bacteria 7297
687 Ga0500604_0081881 3300053151 Bacteria 1044
688 Ga0500616_0012777 3300053153 Bacteria 4901
689 Ga0500637_0129142 3300053178 Bacteria 1466
690 Ga0500611_000054 3300053727 Bacteria 50397
691 Ga0500611_001068 3300053727 Bacteria 2902
692 Ga0500645_018744 3300053730 Bacteria 2158
693 Ga0500587_009357 3300053739 Bacteria 1252
694 Ga0587077_042960 3300059493 Bacteria 915
695 Ga0501082_0420887 3300060353 Unclassified 1166
696 Ga0466962_0083735 3300061719 Bacteria 1526

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10061449 Ga0157370_100614493 181
2 3300028786 Ga0307517_10000689 Ga0307517_1000068911 189
3 3300044656 Ga0466969_0027918 Ga0466969_0027918_1406_2053 194
4 3300044684 Ga0466966_0186204 Ga0466966_0186204_186_833 194
5 3300044693 Ga0466961_0054835 Ga0466961_0054835_313_960 194
6 3300045049 Ga0466959_0108333 Ga0466959_0108333_344_991 194
7 3300045836 Ga0466958_0008209 Ga0466958_0008209_3496_4143 194
8 3300020077 Ga0206351_10160225 Ga0206351_101602251 195
9 3300013102 Ga0157371_10007347 Ga0157371_100073473 196
10 3300013307 Ga0157372_10000182 Ga0157372_1000018231 196
11 3300025981 Ga0207640_10180581 Ga0207640_101805812 196
12 3300049651 Ga0501201_011133 Ga0501201_011133_172_783 196
13 3300005563 Ga0068855_100015513 Ga0068855_1000155135 197
14 3300025949 Ga0207667_10018470 Ga0207667_100184702 197
15 3300037312 Ga0395899_0000272 Ga0395899_0000272_57265_57912 197
16 3300005458 Ga0070681_10498956 Ga0070681_104989561 198
17 3300041406 Ga0439439_0034103 Ga0439439_0034103_50_703 198
18 3300041451 Ga0451791_0915382 Ga0451791_0915382_179_832 198
19 3300050493 nmdc:mga0k408_406335_c1 nmdc:mga0k408_406335_c1_94_756 198
20 3300050496 nmdc:mga07m45_333161_c1 nmdc:mga07m45_333161_c1_14_628 198
21 3300053086 Ga0500578_0175718 Ga0500578_0175718_476_1183 198
22 3300053098 Ga0500650_0189003 Ga0500650_0189003_237_890 198
23 3300003316 rootH1_10026206 rootH1_100262068 199
24 3300003322 rootL2_10075832 rootL2_100758322 199
25 3300009553 Ga0105249_10170008 Ga0105249_101700083 199
26 3300013306 Ga0163162_10007383 Ga0163162_100073837 199
27 3300014325 Ga0163163_10539952 Ga0163163_105399521 199
28 3300025893 Ga0207682_10243175 Ga0207682_102431751 199
29 3300044842 Ga0466957_0000361 Ga0466957_0000361_2736_3401 199
30 3300003323 rootH1_10176585 rootH1_101765858 201
31 3300031507 Ga0307509_10189842 Ga0307509_101898422 201
32 3300053140 Ga0500573_0164808 Ga0500573_0164808_378_1085 201
33 3300041512 Ga0451853_0175003 Ga0451853_0175003_10_675 202
34 3300053092 Ga0500583_0000130 Ga0500583_0000130_4603_5304 202
35 3300053178 Ga0500637_0129142 Ga0500637_0129142_68_730 202
36 3300004799 Ga0058863_10172141 Ga0058863_101721413 203
37 3300004800 Ga0058861_11885956 Ga0058861_118859563 203
38 3300004803 Ga0058862_12637711 Ga0058862_126377112 203
39 3300005336 Ga0070680_100005626 Ga0070680_1000056267 203
40 3300005530 Ga0070679_100249780 Ga0070679_1002497801 203
41 3300009176 Ga0105242_10369030 Ga0105242_103690301 203
42 3300013297 Ga0157378_10031792 Ga0157378_100317926 203
43 3300025917 Ga0207660_10046627 Ga0207660_100466272 203
44 3300025921 Ga0207652_10064372 Ga0207652_100643723 203
45 3300025934 Ga0207686_10251401 Ga0207686_102514011 203
46 3300041460 Ga0451802_1870795 Ga0451802_1870795_495_1196 203
47 3300053092 Ga0500583_0000387 Ga0500583_0000387_7995_8696 203
48 3300053727 Ga0500611_001068 Ga0500611_001068_1345_2046 203
49 3300005548 Ga0070665_100515444 Ga0070665_1005154442 204
50 3300005563 Ga0068855_100000631 Ga0068855_10000063135 204
51 3300013100 Ga0157373_10004999 Ga0157373_100049992 204
52 3300017792 Ga0163161_10000230 Ga0163161_1000023016 204
53 3300017792 Ga0163161_10097798 Ga0163161_100977982 204
54 3300025949 Ga0207667_10000218 Ga0207667_1000021861 204
55 3300028379 Ga0268266_10421338 Ga0268266_104213382 204
56 3300005563 Ga0068855_100413422 Ga0068855_1004134222 205
57 3300013307 Ga0157372_10051844 Ga0157372_100518445 205
58 3300049571 Ga0501034_0326392 Ga0501034_0326392_733_1371 205
59 3300049580 Ga0501046_0250957 Ga0501046_0250957_436_1116 205
60 3300049581 Ga0501047_0315842 Ga0501047_0315842_550_1230 205
61 3300049583 Ga0501067_0056979 Ga0501067_0056979_1451_2131 205
62 3300049585 Ga0501069_0079963 Ga0501069_0079963_486_1166 205
63 3300060353 Ga0501082_0420887 Ga0501082_0420887_313_993 205
64 3300003323 rootH1_10015461 rootH1_100154615 206
65 3300046660 Ga0495625_0000486 Ga0495625_0000486_43459_44097 206
66 3300047320 Ga0495672_0032936 Ga0495672_0032936_1365_2066 206
67 3300050493 nmdc:mga0k408_22_c2 nmdc:mga0k408_22_c2_60482_61120 206
68 3300009094 Ga0111539_10006564 Ga0111539_1000656411 207
69 3300009147 Ga0114129_10729842 Ga0114129_107298422 207
70 3300037312 Ga0395899_0000011 Ga0395899_0000011_176313_176972 207
71 3300044684 Ga0466966_0041874 Ga0466966_0041874_560_1216 207
72 3300045049 Ga0466959_0027330 Ga0466959_0027330_500_1177 207
73 3300046500 Ga0495596_0051164 Ga0495596_0051164_88_768 207
74 3300061719 Ga0466962_0083735 Ga0466962_0083735_26_703 207
75 3300005327 Ga0070658_10039535 Ga0070658_100395352 208
76 3300005563 Ga0068855_100404665 Ga0068855_1004046652 208
77 3300005834 Ga0068851_10092301 Ga0068851_100923012 208
78 3300005985 Ga0081539_10001220 Ga0081539_100012202 208
79 3300025899 Ga0207642_10218472 Ga0207642_102184721 208
80 3300025909 Ga0207705_10295049 Ga0207705_102950492 208
81 3300037418 Ga0395900_0518093 Ga0395900_0518093_259_897 208
82 3300037466 Ga0395898_0314505 Ga0395898_0314505_780_1418 208
83 3300053151 Ga0500604_0081881 Ga0500604_0081881_101_802 208
84 3300053739 Ga0500587_009357 Ga0500587_009357_100_801 208
85 3300014325 Ga0163163_10348328 Ga0163163_103483282 209
86 3300028786 Ga0307517_10001373 Ga0307517_1000137319 209
87 3300037471 Ga0395905_0346240 Ga0395905_0346240_283_930 209
88 3300044765 Ga0466970_0171737 Ga0466970_0171737_200_847 209
89 3300005614 Ga0068856_100277262 Ga0068856_1002772622 210
90 3300025924 Ga0207694_10027721 Ga0207694_100277214 210
91 3300026078 Ga0207702_10203202 Ga0207702_102032022 210
92 3300042876 Ga0451577_0162586 Ga0451577_0162586_945_1613 210
93 3300044712 Ga0453684_0035341 Ga0453684_0035341_5917_6585 210
94 3300045051 Ga0451576_0809183 Ga0451576_0809183_290_958 210
95 3300049569 Ga0501032_0350526 Ga0501032_0350526_181_861 210
96 3300049582 Ga0501048_0321824 Ga0501048_0321824_54_734 210
97 3300049584 Ga0501068_0337583 Ga0501068_0337583_143_823 210
98 3300049586 Ga0501070_0163050 Ga0501070_0163050_33_713 210
99 3300049587 Ga0501071_0090347 Ga0501071_0090347_468_1148 210
100 3300049588 Ga0501072_0179078 Ga0501072_0179078_264_944 210
101 3300049589 Ga0501073_0009189 Ga0501073_0009189_1756_2436 210
102 3300049590 Ga0501074_0088118 Ga0501074_0088118_381_1061 210
103 3300049744 Ga0501083_0070947 Ga0501083_0070947_525_1205 210
104 3300049823 Ga0501044_0075714 Ga0501044_0075714_794_1474 210
105 3300005840 Ga0068870_10369972 Ga0068870_103699721 211
106 3300013297 Ga0157378_10017995 Ga0157378_100179957 211
107 3300013308 Ga0157375_10034881 Ga0157375_100348812 211
108 3300047447 Ga0495685_038486 Ga0495685_038486_223_897 211
109 3300047470 Ga0495681_0169620 Ga0495681_0169620_43_717 211
110 iso_pu_bacteria 2738541278 2738729407 212
111 3300003322 rootL2_10173807 rootL2_101738071 213
112 3300003322 rootL2_10251069 rootL2_102510692 213
113 3300005354 Ga0070675_100015362 Ga0070675_1000153623 213
114 3300006844 Ga0075428_100542658 Ga0075428_1005426582 213
115 3300009094 Ga0111539_10001678 Ga0111539_100016789 213
116 3300013297 Ga0157378_11404986 Ga0157378_114049861 213
117 3300013308 Ga0157375_11366032 Ga0157375_113660321 213
118 3300014326 Ga0157380_10097921 Ga0157380_100979212 213
119 3300021384 Ga0213876_10186190 Ga0213876_101861902 213
120 3300031824 Ga0307413_11058270 Ga0307413_110582701 213
121 3300039437 Ga0436365_1199589 Ga0436365_1199589_400_1053 213
122 3300044712 Ga0453684_0753453 Ga0453684_0753453_36_683 213
123 3300049649 Ga0501198_003043 Ga0501198_003043_97_765 213
124 3300049653 Ga0501206_016999 Ga0501206_016999_135_803 213
125 3300049664 Ga0501224_013143 Ga0501224_013143_135_803 213
126 3300049669 Ga0501235_001096 Ga0501235_001096_1741_2409 213
127 3300049675 Ga0501243_002332 Ga0501243_002332_426_1094 213
128 3300049682 Ga0501252_000835 Ga0501252_000835_1853_2521 213
129 3300049688 Ga0501259_002139 Ga0501259_002139_86_754 213
130 3300049705 Ga0501225_0008301 Ga0501225_0008301_329_997 213
131 3300049708 Ga0501245_002571 Ga0501245_002571_1146_1814 213
132 3300050511 nmdc:mga08y16_5136_c1 nmdc:mga08y16_5136_c1_9755_10411 213
133 3300053153 Ga0500616_0012777 Ga0500616_0012777_2153_2806 213
134 3300005548 Ga0070665_100889998 Ga0070665_1008899981 214
135 3300013306 Ga0163162_10356335 Ga0163162_103563352 214
136 3300031507 Ga0307509_10043332 Ga0307509_100433323 214
137 3300031731 Ga0307405_10012150 Ga0307405_100121503 214
138 3300031824 Ga0307413_10261263 Ga0307413_102612632 214
139 3300031824 Ga0307413_10642091 Ga0307413_106420912 214
140 3300031852 Ga0307410_10344346 Ga0307410_103443462 214
141 3300031901 Ga0307406_10381909 Ga0307406_103819092 214
142 3300031911 Ga0307412_10017558 Ga0307412_100175584 214
143 3300031995 Ga0307409_100023495 Ga0307409_1000234954 214
144 3300032002 Ga0307416_100013580 Ga0307416_1000135804 214
145 3300032004 Ga0307414_10994368 Ga0307414_109943681 214
146 3300032126 Ga0307415_100008920 Ga0307415_1000089203 214
147 3300044712 Ga0453684_0203900 Ga0453684_0203900_54_710 214
148 3300046616 Ga0495668_0009186 Ga0495668_0009186_520_1194 214
149 3300053151 Ga0500604_0001170 Ga0500604_0001170_6388_7062 214
150 3300003320 rootH2_10013162 rootH2_1001316226 215
151 3300003322 rootL2_10153257 rootL2_101532572 215
152 3300003322 rootL2_10363313 rootL2_103633132 215
153 3300005471 Ga0070698_100027024 Ga0070698_1000270245 215
154 3300005539 Ga0068853_101089999 Ga0068853_1010899991 215
155 3300009094 Ga0111539_10193845 Ga0111539_101938452 215
156 3300009553 Ga0105249_10002393 Ga0105249_100023938 215
157 3300013104 Ga0157370_10073871 Ga0157370_100738713 215
158 3300013306 Ga0163162_10953408 Ga0163162_109534082 215
159 3300014326 Ga0157380_10004725 Ga0157380_100047253 215
160 3300014326 Ga0157380_10164705 Ga0157380_101647052 215
161 3300025246 Ga0209646_1000837 Ga0209646_10008378 215
162 3300025304 Ga0209257_1000006 Ga0209257_1000006399 215
163 3300025901 Ga0207688_10409916 Ga0207688_104099161 215
164 3300025961 Ga0207712_10001912 Ga0207712_100019129 215
165 3300026088 Ga0207641_10545316 Ga0207641_105453162 215
166 3300031548 Ga0307408_100011316 Ga0307408_1000113162 215
167 3300031730 Ga0307516_10030336 Ga0307516_100303364 215
168 3300031852 Ga0307410_10445653 Ga0307410_104456532 215
169 3300032005 Ga0307411_10557105 Ga0307411_105571051 215
170 3300044658 Ga0466972_0010220 Ga0466972_0010220_2971_3672 215
171 3300047320 Ga0495672_0126708 Ga0495672_0126708_606_1265 215
172 3300048918 Ga0496115_0161568 Ga0496115_0161568_63_734 215
173 3300049523 Ga0501300_000687 Ga0501300_000687_16_672 215
174 3300049581 Ga0501047_0049481 Ga0501047_0049481_958_1662 215
175 3300049661 Ga0501217_004320 Ga0501217_004320_1806_2462 215
176 3300049662 Ga0501222_012288 Ga0501222_012288_418_1077 215
177 3300049677 Ga0501247_002650 Ga0501247_002650_181_837 215
178 3300049686 Ga0501257_002236 Ga0501257_002236_1775_2434 215
179 3300049761 Ga0501264_000244 Ga0501264_000244_3642_4301 215
180 3300049768 Ga0501271_006979 Ga0501271_006979_87_743 215
181 3300049823 Ga0501044_0018948 Ga0501044_0018948_395_1099 215
182 3300050511 nmdc:mga08y16_134651_c1 nmdc:mga08y16_134651_c1_464_1171 215
183 3300053086 Ga0500578_0000017 Ga0500578_0000017_74793_75494 215
184 3300053727 Ga0500611_000054 Ga0500611_000054_23989_24651 215
185 3300059493 Ga0587077_042960 Ga0587077_042960_178_879 215
186 iso_pu_bacteria 2910245624 2910247887 215
187 3300001904 JGI24736J21556_1017643 JGI24736J21556_10176432 216
188 3300003322 rootL2_10057324 rootL2_100573243 216
189 3300003323 rootH1_10197827 rootH1_101978272 216
190 3300005329 Ga0070683_100053211 Ga0070683_1000532113 216
191 3300005334 Ga0068869_100557115 Ga0068869_1005571151 216
192 3300005336 Ga0070680_100190324 Ga0070680_1001903241 216
193 3300005336 Ga0070680_100274768 Ga0070680_1002747682 216
194 3300005337 Ga0070682_100016869 Ga0070682_1000168692 216
195 3300005338 Ga0068868_100092748 Ga0068868_1000927481 216
196 3300005340 Ga0070689_100654252 Ga0070689_1006542522 216
197 3300005343 Ga0070687_100005535 Ga0070687_1000055351 216
198 3300005344 Ga0070661_100096260 Ga0070661_1000962602 216
199 3300005364 Ga0070673_100051840 Ga0070673_1000518403 216
200 3300005364 Ga0070673_100330898 Ga0070673_1003308982 216
201 3300005366 Ga0070659_100012341 Ga0070659_1000123414 216
202 3300005366 Ga0070659_100060941 Ga0070659_1000609413 216
203 3300005367 Ga0070667_100071055 Ga0070667_1000710551 216
204 3300005367 Ga0070667_100223154 Ga0070667_1002231542 216
205 3300005438 Ga0070701_10081726 Ga0070701_100817262 216
206 3300005456 Ga0070678_100250511 Ga0070678_1002505112 216
207 3300005457 Ga0070662_100002472 Ga0070662_10000247211 216
208 3300005459 Ga0068867_100047251 Ga0068867_1000472512 216
209 3300005471 Ga0070698_100157563 Ga0070698_1001575631 216
210 3300005530 Ga0070679_100006085 Ga0070679_1000060852 216
211 3300005530 Ga0070679_100192443 Ga0070679_1001924432 216
212 3300005535 Ga0070684_100056185 Ga0070684_1000561852 216
213 3300005539 Ga0068853_100053211 Ga0068853_1000532112 216
214 3300005547 Ga0070693_100352257 Ga0070693_1003522571 216
215 3300005563 Ga0068855_100004470 Ga0068855_10000447010 216
216 3300005564 Ga0070664_100123343 Ga0070664_1001233433 216
217 3300005564 Ga0070664_100440844 Ga0070664_1004408441 216
218 3300005577 Ga0068857_100018099 Ga0068857_1000180993 216
219 3300005577 Ga0068857_100057738 Ga0068857_1000577381 216
220 3300005577 Ga0068857_100114700 Ga0068857_1001147003 216
221 3300005614 Ga0068856_100126917 Ga0068856_1001269171 216
222 3300005616 Ga0068852_100007007 Ga0068852_1000070073 216
223 3300005616 Ga0068852_100458321 Ga0068852_1004583211 216
224 3300005834 Ga0068851_10044146 Ga0068851_100441462 216
225 3300005842 Ga0068858_100744799 Ga0068858_1007447991 216
226 3300005985 Ga0081539_10018402 Ga0081539_100184022 216
227 3300006195 Ga0075366_10070576 Ga0075366_100705762 216
228 3300006195 Ga0075366_10319867 Ga0075366_103198672 216
229 3300006358 Ga0068871_100028768 Ga0068871_1000287683 216
230 3300006871 Ga0075434_100064367 Ga0075434_1000643673 216
231 3300006914 Ga0075436_100113601 Ga0075436_1001136012 216
232 3300009093 Ga0105240_10629514 Ga0105240_106295141 216
233 3300009147 Ga0114129_10005512 Ga0114129_100055122 216
234 3300009174 Ga0105241_10107885 Ga0105241_101078852 216
235 3300009177 Ga0105248_11103629 Ga0105248_111036292 216
236 3300009177 Ga0105248_11402990 Ga0105248_114029901 216
237 3300009545 Ga0105237_10566965 Ga0105237_105669651 216
238 3300009545 Ga0105237_10883440 Ga0105237_108834401 216
239 3300010375 Ga0105239_10014100 Ga0105239_100141004 216
240 3300013100 Ga0157373_10000978 Ga0157373_100009782 216
241 3300013102 Ga0157371_10001061 Ga0157371_100010615 216
242 3300013104 Ga0157370_10099357 Ga0157370_100993572 216
243 3300013104 Ga0157370_10333429 Ga0157370_103334292 216
244 3300013105 Ga0157369_10052946 Ga0157369_100529464 216
245 3300013105 Ga0157369_10056016 Ga0157369_100560164 216
246 3300013296 Ga0157374_10064307 Ga0157374_100643072 216
247 3300013296 Ga0157374_10089978 Ga0157374_100899782 216
248 3300013297 Ga0157378_10005392 Ga0157378_100053922 216
249 3300013297 Ga0157378_10040863 Ga0157378_100408632 216
250 3300013306 Ga0163162_10895910 Ga0163162_108959101 216
251 3300013307 Ga0157372_10193797 Ga0157372_101937971 216
252 3300013307 Ga0157372_10415907 Ga0157372_104159072 216
253 3300014745 Ga0157377_10411294 Ga0157377_104112941 216
254 3300025901 Ga0207688_10021329 Ga0207688_100213293 216
255 3300025903 Ga0207680_10080441 Ga0207680_100804413 216
256 3300025903 Ga0207680_10575727 Ga0207680_105757271 216
257 3300025904 Ga0207647_10000045 Ga0207647_1000004597 216
258 3300025907 Ga0207645_10032044 Ga0207645_100320443 216
259 3300025909 Ga0207705_10123331 Ga0207705_101233312 216
260 3300025912 Ga0207707_10178394 Ga0207707_101783942 216
261 3300025913 Ga0207695_10486805 Ga0207695_104868052 216
262 3300025917 Ga0207660_10319891 Ga0207660_103198912 216
263 3300025918 Ga0207662_10421701 Ga0207662_104217011 216
264 3300025919 Ga0207657_10023759 Ga0207657_100237592 216
265 3300025919 Ga0207657_10114354 Ga0207657_101143542 216
266 3300025919 Ga0207657_10438199 Ga0207657_104381992 216
267 3300025921 Ga0207652_10000160 Ga0207652_1000016025 216
268 3300025931 Ga0207644_10331488 Ga0207644_103314882 216
269 3300025932 Ga0207690_10017157 Ga0207690_100171574 216
270 3300025932 Ga0207690_10060177 Ga0207690_100601772 216
271 3300025933 Ga0207706_10015500 Ga0207706_100155004 216
272 3300025937 Ga0207669_10157449 Ga0207669_101574491 216
273 3300025942 Ga0207689_10545644 Ga0207689_105456441 216
274 3300025945 Ga0207679_10133437 Ga0207679_101334372 216
275 3300025949 Ga0207667_10015291 Ga0207667_100152915 216
276 3300025960 Ga0207651_10141165 Ga0207651_101411653 216
277 3300025986 Ga0207658_10530000 Ga0207658_105300001 216
278 3300026041 Ga0207639_10168375 Ga0207639_101683753 216
279 3300026075 Ga0207708_10144733 Ga0207708_101447332 216
280 3300026089 Ga0207648_10134661 Ga0207648_101346611 216
281 3300026116 Ga0207674_10023207 Ga0207674_100232076 216
282 3300026116 Ga0207674_10042476 Ga0207674_100424764 216
283 3300026116 Ga0207674_10075512 Ga0207674_100755122 216
284 3300026116 Ga0207674_10478069 Ga0207674_104780692 216
285 3300026118 Ga0207675_100965560 Ga0207675_1009655601 216
286 3300026142 Ga0207698_10005375 Ga0207698_100053754 216
287 3300026142 Ga0207698_10381440 Ga0207698_103814402 216
288 3300031456 Ga0307513_10117569 Ga0307513_101175692 216
289 3300031903 Ga0307407_10535202 Ga0307407_105352021 216
290 3300037312 Ga0395899_0002489 Ga0395899_0002489_6940_7602 216
291 3300037312 Ga0395899_0113259 Ga0395899_0113259_447_1109 216
292 3300037312 Ga0395899_0113264 Ga0395899_0113264_841_1503 216
293 3300037312 Ga0395899_0133951 Ga0395899_0133951_1078_1740 216
294 3300037418 Ga0395900_0002996 Ga0395900_0002996_1193_1855 216
295 3300037418 Ga0395900_0037187 Ga0395900_0037187_3803_4465 216
296 3300037418 Ga0395900_0213375 Ga0395900_0213375_446_1108 216
297 3300037418 Ga0395900_0235202 Ga0395900_0235202_732_1394 216
298 3300037466 Ga0395898_0001675 Ga0395898_0001675_28564_29226 216
299 3300037466 Ga0395898_0040570 Ga0395898_0040570_2905_3567 216
300 3300037466 Ga0395898_0042281 Ga0395898_0042281_1299_1961 216
301 3300037466 Ga0395898_0199535 Ga0395898_0199535_815_1477 216
302 3300037471 Ga0395905_0181426 Ga0395905_0181426_449_1111 216
303 3300038443 Ga0395901_0041781 Ga0395901_0041781_447_1109 216
304 3300038443 Ga0395901_0051770 Ga0395901_0051770_2194_2856 216
305 3300038443 Ga0395901_0095191 Ga0395901_0095191_1479_2141 216
306 3300041404 Ga0439436_0000463 Ga0439436_0000463_5815_6477 216
307 3300042001 Ga0439441_051278 Ga0439441_051278_108_773 216
308 3300042007 Ga0439449_0084860 Ga0439449_0084860_431_1093 216
309 3300042461 Ga0439460_0012132 Ga0439460_0012132_21_686 216
310 3300044656 Ga0466969_0002735 Ga0466969_0002735_7224_7892 216
311 3300044658 Ga0466972_0000183 Ga0466972_0000183_30412_31071 216
312 3300044684 Ga0466966_0000053 Ga0466966_0000053_52067_52735 216
313 3300044735 Ga0466968_0073890 Ga0466968_0073890_475_1143 216
314 3300044842 Ga0466957_0003621 Ga0466957_0003621_6022_6726 216
315 3300045049 Ga0466959_0000005 Ga0466959_0000005_173743_174411 216
316 3300045976 Ga0466967_0285040 Ga0466967_0285040_147_899 216
317 3300046663 Ga0495635_0156487 Ga0495635_0156487_589_1299 216
318 3300047472 Ga0495686_0011709 Ga0495686_0011709_1059_1730 216
319 3300047472 Ga0495686_0038473 Ga0495686_0038473_2275_2949 216
320 3300049571 Ga0501034_0104178 Ga0501034_0104178_191_856 216
321 3300049680 Ga0501250_000629 Ga0501250_000629_27_689 216
322 3300049688 Ga0501259_002416 Ga0501259_002416_187_849 216
323 3300049705 Ga0501225_0048116 Ga0501225_0048116_255_1049 216
324 3300049760 Ga0501263_013543 Ga0501263_013543_40_702 216
325 3300049763 Ga0501266_001020 Ga0501266_001020_110_772 216
326 3300050493 nmdc:mga0k408_115890_c1 nmdc:mga0k408_115890_c1_430_1104 216
327 3300050512 nmdc:mga0n895_198258_c1 nmdc:mga0n895_198258_c1_454_1161 216
328 3300050514 nmdc:mga08x19_127677_c1 nmdc:mga08x19_127677_c1_725_1393 216
329 3300002459 JGI24751J29686_10002883 JGI24751J29686_100028835 217
330 3300005327 Ga0070658_10000363 Ga0070658_1000036315 217
331 3300005327 Ga0070658_10057120 Ga0070658_100571202 217
332 3300005328 Ga0070676_10000103 Ga0070676_100001034 217
333 3300005328 Ga0070676_10167743 Ga0070676_101677432 217
334 3300005329 Ga0070683_100060211 Ga0070683_1000602113 217
335 3300005330 Ga0070690_100061461 Ga0070690_1000614613 217
336 3300005331 Ga0070670_100040709 Ga0070670_1000407091 217
337 3300005334 Ga0068869_100107275 Ga0068869_1001072752 217
338 3300005335 Ga0070666_10009574 Ga0070666_100095745 217
339 3300005336 Ga0070680_100002416 Ga0070680_1000024166 217
340 3300005338 Ga0068868_100000358 Ga0068868_10000035815 217
341 3300005339 Ga0070660_100871196 Ga0070660_1008711961 217
342 3300005344 Ga0070661_100057865 Ga0070661_1000578652 217
343 3300005347 Ga0070668_100000308 Ga0070668_10000030815 217
344 3300005347 Ga0070668_100697232 Ga0070668_1006972321 217
345 3300005354 Ga0070675_100409833 Ga0070675_1004098332 217
346 3300005355 Ga0070671_100255037 Ga0070671_1002550372 217
347 3300005356 Ga0070674_100322107 Ga0070674_1003221071 217
348 3300005364 Ga0070673_100000232 Ga0070673_10000023211 217
349 3300005367 Ga0070667_100000583 Ga0070667_10000058314 217
350 3300005455 Ga0070663_100088748 Ga0070663_1000887482 217
351 3300005455 Ga0070663_100296502 Ga0070663_1002965022 217
352 3300005456 Ga0070678_100061345 Ga0070678_1000613453 217
353 3300005456 Ga0070678_100170806 Ga0070678_1001708062 217
354 3300005457 Ga0070662_100003765 Ga0070662_1000037659 217
355 3300005458 Ga0070681_10014298 Ga0070681_100142983 217
356 3300005535 Ga0070684_100000251 Ga0070684_10000025116 217
357 3300005539 Ga0068853_100015341 Ga0068853_1000153414 217
358 3300005543 Ga0070672_100000345 Ga0070672_10000034513 217
359 3300005548 Ga0070665_100004255 Ga0070665_1000042552 217
360 3300005563 Ga0068855_100046876 Ga0068855_1000468761 217
361 3300005563 Ga0068855_100156908 Ga0068855_1001569082 217
362 3300005614 Ga0068856_100037746 Ga0068856_1000377462 217
363 3300005614 Ga0068856_100058387 Ga0068856_1000583872 217
364 3300005616 Ga0068852_100659415 Ga0068852_1006594152 217
365 3300005616 Ga0068852_101156020 Ga0068852_1011560201 217
366 3300005618 Ga0068864_100004460 Ga0068864_1000044606 217
367 3300005618 Ga0068864_100008678 Ga0068864_1000086782 217
368 3300005618 Ga0068864_100436712 Ga0068864_1004367121 217
369 3300005834 Ga0068851_10010581 Ga0068851_100105813 217
370 3300005841 Ga0068863_100001439 Ga0068863_10000143910 217
371 3300005842 Ga0068858_100005079 Ga0068858_1000050799 217
372 3300005843 Ga0068860_100000662 Ga0068860_10000066214 217
373 3300006237 Ga0097621_100002379 Ga0097621_1000023793 217
374 3300006358 Ga0068871_100101575 Ga0068871_1001015753 217
375 3300006844 Ga0075428_100014091 Ga0075428_1000140916 217
376 3300006844 Ga0075428_100030606 Ga0075428_1000306062 217
377 3300006846 Ga0075430_100143546 Ga0075430_1001435462 217
378 3300006880 Ga0075429_100002894 Ga0075429_1000028946 217
379 3300009093 Ga0105240_10098438 Ga0105240_100984383 217
380 3300009177 Ga0105248_10274774 Ga0105248_102747742 217
381 3300009551 Ga0105238_10922743 Ga0105238_109227432 217
382 3300009553 Ga0105249_10000682 Ga0105249_1000068215 217
383 3300011119 Ga0105246_10180273 Ga0105246_101802732 217
384 3300013102 Ga0157371_10015667 Ga0157371_100156672 217
385 3300013102 Ga0157371_10028919 Ga0157371_100289192 217
386 3300013102 Ga0157371_10649051 Ga0157371_106490511 217
387 3300013104 Ga0157370_10213393 Ga0157370_102133932 217
388 3300013104 Ga0157370_10239682 Ga0157370_102396822 217
389 3300013105 Ga0157369_11220519 Ga0157369_112205191 217
390 3300013296 Ga0157374_10000484 Ga0157374_1000048414 217
391 3300013297 Ga0157378_10012007 Ga0157378_100120077 217
392 3300013306 Ga0163162_10000484 Ga0163162_1000048414 217
393 3300013306 Ga0163162_10042174 Ga0163162_100421742 217
394 3300013306 Ga0163162_10318361 Ga0163162_103183611 217
395 3300013307 Ga0157372_10059895 Ga0157372_100598954 217
396 3300013307 Ga0157372_10139667 Ga0157372_101396672 217
397 3300013307 Ga0157372_10157503 Ga0157372_101575033 217
398 3300013307 Ga0157372_10178779 Ga0157372_101787792 217
399 3300013307 Ga0157372_10254704 Ga0157372_102547042 217
400 3300013307 Ga0157372_10654659 Ga0157372_106546592 217
401 3300013308 Ga0157375_10000619 Ga0157375_1000061914 217
402 3300014325 Ga0163163_10000499 Ga0163163_1000049914 217
403 3300014968 Ga0157379_10002615 Ga0157379_1000261514 217
404 3300014968 Ga0157379_10100040 Ga0157379_101000402 217
405 3300014969 Ga0157376_10000798 Ga0157376_100007983 217
406 3300017792 Ga0163161_10004178 Ga0163161_100041786 217
407 3300025315 Ga0207697_10086330 Ga0207697_100863303 217
408 3300025903 Ga0207680_10011113 Ga0207680_100111133 217
409 3300025904 Ga0207647_10068299 Ga0207647_100682992 217
410 3300025904 Ga0207647_10102849 Ga0207647_101028492 217
411 3300025907 Ga0207645_10001476 Ga0207645_100014765 217
412 3300025909 Ga0207705_10006001 Ga0207705_100060014 217
413 3300025909 Ga0207705_10007688 Ga0207705_100076882 217
414 3300025909 Ga0207705_10626479 Ga0207705_106264792 217
415 3300025913 Ga0207695_10115674 Ga0207695_101156742 217
416 3300025917 Ga0207660_10002253 Ga0207660_100022532 217
417 3300025919 Ga0207657_10782507 Ga0207657_107825071 217
418 3300025920 Ga0207649_10251594 Ga0207649_102515943 217
419 3300025921 Ga0207652_10001570 Ga0207652_1000157011 217
420 3300025923 Ga0207681_10459089 Ga0207681_104590892 217
421 3300025925 Ga0207650_10072941 Ga0207650_100729413 217
422 3300025926 Ga0207659_10359430 Ga0207659_103594302 217
423 3300025929 Ga0207664_10234683 Ga0207664_102346832 217
424 3300025933 Ga0207706_10023446 Ga0207706_100234463 217
425 3300025935 Ga0207709_10030470 Ga0207709_100304702 217
426 3300025940 Ga0207691_10000549 Ga0207691_1000054914 217
427 3300025941 Ga0207711_10952905 Ga0207711_109529052 217
428 3300025942 Ga0207689_10123931 Ga0207689_101239313 217
429 3300025949 Ga0207667_10033964 Ga0207667_100339642 217
430 3300025949 Ga0207667_10072873 Ga0207667_100728731 217
431 3300025960 Ga0207651_10000231 Ga0207651_100002318 217
432 3300025961 Ga0207712_10149374 Ga0207712_101493742 217
433 3300025972 Ga0207668_10000639 Ga0207668_1000063912 217
434 3300025981 Ga0207640_10584164 Ga0207640_105841642 217
435 3300025986 Ga0207658_10000942 Ga0207658_1000094215 217
436 3300026023 Ga0207677_10001537 Ga0207677_100015374 217
437 3300026041 Ga0207639_10028395 Ga0207639_100283954 217
438 3300026067 Ga0207678_10020363 Ga0207678_100203635 217
439 3300026067 Ga0207678_10314757 Ga0207678_103147572 217
440 3300026078 Ga0207702_10021847 Ga0207702_100218475 217
441 3300026078 Ga0207702_10150742 Ga0207702_101507421 217
442 3300026088 Ga0207641_10000890 Ga0207641_1000089013 217
443 3300026095 Ga0207676_10011544 Ga0207676_100115449 217
444 3300026095 Ga0207676_10041594 Ga0207676_100415942 217
445 3300026116 Ga0207674_10355615 Ga0207674_103556152 217
446 3300026121 Ga0207683_10085831 Ga0207683_100858313 217
447 3300026121 Ga0207683_10465006 Ga0207683_104650062 217
448 3300026142 Ga0207698_10210463 Ga0207698_102104632 217
449 3300026142 Ga0207698_10597464 Ga0207698_105974642 217
450 3300028379 Ga0268266_10169385 Ga0268266_101693852 217
451 3300028381 Ga0268264_10001550 Ga0268264_1000155014 217
452 3300031456 Ga0307513_10250713 Ga0307513_102507132 217
453 3300031616 Ga0307508_10000490 Ga0307508_1000049043 217
454 3300033179 Ga0307507_10249165 Ga0307507_102491652 217
455 3300035113 Ga0373936_0235011 Ga0373936_0235011_70_741 217
456 3300035725 Ga0373947_0080417 Ga0373947_0080417_170_841 217
457 3300037312 Ga0395899_0012002 Ga0395899_0012002_5490_6155 217
458 3300037312 Ga0395899_0170733 Ga0395899_0170733_310_975 217
459 3300037418 Ga0395900_0065294 Ga0395900_0065294_1458_2126 217
460 3300037418 Ga0395900_0224964 Ga0395900_0224964_368_1033 217
461 3300037466 Ga0395898_0177691 Ga0395898_0177691_1080_1745 217
462 3300037466 Ga0395898_0343107 Ga0395898_0343107_711_1376 217
463 3300037471 Ga0395905_0014794 Ga0395905_0014794_5799_6467 217
464 3300037471 Ga0395905_0021697 Ga0395905_0021697_371_1039 217
465 3300037471 Ga0395905_0827533 Ga0395905_0827533_99_767 217
466 3300038443 Ga0395901_0181268 Ga0395901_0181268_1074_1739 217
467 3300044901 Ga0466960_0282646 Ga0466960_0282646_12_677 217
468 3300046472 Ga0495580_0096192 Ga0495580_0096192_1174_1845 217
469 3300046517 Ga0495630_0045267 Ga0495630_0045267_349_1020 217
470 3300046517 Ga0495630_0388317 Ga0495630_0388317_305_976 217
471 3300046531 Ga0495665_0212687 Ga0495665_0212687_199_870 217
472 3300046543 Ga0495645_0207332 Ga0495645_0207332_86_757 217
473 3300046681 Ga0495647_0111774 Ga0495647_0111774_310_981 217
474 3300046694 Ga0495649_0162274 Ga0495649_0162274_329_1000 217
475 3300047319 Ga0495674_0012685 Ga0495674_0012685_1060_1731 217
476 3300048911 Ga0496108_0016487 Ga0496108_0016487_2647_3318 217
477 3300048912 Ga0496109_0111128 Ga0496109_0111128_1212_1883 217
478 3300049581 Ga0501047_0629745 Ga0501047_0629745_71_739 217
479 3300049703 Ga0501219_000818 Ga0501219_000818_3339_4004 217
480 3300050005 Ga0501284_00044 Ga0501284_00044_24710_25375 217
481 3300050508 nmdc:mga09592_2911_c1 nmdc:mga09592_2911_c1_6364_7035 217
482 3300053146 Ga0500588_0007343 Ga0500588_0007343_1260_1931 217
483 3300001979 JGI24740J21852_10016158 JGI24740J21852_100161582 218
484 3300005327 Ga0070658_10032568 Ga0070658_100325682 218
485 3300005327 Ga0070658_10063054 Ga0070658_100630542 218
486 3300005336 Ga0070680_100214903 Ga0070680_1002149032 218
487 3300005339 Ga0070660_100001037 Ga0070660_10000103714 218
488 3300005530 Ga0070679_100056944 Ga0070679_1000569442 218
489 3300005539 Ga0068853_100028870 Ga0068853_1000288702 218
490 3300005544 Ga0070686_100144738 Ga0070686_1001447382 218
491 3300005563 Ga0068855_100196353 Ga0068855_1001963532 218
492 3300005578 Ga0068854_100209079 Ga0068854_1002090792 218
493 3300005616 Ga0068852_100099983 Ga0068852_1000999833 218
494 3300005618 Ga0068864_100112719 Ga0068864_1001127192 218
495 3300005843 Ga0068860_100060978 Ga0068860_1000609784 218
496 3300005843 Ga0068860_100588533 Ga0068860_1005885331 218
497 3300009101 Ga0105247_10024632 Ga0105247_100246322 218
498 3300009545 Ga0105237_10009517 Ga0105237_100095173 218
499 3300010375 Ga0105239_10008049 Ga0105239_100080498 218
500 3300013102 Ga0157371_10001864 Ga0157371_100018642 218
501 3300013104 Ga0157370_10138332 Ga0157370_101383323 218
502 3300013105 Ga0157369_10461817 Ga0157369_104618172 218
503 3300013307 Ga0157372_10016543 Ga0157372_100165437 218
504 3300013307 Ga0157372_10084335 Ga0157372_100843352 218
505 3300013307 Ga0157372_10100508 Ga0157372_101005082 218
506 3300014325 Ga0163163_10037722 Ga0163163_100377226 218
507 3300025900 Ga0207710_10002155 Ga0207710_100021552 218
508 3300025904 Ga0207647_10210896 Ga0207647_102108962 218
509 3300025909 Ga0207705_10026729 Ga0207705_100267294 218
510 3300025909 Ga0207705_10031050 Ga0207705_100310502 218
511 3300025914 Ga0207671_10263316 Ga0207671_102633162 218
512 3300025917 Ga0207660_10136772 Ga0207660_101367722 218
513 3300025919 Ga0207657_10028070 Ga0207657_100280701 218
514 3300025921 Ga0207652_10005109 Ga0207652_100051096 218
515 3300026067 Ga0207678_10062988 Ga0207678_100629882 218
516 3300026078 Ga0207702_10550843 Ga0207702_105508432 218
517 3300026095 Ga0207676_10089828 Ga0207676_100898282 218
518 3300026142 Ga0207698_10049692 Ga0207698_100496923 218
519 3300026142 Ga0207698_10238002 Ga0207698_102380022 218
520 3300028380 Ga0268265_10575091 Ga0268265_105750911 218
521 3300047320 Ga0495672_0156931 Ga0495672_0156931_331_999 218
522 3300048929 Ga0496126_0744012 Ga0496126_0744012_37_735 218
523 3300005330 Ga0070690_100516950 Ga0070690_1005169501 219
524 3300005335 Ga0070666_10563175 Ga0070666_105631751 219
525 3300005355 Ga0070671_100087379 Ga0070671_1000873791 219
526 3300005367 Ga0070667_100164843 Ga0070667_1001648432 219
527 3300005456 Ga0070678_100094174 Ga0070678_1000941742 219
528 3300005718 Ga0068866_10068426 Ga0068866_100684262 219
529 3300005841 Ga0068863_100105839 Ga0068863_1001058392 219
530 3300006237 Ga0097621_100000460 Ga0097621_1000004605 219
531 3300006358 Ga0068871_100000251 Ga0068871_10000025122 219
532 3300009177 Ga0105248_10026803 Ga0105248_100268037 219
533 3300013104 Ga0157370_10000405 Ga0157370_1000040534 219
534 3300013297 Ga0157378_10009000 Ga0157378_100090004 219
535 3300013306 Ga0163162_10000628 Ga0163162_100006288 219
536 3300013308 Ga0157375_10004383 Ga0157375_100043839 219
537 3300014968 Ga0157379_10038676 Ga0157379_100386762 219
538 3300014969 Ga0157376_10000637 Ga0157376_100006378 219
539 3300014969 Ga0157376_10316897 Ga0157376_103168972 219
540 3300025921 Ga0207652_10486875 Ga0207652_104868751 219
541 3300025931 Ga0207644_10025152 Ga0207644_100251522 219
542 3300025986 Ga0207658_10169489 Ga0207658_101694891 219
543 3300026035 Ga0207703_10495775 Ga0207703_104957752 219
544 3300026088 Ga0207641_10330686 Ga0207641_103306862 219
545 3300026121 Ga0207683_10123282 Ga0207683_101232822 219
546 3300031251 Ga0265327_10030527 Ga0265327_100305274 219
547 3300044712 Ga0453684_0201178 Ga0453684_0201178_1627_2304 219
548 3300044712 Ga0453684_0206171 Ga0453684_0206171_283_951 219
549 3300047472 Ga0495686_0000016 Ga0495686_0000016_175122_175805 219
550 3300048904 Ga0496101_0211869 Ga0496101_0211869_103_783 219
551 3300048917 Ga0496114_0108349 Ga0496114_0108349_956_1636 219
552 3300003320 rootH2_10019937 rootH2_100199372 220
553 3300003320 rootH2_10150472 rootH2_101504722 220
554 3300005328 Ga0070676_10013430 Ga0070676_100134303 220
555 3300005331 Ga0070670_100073976 Ga0070670_1000739763 220
556 3300005333 Ga0070677_10063330 Ga0070677_100633302 220
557 3300005334 Ga0068869_100065844 Ga0068869_1000658442 220
558 3300005334 Ga0068869_100183454 Ga0068869_1001834542 220
559 3300005335 Ga0070666_10031556 Ga0070666_100315563 220
560 3300005336 Ga0070680_100055462 Ga0070680_1000554623 220
561 3300005337 Ga0070682_100001222 Ga0070682_10000122211 220
562 3300005338 Ga0068868_100059709 Ga0068868_1000597092 220
563 3300005341 Ga0070691_10026361 Ga0070691_100263612 220
564 3300005347 Ga0070668_100022823 Ga0070668_1000228232 220
565 3300005353 Ga0070669_100126552 Ga0070669_1001265522 220
566 3300005354 Ga0070675_100081326 Ga0070675_1000813262 220
567 3300005356 Ga0070674_100048082 Ga0070674_1000480822 220
568 3300005456 Ga0070678_100010907 Ga0070678_1000109074 220
569 3300005457 Ga0070662_100140633 Ga0070662_1001406332 220
570 3300005458 Ga0070681_10220791 Ga0070681_102207912 220
571 3300005530 Ga0070679_100015932 Ga0070679_1000159323 220
572 3300005539 Ga0068853_100597890 Ga0068853_1005978901 220
573 3300005543 Ga0070672_100237554 Ga0070672_1002375542 220
574 3300005547 Ga0070693_100002663 Ga0070693_1000026635 220
575 3300005548 Ga0070665_100008316 Ga0070665_10000831610 220
576 3300005617 Ga0068859_100223243 Ga0068859_1002232432 220
577 3300005718 Ga0068866_10014051 Ga0068866_100140513 220
578 3300005719 Ga0068861_100044777 Ga0068861_1000447772 220
579 3300005719 Ga0068861_100596444 Ga0068861_1005964441 220
580 3300005840 Ga0068870_10019937 Ga0068870_100199374 220
581 3300005844 Ga0068862_100097194 Ga0068862_1000971942 220
582 3300006358 Ga0068871_100020152 Ga0068871_1000201522 220
583 3300006358 Ga0068871_100242241 Ga0068871_1002422411 220
584 3300006931 Ga0097620_100223244 Ga0097620_1002232442 220
585 3300009093 Ga0105240_10018228 Ga0105240_100182285 220
586 3300009098 Ga0105245_10315943 Ga0105245_103159432 220
587 3300009174 Ga0105241_10003487 Ga0105241_100034874 220
588 3300009174 Ga0105241_10152420 Ga0105241_101524202 220
589 3300009176 Ga0105242_10014893 Ga0105242_100148936 220
590 3300009545 Ga0105237_10138759 Ga0105237_101387592 220
591 3300009553 Ga0105249_10014917 Ga0105249_100149172 220
592 3300009553 Ga0105249_10384826 Ga0105249_103848262 220
593 3300011119 Ga0105246_10031485 Ga0105246_100314854 220
594 3300013104 Ga0157370_10033633 Ga0157370_100336332 220
595 3300013296 Ga0157374_10171333 Ga0157374_101713332 220
596 3300013297 Ga0157378_10065592 Ga0157378_100655923 220
597 3300025315 Ga0207697_10183104 Ga0207697_101831042 220
598 3300025899 Ga0207642_10047437 Ga0207642_100474372 220
599 3300025901 Ga0207688_10033949 Ga0207688_100339493 220
600 3300025907 Ga0207645_10003649 Ga0207645_100036496 220
601 3300025908 Ga0207643_10036158 Ga0207643_100361582 220
602 3300025911 Ga0207654_10001573 Ga0207654_100015739 220
603 3300025911 Ga0207654_10172542 Ga0207654_101725422 220
604 3300025912 Ga0207707_10001470 Ga0207707_100014707 220
605 3300025913 Ga0207695_10031739 Ga0207695_100317394 220
606 3300025917 Ga0207660_10004358 Ga0207660_100043583 220
607 3300025921 Ga0207652_10001229 Ga0207652_100012299 220
608 3300025923 Ga0207681_10481851 Ga0207681_104818511 220
609 3300025925 Ga0207650_10380617 Ga0207650_103806172 220
610 3300025934 Ga0207686_10246624 Ga0207686_102466242 220
611 3300025935 Ga0207709_10305725 Ga0207709_103057252 220
612 3300025938 Ga0207704_10233363 Ga0207704_102333632 220
613 3300025940 Ga0207691_10231686 Ga0207691_102316862 220
614 3300025942 Ga0207689_10007988 Ga0207689_100079885 220
615 3300025942 Ga0207689_10035131 Ga0207689_100351313 220
616 3300025961 Ga0207712_10012826 Ga0207712_100128265 220
617 3300026023 Ga0207677_10389101 Ga0207677_103891011 220
618 3300026089 Ga0207648_10001186 Ga0207648_1000118621 220
619 3300026121 Ga0207683_10003156 Ga0207683_100031568 220
620 3300028381 Ga0268264_10037060 Ga0268264_100370602 220
621 3300031456 Ga0307513_10415778 Ga0307513_104157781 220
622 3300031548 Ga0307408_100732139 Ga0307408_1007321392 220
623 3300049744 Ga0501083_0321259 Ga0501083_0321259_35_703 220
624 3300005327 Ga0070658_10000014 Ga0070658_10000014155 221
625 3300005339 Ga0070660_100023582 Ga0070660_1000235825 221
626 3300005530 Ga0070679_100301102 Ga0070679_1003011022 221
627 3300005539 Ga0068853_100225022 Ga0068853_1002250222 221
628 3300009545 Ga0105237_10000261 Ga0105237_1000026136 221
629 3300025909 Ga0207705_10000107 Ga0207705_1000010712 221
630 3300025914 Ga0207671_10003003 Ga0207671_100030038 221
631 3300025960 Ga0207651_10461794 Ga0207651_104617941 221
632 3300026041 Ga0207639_10452397 Ga0207639_104523972 221
633 3300028381 Ga0268264_10374119 Ga0268264_103741192 221
634 3300033180 Ga0307510_10001453 Ga0307510_100014538 221
635 3300035115 Ga0373941_0002433 Ga0373941_0002433_935_1609 221
636 3300046684 Ga0495669_0156570 Ga0495669_0156570_290_964 221
637 3300049568 Ga0501031_0004805 Ga0501031_0004805_7271_7939 221
638 3300049572 Ga0501036_0029052 Ga0501036_0029052_2057_2725 221
639 3300049574 Ga0501038_0015516 Ga0501038_0015516_2817_3485 221
640 3300049579 Ga0501043_0009411 Ga0501043_0009411_6876_7544 221
641 3300049581 Ga0501047_0093282 Ga0501047_0093282_682_1350 221
642 3300049822 Ga0501035_0023385 Ga0501035_0023385_3537_4205 221
643 3300049823 Ga0501044_0020539 Ga0501044_0020539_553_1221 221
644 3300053136 Ga0500559_0088846 Ga0500559_0088846_272_949 221
645 3300053730 Ga0500645_018744 Ga0500645_018744_1159_1839 221
646 3300003316 rootH1_10018315 rootH1_100183153 222
647 3300005563 Ga0068855_100713693 Ga0068855_1007136931 222
648 3300009093 Ga0105240_10297840 Ga0105240_102978402 222
649 3300013296 Ga0157374_10008038 Ga0157374_100080389 222
650 3300025913 Ga0207695_10436891 Ga0207695_104368911 222
651 3300025941 Ga0207711_10022613 Ga0207711_100226132 222
652 3300001904 JGI24736J21556_1009994 JGI24736J21556_10099942 223
653 3300001990 JGI24737J22298_10010438 JGI24737J22298_100104383 223
654 3300003320 rootH2_10005336 rootH2_1000533686 223
655 3300003320 rootH2_10181826 rootH2_101818261 223
656 3300005327 Ga0070658_10341556 Ga0070658_103415562 223
657 3300005355 Ga0070671_100031152 Ga0070671_1000311524 223
658 3300005457 Ga0070662_100000014 Ga0070662_10000001470 223
659 3300005548 Ga0070665_100000032 Ga0070665_100000032178 223
660 3300005614 Ga0068856_100292618 Ga0068856_1002926182 223
661 3300005842 Ga0068858_100486660 Ga0068858_1004866602 223
662 3300009093 Ga0105240_10018900 Ga0105240_100189007 223
663 3300009093 Ga0105240_10116878 Ga0105240_101168783 223
664 3300009174 Ga0105241_10015592 Ga0105241_100155926 223
665 3300009551 Ga0105238_10013714 Ga0105238_100137145 223
666 3300010375 Ga0105239_10093479 Ga0105239_100934794 223
667 3300011119 Ga0105246_10062759 Ga0105246_100627592 223
668 3300013100 Ga0157373_10015926 Ga0157373_100159267 223
669 3300013102 Ga0157371_10098809 Ga0157371_100988092 223
670 3300013105 Ga0157369_10180026 Ga0157369_101800261 223
671 3300013296 Ga0157374_10000365 Ga0157374_1000036534 223
672 3300013306 Ga0163162_10000010 Ga0163162_10000010283 223
673 3300013307 Ga0157372_10031424 Ga0157372_100314245 223
674 3300013308 Ga0157375_10002043 Ga0157375_100020438 223
675 3300021361 Ga0213872_10101251 Ga0213872_101012511 223
676 3300025904 Ga0207647_10031534 Ga0207647_100315342 223
677 3300025911 Ga0207654_10038862 Ga0207654_100388622 223
678 3300025913 Ga0207695_10009594 Ga0207695_1000959410 223
679 3300025913 Ga0207695_10021017 Ga0207695_100210176 223
680 3300025914 Ga0207671_10010262 Ga0207671_100102625 223
681 3300025931 Ga0207644_10005751 Ga0207644_100057512 223
682 3300025933 Ga0207706_10000057 Ga0207706_1000005766 223
683 3300025933 Ga0207706_10108370 Ga0207706_101083702 223
684 3300025949 Ga0207667_10013351 Ga0207667_100133512 223
685 3300028379 Ga0268266_10000030 Ga0268266_10000030152 223
686 3300030521 Ga0307511_10018245 Ga0307511_100182452 223
687 3300037312 Ga0395899_0002241 Ga0395899_0002241_14845_15525 223
688 3300037418 Ga0395900_0000143 Ga0395900_0000143_29755_30435 223
689 3300037418 Ga0395900_0000284 Ga0395900_0000284_11832_12512 223
690 3300037418 Ga0395900_0599043 Ga0395900_0599043_37_717 223
691 3300037466 Ga0395898_0269051 Ga0395898_0269051_221_901 223
692 3300037471 Ga0395905_0000045 Ga0395905_0000045_240477_241157 223
693 3300039447 Ga0436361_0924736 Ga0436361_0924736_6139_6819 223
694 3300046506 Ga0495583_0098522 Ga0495583_0098522_247_927 223
695 3300046518 Ga0495631_0003227 Ga0495631_0003227_6755_7435 223
696 3300046660 Ga0495625_0253327 Ga0495625_0253327_359_1039 223
697 3300047443 Ga0495687_006354 Ga0495687_006354_3582_4262 223
698 3300053122 Ga0500608_016510 Ga0500608_016510_1707_2387 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

95

240

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rag-assembly2.cif.gz_B crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 0.3645 104 177
3a5z-assembly2.cif.gz_G crystal structure of escherichia coli genx in complex with elongation factor p 0.3404 118 168
3rag-assembly1.cif.gz_A crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 0.3212 87 177
5eys-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant f106w at ambient pressure 0.2802 51 172
5eet-assembly1.cif.gz_A crystal structure of murine neuroglobin at ambient pressure 0.2736 51 172
ID Description Score Start End Superfamily
af_A1Z856_198_303_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.328 92 174 1.10.287.70
af_P0A769_38_384_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2893 51 188 1.20.1740.10
af_Q12981_1_132_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.2861 47 183 1.20.58.70
af_A1Z856_198_303_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.273 92 174 1.10.287.70
af_Q4CNP1_460_605_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.2696 48 172 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A2V9KGY0-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9182 59 190
AF-A0A2V9IIK3-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.896 88 189
AF-A0A2E0N6S3-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8957 60 189
AF-A0A2V9QQB0-F1-model_v4 Transcriptional initiation protein Tat 0.8949 63 197
AF-A0A2E1P5L9-F1-model_v4 Uncharacterized protein 0.8908 46 191

Feature Viewer

pLDDT pTM Quality
77.74 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map