F475841

General Info

Members Datasets Scaffolds Average Seq Length
696 365 1392 211

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10048431|Ga0265330_100484312
Length 246
Sequence MPDRTPQSLSIAQRMRSLHKAASGVENASPAKFVPAKTKARRKPGPRGPRKEKSAARRDAILAAALAEFAERGFEAARLDDVARRANVAKGTIYLYFRDKQALFQELLRQMLTPIIGGIEALGAADLPVHAFVEQLVELFVREVYETPRKDVIRLMITEGRRFPKLAEFYYREVLSRIIAAVRALLSRAAARGEVPAGLVDFPQIIVAPGLLAIVWSGLFDKYEPLDVRAMMKAHVELLFAPRRAA

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
103 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
104 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
234 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
354 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
355 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
365 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.31
Nodule 0
Rhizoplane 5.32
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10048431 3300031235 Bacteria 1869
2 ARcpr5oldR_c000444 3300000041 Bacteria 5518
3 ARSoilYngRDRAFT_c00409 3300000042 Bacteria 5538
4 ARcpr5yngRDRAFT_c000424 3300000043 Bacteria 5559
5 ARSoilOldRDRAFT_c000395 3300000044 Bacteria 5402
6 ARCol0oldRDRAFT_c01154 3300000045 Bacteria 1926
7 ARCol0yngRDRAFT_1000418 3300000652 Bacteria 5543
8 JGI24752J21851_1003948 3300001976 Bacteria 1952
9 JGI24746J21847_1000185 3300001977 Bacteria 8237
10 JGI24747J21853_1002365 3300001978 Bacteria 1531
11 JGI24739J22299_10000164 3300001989 Bacteria 21825
12 JGI24745J21846_1000369 3300002073 Bacteria 3934
13 JGI24749J21850_1005843 3300002076 Bacteria 1716
14 JGI24744J21845_10011578 3300002077 Bacteria 1802
15 JGI24033J26618_1002322 3300002155 Bacteria 1938
16 JGI24751J29686_10011012 3300002459 Unclassified 1865
17 JGI25405J52794_10058386 3300003911 Bacteria 832
18 Ga0065704_10139579 3300005289 Bacteria 1532
19 Ga0065712_10105365 3300005290 Bacteria 1941
20 Ga0065715_10001682 3300005293 Bacteria 8090
21 Ga0065715_10121240 3300005293 Bacteria 2235
22 Ga0070676_10136131 3300005328 Bacteria 1559
23 Ga0070683_100000376 3300005329 Bacteria 31004
24 Ga0070683_100022026 3300005329 Bacteria 5690
25 Ga0070666_10184690 3300005335 Bacteria 1463
26 Ga0070680_100172825 3300005336 Unclassified 1819
27 Ga0070680_100500512 3300005336 Bacteria 1040
28 Ga0070682_100000141 3300005337 Bacteria 57251
29 Ga0068868_100379489 3300005338 Bacteria 1216
30 Ga0070660_100100076 3300005339 Unclassified 2295
31 Ga0070689_100003974 3300005340 Bacteria 9929
32 Ga0070691_10014449 3300005341 Bacteria 3623
33 Ga0070661_100000242 3300005344 Bacteria 44945
34 Ga0070668_100192735 3300005347 Bacteria 1670
35 Ga0070675_100000165 3300005354 Bacteria 40656
36 Ga0070675_100280831 3300005354 Bacteria 1463
37 Ga0070671_100001907 3300005355 Bacteria 15957
38 Ga0070674_100142637 3300005356 Bacteria 1799
39 Ga0070673_100001190 3300005364 Bacteria 14967
40 Ga0070673_100027376 3300005364 Bacteria 4225
41 Ga0070688_100002746 3300005365 Bacteria 8940
42 Ga0070703_10010312 3300005406 Bacteria 2632
43 Ga0070709_10633969 3300005434 Bacteria 826
44 Ga0070713_100010515 3300005436 Bacteria 6688
45 Ga0070713_100538902 3300005436 Bacteria 1104
46 Ga0070710_10013868 3300005437 Bacteria 4046
47 Ga0070710_10036184 3300005437 Bacteria 2697
48 Ga0070711_100090906 3300005439 Bacteria 2199
49 Ga0070711_100282896 3300005439 Bacteria 1313
50 Ga0070711_100367936 3300005439 Bacteria 1159
51 Ga0070705_100102590 3300005440 Bacteria 1809
52 Ga0070705_100166578 3300005440 Bacteria 1479
53 Ga0070708_100038832 3300005445 Bacteria 4162
54 Ga0070663_100012645 3300005455 Bacteria 5348
55 Ga0070663_100130562 3300005455 Bacteria 1907
56 Ga0070678_100001012 3300005456 Bacteria 14620
57 Ga0070662_100235133 3300005457 Unclassified 1467
58 Ga0068867_100050314 3300005459 Bacteria 3070
59 Ga0068867_100290654 3300005459 Unclassified 1344
60 Ga0068867_100701373 3300005459 Bacteria 893
61 Ga0070685_10000547 3300005466 Bacteria 21062
62 Ga0070707_101018000 3300005468 Bacteria 794
63 Ga0070679_100024204 3300005530 Bacteria 5950
64 Ga0070679_100641681 3300005530 Bacteria 1005
65 Ga0070679_100697948 3300005530 Bacteria 957
66 Ga0070684_100382482 3300005535 Bacteria 1296
67 Ga0070697_100201328 3300005536 Bacteria 1693
68 Ga0070672_100000527 3300005543 Bacteria 22399
69 Ga0070672_100406113 3300005543 Bacteria 1168
70 Ga0070695_100001734 3300005545 Bacteria 12268
71 Ga0070695_100007154 3300005545 Bacteria 6616
72 Ga0070695_100012588 3300005545 Bacteria 5079
73 Ga0070696_100040533 3300005546 Bacteria 3215
74 Ga0070693_100000199 3300005547 Bacteria 28265
75 Ga0070693_100013889 3300005547 Bacteria 4113
76 Ga0070665_100374166 3300005548 Bacteria 1432
77 Ga0068855_100004444 3300005563 Bacteria 17127
78 Ga0070664_100000895 3300005564 Bacteria 23168
79 Ga0070664_100006659 3300005564 Bacteria 9319
80 Ga0070664_100031100 3300005564 Bacteria 4457
81 Ga0068857_100001816 3300005577 Bacteria 17161
82 Ga0068854_100001666 3300005578 Bacteria 13522
83 Ga0068856_100001538 3300005614 Bacteria 24179
84 Ga0068856_100478856 3300005614 Bacteria 1266
85 Ga0068856_100622010 3300005614 Bacteria 1101
86 Ga0070702_100001415 3300005615 Bacteria 9801
87 Ga0070702_100700950 3300005615 Unclassified 772
88 Ga0068852_100002972 3300005616 Bacteria 11773
89 Ga0068864_100000227 3300005618 Bacteria 50765
90 Ga0068870_10000155 3300005840 Bacteria 23940
91 Ga0068863_100000495 3300005841 Bacteria 39957
92 Ga0068858_100000783 3300005842 Bacteria 33229
93 Ga0068858_100286720 3300005842 Bacteria 1569
94 Ga0068860_100022860 3300005843 Bacteria 6046
95 Ga0068860_100126276 3300005843 Bacteria 2452
96 Ga0068860_100312604 3300005843 Bacteria 1541
97 Ga0068862_100313808 3300005844 Unclassified 1445
98 Ga0081455_10006948 3300005937 Bacteria 12035
99 Ga0081455_10169393 3300005937 Bacteria 1665
100 Ga0081538_10006317 3300005981 Bacteria 10463
101 Ga0081540_1029769 3300005983 Bacteria 3036
102 Ga0081540_1067389 3300005983 Bacteria 1673
103 Ga0070717_10421408 3300006028 Bacteria 1201
104 Ga0070717_10440499 3300006028 Bacteria 1173
105 Ga0075365_10077232 3300006038 Bacteria 2250
106 Ga0075368_10000202 3300006042 Bacteria 16522
107 Ga0075368_10009591 3300006042 Bacteria 3483
108 Ga0075363_100015552 3300006048 Bacteria 3743
109 Ga0075363_100064868 3300006048 Bacteria 1973
110 Ga0075363_100082581 3300006048 Bacteria 1759
111 Ga0075432_10000464 3300006058 Bacteria 12026
112 Ga0075432_10058773 3300006058 Bacteria 1366
113 Ga0070715_10063192 3300006163 Bacteria 1631
114 Ga0070712_100365350 3300006175 Bacteria 1184
115 Ga0070712_100849664 3300006175 Bacteria 785
116 Ga0075367_10000448 3300006178 Bacteria 15330
117 Ga0075367_10126994 3300006178 Bacteria 1574
118 Ga0075367_10309065 3300006178 Bacteria 996
119 Ga0097621_100000010 3300006237 Bacteria 112867
120 Ga0097621_100038380 3300006237 Bacteria 3843
121 Ga0075370_10099418 3300006353 Bacteria 1683
122 Ga0068871_100000034 3300006358 Bacteria 71462
123 Ga0075428_100016761 3300006844 Bacteria 8090
124 Ga0075428_100156309 3300006844 Bacteria 2477
125 Ga0075428_100410294 3300006844 Bacteria 1451
126 Ga0075428_100507572 3300006844 Bacteria 1290
127 Ga0075428_100610672 3300006844 Bacteria 1164
128 Ga0075430_100005590 3300006846 Bacteria 10623
129 Ga0075430_100006793 3300006846 Bacteria 9642
130 Ga0075430_100074585 3300006846 Bacteria 2844
131 Ga0075430_100092819 3300006846 Bacteria 2523
132 Ga0075430_100178157 3300006846 Bacteria 1768
133 Ga0075430_100281040 3300006846 Bacteria 1377
134 Ga0075431_100002999 3300006847 Bacteria 16342
135 Ga0075431_100004052 3300006847 Bacteria 14278
136 Ga0075431_100010695 3300006847 Bacteria 9221
137 Ga0075431_100171407 3300006847 Bacteria 2229
138 Ga0075431_100252069 3300006847 Bacteria 1793
139 Ga0075431_100260622 3300006847 Bacteria 1759
140 Ga0075431_100395587 3300006847 Bacteria 1384
141 Ga0075431_100619943 3300006847 Bacteria 1064
142 Ga0075433_10000774 3300006852 Bacteria 21997
143 Ga0075433_10009145 3300006852 Bacteria 7912
144 Ga0075434_100001700 3300006871 Bacteria 18837
145 Ga0075434_100005910 3300006871 Bacteria 11193
146 Ga0075434_100017596 3300006871 Bacteria 6890
147 Ga0075429_100007130 3300006880 Bacteria 9709
148 Ga0075429_100208466 3300006880 Bacteria 1712
149 Ga0075429_100249590 3300006880 Bacteria 1554
150 Ga0075429_100291621 3300006880 Bacteria 1428
151 Ga0068865_100000230 3300006881 Bacteria 31147
152 Ga0068865_100460130 3300006881 Unclassified 1054
153 Ga0075435_100018036 3300007076 Bacteria 5355
154 Ga0075435_100262238 3300007076 Bacteria 1472
155 Ga0099795_10020516 3300007788 Bacteria 2154
156 Ga0105240_10412735 3300009093 Unclassified 1518
157 Ga0111539_10000932 3300009094 Bacteria 38323
158 Ga0111539_10010377 3300009094 Bacteria 11726
159 Ga0111539_10134890 3300009094 Bacteria 2891
160 Ga0111539_10361669 3300009094 Bacteria 1689
161 Ga0114129_10026350 3300009147 Bacteria 8231
162 Ga0114129_10072966 3300009147 Bacteria 4783
163 Ga0114129_10097472 3300009147 Bacteria 4071
164 Ga0114129_10124834 3300009147 Bacteria 3540
165 Ga0114129_10151517 3300009147 Bacteria 3173
166 Ga0114129_10646036 3300009147 Bacteria 1366
167 Ga0114129_10743347 3300009147 Bacteria 1256
168 Ga0114129_10970007 3300009147 Bacteria 1072
169 Ga0105241_10052670 3300009174 Bacteria 3109
170 Ga0105241_10300667 3300009174 Bacteria 1377
171 Ga0105238_10287562 3300009551 Bacteria 1626
172 Ga0105249_10018811 3300009553 Bacteria 6157
173 Ga0105249_10080288 3300009553 Bacteria 3029
174 Ga0105249_11226388 3300009553 Bacteria 821
175 Ga0099796_10075690 3300010159 Unclassified 1224
176 Ga0105239_10074122 3300010375 Bacteria 3742
177 Ga0105239_10528203 3300010375 Bacteria 1343
178 Ga0157324_1000372 3300012506 Bacteria 2076
179 Ga0157326_1001336 3300012513 Bacteria 2725
180 Ga0157338_1004402 3300012515 Bacteria 1216
181 Ga0157373_10122264 3300013100 Bacteria 1829
182 Ga0157370_10038246 3300013104 Bacteria 4642
183 Ga0157370_10501211 3300013104 Bacteria 1115
184 Ga0163162_10238564 3300013306 Bacteria 1949
185 Ga0157372_10085368 3300013307 Bacteria 3580
186 Ga0157380_10031602 3300014326 Bacteria 4065
187 Ga0157380_10156672 3300014326 Bacteria 1975
188 Ga0157379_10228435 3300014968 Bacteria 1687
189 Ga0163161_10000523 3300017792 Bacteria 31363
190 Ga0213875_10000567 3300021388 Bacteria 30137
191 Ga0207666_1000010 3300025271 Bacteria 46973
192 Ga0207673_1000265 3300025290 Bacteria 5342
193 Ga0207697_10000186 3300025315 Bacteria 32405
194 Ga0207697_10003939 3300025315 Bacteria 7220
195 Ga0207653_10006329 3300025885 Bacteria 3693
196 Ga0207682_10000123 3300025893 Bacteria 34953
197 Ga0207692_10196855 3300025898 Bacteria 1182
198 Ga0207642_10043751 3300025899 Unclassified 1978
199 Ga0207710_10002765 3300025900 Bacteria 8022
200 Ga0207688_10000889 3300025901 Bacteria 15094
201 Ga0207685_10026415 3300025905 Bacteria 2019
202 Ga0207699_10003769 3300025906 Bacteria 7238
203 Ga0207699_10043874 3300025906 Bacteria 2600
204 Ga0207645_10000023 3300025907 Bacteria 98724
205 Ga0207645_10141903 3300025907 Unclassified 1566
206 Ga0207643_10000007 3300025908 Bacteria 171706
207 Ga0207654_10006607 3300025911 Bacteria 5831
208 Ga0207654_10059928 3300025911 Unclassified 2222
209 Ga0207707_10002015 3300025912 Bacteria 18441
210 Ga0207707_10454637 3300025912 Bacteria 1095
211 Ga0207671_10053873 3300025914 Bacteria 2981
212 Ga0207671_10317139 3300025914 Bacteria 1233
213 Ga0207693_10009823 3300025915 Bacteria 7788
214 Ga0207693_10062939 3300025915 Bacteria 2907
215 Ga0207663_10059523 3300025916 Bacteria 2417
216 Ga0207663_10193802 3300025916 Bacteria 1461
217 Ga0207663_10243886 3300025916 Bacteria 1319
218 Ga0207660_10000393 3300025917 Bacteria 28822
219 Ga0207660_10050417 3300025917 Bacteria 2955
220 Ga0207660_10109916 3300025917 Bacteria 2073
221 Ga0207660_10136260 3300025917 Bacteria 1874
222 Ga0207662_10000136 3300025918 Bacteria 35258
223 Ga0207657_10035478 3300025919 Bacteria 4471
224 Ga0207649_10000434 3300025920 Bacteria 30314
225 Ga0207652_10001720 3300025921 Bacteria 19098
226 Ga0207652_10065502 3300025921 Bacteria 3146
227 Ga0207652_10066943 3300025921 Bacteria 3114
228 Ga0207681_10000273 3300025923 Bacteria 38704
229 Ga0207659_10000097 3300025926 Bacteria 51545
230 Ga0207687_10001031 3300025927 Bacteria 18938
231 Ga0207700_10019506 3300025928 Bacteria 4580
232 Ga0207664_10470213 3300025929 Bacteria 1124
233 Ga0207644_10005450 3300025931 Bacteria 8289
234 Ga0207690_10000962 3300025932 Bacteria 18398
235 Ga0207690_10176703 3300025932 Bacteria 1604
236 Ga0207706_10000867 3300025933 Bacteria 31142
237 Ga0207706_10023602 3300025933 Bacteria 5522
238 Ga0207706_10271666 3300025933 Unclassified 1479
239 Ga0207686_10002591 3300025934 Bacteria 9812
240 Ga0207686_10020419 3300025934 Bacteria 3784
241 Ga0207709_10007329 3300025935 Bacteria 6150
242 Ga0207709_10047675 3300025935 Bacteria 2606
243 Ga0207670_10000536 3300025936 Bacteria 20898
244 Ga0207669_10001135 3300025937 Bacteria 11370
245 Ga0207669_10082800 3300025937 Bacteria 2061
246 Ga0207669_10094150 3300025937 Bacteria 1959
247 Ga0207704_10000119 3300025938 Bacteria 43208
248 Ga0207665_10103561 3300025939 Bacteria 1991
249 Ga0207691_10000544 3300025940 Bacteria 37754
250 Ga0207711_10002468 3300025941 Bacteria 16502
251 Ga0207711_10235409 3300025941 Bacteria 1678
252 Ga0207689_10001743 3300025942 Bacteria 20521
253 Ga0207661_10000785 3300025944 Bacteria 20682
254 Ga0207661_10080161 3300025944 Bacteria 2693
255 Ga0207679_10000029 3300025945 Bacteria 183002
256 Ga0207667_10016422 3300025949 Bacteria 8368
257 Ga0207651_10000083 3300025960 Bacteria 42310
258 Ga0207712_10000471 3300025961 Bacteria 33929
259 Ga0207712_10313237 3300025961 Bacteria 1292
260 Ga0207668_10000862 3300025972 Bacteria 18292
261 Ga0207658_10002203 3300025986 Bacteria 14473
262 Ga0207677_10000992 3300026023 Bacteria 15647
263 Ga0207703_10088692 3300026035 Bacteria 2596
264 Ga0207639_10004451 3300026041 Bacteria 9457
265 Ga0207678_10001568 3300026067 Bacteria 21015
266 Ga0207708_10002060 3300026075 Bacteria 14813
267 Ga0207708_10163360 3300026075 Bacteria 1759
268 Ga0207702_10003639 3300026078 Bacteria 13965
269 Ga0207702_10421742 3300026078 Bacteria 1290
270 Ga0207702_11047310 3300026078 Bacteria 809
271 Ga0207641_10000510 3300026088 Bacteria 43699
272 Ga0207648_10002351 3300026089 Bacteria 20407
273 Ga0207648_10739767 3300026089 Bacteria 913
274 Ga0207676_10003788 3300026095 Bacteria 10694
275 Ga0207674_10000608 3300026116 Bacteria 46971
276 Ga0207675_100000805 3300026118 Bacteria 31142
277 Ga0207675_100049572 3300026118 Bacteria 3918
278 Ga0207675_100172777 3300026118 Bacteria 2066
279 Ga0207683_10000082 3300026121 Bacteria 74842
280 Ga0207698_10000377 3300026142 Bacteria 25983
281 Ga0207698_10257026 3300026142 Bacteria 1602
282 Ga0209999_1021261 3300027543 Unclassified 1191
283 Ga0209971_1007895 3300027682 Bacteria 2525
284 Ga0209966_1000761 3300027695 Bacteria 6647
285 Ga0209998_10001920 3300027717 Bacteria 4889
286 Ga0209998_10005097 3300027717 Bacteria 2759
287 Ga0209813_10004851 3300027866 Bacteria 3233
288 Ga0209974_10004757 3300027876 Bacteria 4820
289 Ga0207428_10000124 3300027907 Bacteria 105795
290 Ga0207428_10000420 3300027907 Bacteria 52679
291 Ga0207428_10000703 3300027907 Bacteria 38851
292 Ga0207428_10040025 3300027907 Bacteria 3804
293 Ga0268265_10001170 3300028380 Bacteria 22993
294 Ga0268265_10322200 3300028380 Bacteria 1400
295 Ga0268265_10335815 3300028380 Bacteria 1374
296 Ga0268264_10001878 3300028381 Bacteria 19073
297 Ga0268264_10080791 3300028381 Bacteria 2777
298 Ga0268264_10196448 3300028381 Bacteria 1842
299 Ga0268264_10646488 3300028381 Bacteria 1046
300 Ga0265332_10001311 3300031238 Bacteria 14161
301 Ga0265325_10000105 3300031241 Bacteria 59642
302 Ga0265325_10007640 3300031241 Bacteria 6463
303 Ga0265325_10026904 3300031241 Bacteria 3112
304 Ga0265340_10069909 3300031247 Bacteria 1666
305 Ga0265339_10002938 3300031249 Bacteria 12049
306 Ga0265339_10004703 3300031249 Bacteria 9264
307 Ga0265316_10133683 3300031344 Bacteria 1867
308 Ga0265313_10000041 3300031595 Bacteria 119119
309 Ga0265313_10005622 3300031595 Bacteria 9166
310 Ga0265313_10014009 3300031595 Bacteria 4774
311 Ga0265314_10000279 3300031711 Bacteria 74300
312 Ga0265314_10010302 3300031711 Bacteria 7807
313 Ga0265342_10000287 3300031712 Bacteria 57222
314 Ga0307416_100252012 3300032002 Bacteria 1719
315 Ga0373930_0000557 3300034816 Bacteria 5130
316 Ga0373930_0003558 3300034816 Bacteria 2478
317 Ga0373950_0042416 3300034818 Bacteria 874
318 Ga0373958_0001091 3300034819 Bacteria 3577
319 Ga0373959_0001344 3300034820 Bacteria 3926
320 Ga0373959_0005481 3300034820 Bacteria 2081
321 Ga0373938_0000092 3300034957 Bacteria 12211
322 Ga0373938_0004552 3300034957 Bacteria 2323
323 Ga0373926_0002897 3300035083 Bacteria 5500
324 Ga0373928_0000404 3300035084 Bacteria 8588
325 Ga0373929_0000856 3300035085 Bacteria 5927
326 Ga0373929_0019904 3300035085 Unclassified 1348
327 Ga0373934_0014603 3300035086 Bacteria 2977
328 Ga0373940_0000069 3300035088 Bacteria 11756
329 Ga0373944_0000522 3300035089 Bacteria 9004
330 Ga0373949_0002201 3300035090 Bacteria 5100
331 Ga0373949_0003185 3300035090 Bacteria 3988
332 Ga0373951_0005474 3300035091 Bacteria 2950
333 Ga0373952_0001123 3300035092 Bacteria 4891
334 Ga0373952_0002122 3300035092 Bacteria 3563
335 Ga0373923_0000908 3300035111 Bacteria 7900
336 Ga0373923_0012499 3300035111 Bacteria 3139
337 Ga0373932_0000510 3300035112 Bacteria 11939
338 Ga0373932_0076146 3300035112 Unclassified 1051
339 Ga0373936_0013341 3300035113 Bacteria 3136
340 Ga0373936_0017209 3300035113 Bacteria 2782
341 Ga0373939_0002803 3300035114 Bacteria 4090
342 Ga0373939_0044377 3300035114 Bacteria 1353
343 Ga0373941_0000855 3300035115 Bacteria 6273
344 Ga0373941_0002011 3300035115 Bacteria 4408
345 Ga0373941_0003910 3300035115 Bacteria 3413
346 Ga0373945_0000687 3300035116 Bacteria 9768
347 Ga0373956_0003018 3300035119 Bacteria 6820
348 Ga0373956_0017796 3300035119 Bacteria 3002
349 Ga0373957_0118942 3300035120 Bacteria 1068
350 Ga0373960_0002095 3300035121 Bacteria 4490
351 Ga0373960_0051174 3300035121 Bacteria 1226
352 Ga0373943_0078240 3300035170 Bacteria 1690
353 Ga0373943_0094844 3300035170 Bacteria 1551
354 Ga0373946_0070176 3300035171 Unclassified 1511
355 Ga0373955_0006189 3300035172 Bacteria 5443
356 Ga0373942_0001103 3300035207 Bacteria 7179
357 Ga0373961_0000636 3300035241 Bacteria 12674
358 Ga0373961_0005849 3300035241 Bacteria 2954
359 Ga0373961_0079517 3300035241 Unclassified 1029
360 Ga0373962_0054149 3300035242 Bacteria 1163
361 Ga0373962_0060521 3300035242 Bacteria 1111
362 Ga0373924_0027294 3300035410 Bacteria 2270
363 Ga0373924_0089884 3300035410 Bacteria 1313
364 Ga0373931_0000186 3300035691 Bacteria 26950
365 Ga0373931_0001154 3300035691 Bacteria 11223
366 Ga0373931_0003707 3300035691 Bacteria 6911
367 Ga0373931_0032737 3300035691 Bacteria 2691
368 Ga0373935_0032811 3300035692 Bacteria 3228
369 Ga0373935_0124844 3300035692 Bacteria 1723
370 Ga0373927_0006188 3300035695 Bacteria 8178
371 Ga0373927_0123446 3300035695 Bacteria 1690
372 Ga0373933_0004423 3300035724 Bacteria 7714
373 Ga0373933_0012736 3300035724 Bacteria 4650
374 Ga0373947_0039335 3300035725 Bacteria 2813
375 Ga0373937_0011291 3300036401 Bacteria 7833
376 Ga0373937_0019099 3300036401 Bacteria 6133
377 Ga0373937_0019441 3300036401 Bacteria 6080
378 Ga0373937_0020009 3300036401 Bacteria 5995
379 Ga0373937_0062979 3300036401 Bacteria 3410
380 Ga0373925_0033046 3300037068 Bacteria 3812
381 Ga0373925_0040062 3300037068 Bacteria 3467
382 Ga0373925_0115602 3300037068 Bacteria 2077
383 Ga0373925_0334949 3300037068 Unclassified 1226
384 Ga0373925_0402059 3300037068 Bacteria 1117
385 Ga0436364_0045028 3300037853 Bacteria 9121
386 Ga0242420_004233 3300038996 Bacteria 2161
387 Ga0436361_0405803 3300039447 Bacteria 1009
388 Ga0436363_0770944 3300039450 Bacteria 1322
389 Ga0436362_0112778 3300039453 Bacteria 755
390 Ga0439441_015523 3300042001 Unclassified 1348
391 Ga0439455_0010858 3300042012 Bacteria 2013
392 Ga0451577_0048381 3300042876 Bacteria 3799
393 Ga0451576_0052484 3300045051 Bacteria 4272
394 Ga0495592_0001116 3300046454 Bacteria 18677
395 Ga0495592_0008124 3300046454 Bacteria 7881
396 Ga0495592_0028640 3300046454 Bacteria 4217
397 Ga0495592_0169115 3300046454 Bacteria 1498
398 Ga0495603_0008589 3300046455 Bacteria 6173
399 Ga0495603_0040127 3300046455 Bacteria 2803
400 Ga0495629_0061155 3300046459 Bacteria 2631
401 Ga0495629_0162800 3300046459 Bacteria 1549
402 Ga0495638_0041088 3300046460 Bacteria 2928
403 Ga0495641_0021653 3300046461 Bacteria 3230
404 Ga0495641_0110662 3300046461 Bacteria 1226
405 Ga0495651_0000493 3300046462 Bacteria 30523
406 Ga0495651_0003892 3300046462 Bacteria 11420
407 Ga0495651_0006050 3300046462 Bacteria 9238
408 Ga0495653_0004657 3300046463 Bacteria 11097
409 Ga0495653_0174008 3300046463 Bacteria 1483
410 Ga0495580_0021831 3300046472 Bacteria 4721
411 Ga0495582_0001705 3300046473 Bacteria 12400
412 Ga0495582_0024557 3300046473 Bacteria 3299
413 Ga0495639_0047948 3300046475 Bacteria 1936
414 Ga0495662_0009334 3300046476 Bacteria 4811
415 Ga0495664_0001609 3300046477 Bacteria 12011
416 Ga0495585_0003281 3300046492 Bacteria 11009
417 Ga0495594_0022175 3300046499 Bacteria 3395
418 Ga0495607_0004288 3300046501 Bacteria 10532
419 Ga0495608_0088519 3300046511 Bacteria 2004
420 Ga0495618_0015490 3300046514 Bacteria 4653
421 Ga0495628_0002046 3300046516 Bacteria 18273
422 Ga0495628_0014402 3300046516 Bacteria 6630
423 Ga0495630_0036431 3300046517 Bacteria 3678
424 Ga0495630_0065419 3300046517 Bacteria 2732
425 Ga0495630_0143743 3300046517 Bacteria 1814
426 Ga0495644_0000514 3300046523 Bacteria 16546
427 Ga0495666_0001847 3300046526 Bacteria 10463
428 Ga0495666_0016564 3300046526 Bacteria 3672
429 Ga0495652_0011016 3300046529 Bacteria 8193
430 Ga0495652_0143441 3300046529 Bacteria 1875
431 Ga0495652_0325251 3300046529 Bacteria 1109
432 Ga0495665_0026043 3300046531 Bacteria 3141
433 Ga0495640_0019454 3300046533 Bacteria 5011
434 Ga0495640_0036686 3300046533 Bacteria 3462
435 Ga0495640_0038267 3300046533 Bacteria 3375
436 Ga0495640_0153691 3300046533 Bacteria 1477
437 Ga0495587_0016309 3300046536 Bacteria 4623
438 Ga0495587_0016489 3300046536 Bacteria 4595
439 Ga0495587_0020228 3300046536 Bacteria 4111
440 Ga0495645_0001781 3300046543 Bacteria 14625
441 Ga0495645_0009419 3300046543 Bacteria 6824
442 Ga0495645_0312691 3300046543 Bacteria 1022
443 Ga0495622_0012353 3300046557 Bacteria 3952
444 Ga0495622_0148178 3300046557 Bacteria 1063
445 Ga0495667_0002342 3300046559 Bacteria 12672
446 Ga0495667_0011331 3300046559 Bacteria 6037
447 Ga0495667_0037159 3300046559 Bacteria 3246
448 Ga0495667_0052769 3300046559 Bacteria 2678
449 Ga0495656_0001283 3300046615 Bacteria 8165
450 Ga0495634_0063424 3300046642 Bacteria 2452
451 Ga0495634_0088224 3300046642 Bacteria 2018
452 Ga0495634_0096170 3300046642 Bacteria 1918
453 Ga0495625_0193799 3300046660 Bacteria 1345
454 Ga0495635_0000736 3300046663 Bacteria 21173
455 Ga0495635_0004379 3300046663 Bacteria 9778
456 Ga0495659_0056880 3300046664 Bacteria 1436
457 Ga0495661_0056198 3300046665 Bacteria 2356
458 Ga0495588_0018157 3300046674 Bacteria 3425
459 Ga0495588_0080669 3300046674 Unclassified 1698
460 Ga0495657_0007642 3300046675 Bacteria 8326
461 Ga0495657_0172100 3300046675 Unclassified 1333
462 Ga0495599_0002064 3300046678 Bacteria 11642
463 Ga0495599_0002943 3300046678 Bacteria 9902
464 Ga0495599_0003364 3300046678 Bacteria 9345
465 Ga0495623_0002286 3300046679 Bacteria 12776
466 Ga0495623_0159369 3300046679 Bacteria 1327
467 Ga0495646_0000229 3300046680 Bacteria 27971
468 Ga0495646_0006372 3300046680 Bacteria 7484
469 Ga0495647_0004269 3300046681 Bacteria 4629
470 Ga0495647_0185620 3300046681 Bacteria 906
471 Ga0495658_0002748 3300046683 Bacteria 8846
472 Ga0495613_0143415 3300046689 Bacteria 1705
473 Ga0495613_0182060 3300046689 Unclassified 1487
474 Ga0495624_0117309 3300046690 Bacteria 1635
475 Ga0495624_0234738 3300046690 Bacteria 1110
476 Ga0495624_0561834 3300046690 Bacteria 681
477 Ga0495670_0009490 3300046691 Bacteria 4782
478 Ga0495671_0220449 3300046692 Unclassified 918
479 Ga0495600_0003589 3300046809 Bacteria 9137
480 Ga0495600_0032196 3300046809 Bacteria 3401
481 Ga0495600_0073671 3300046809 Unclassified 2230
482 Ga0495600_0121281 3300046809 Unclassified 1700
483 Ga0495581_0005348 3300047315 Bacteria 7424
484 Ga0495581_0260995 3300047315 Bacteria 1013
485 Ga0495581_0301288 3300047315 Unclassified 937
486 Ga0495604_0009381 3300047317 Bacteria 7740
487 Ga0495604_0119859 3300047317 Bacteria 1906
488 Ga0495604_0243196 3300047317 Unclassified 1229
489 Ga0495674_0013071 3300047319 Bacteria 7811
490 Ga0495674_0030389 3300047319 Bacteria 4912
491 Ga0495674_0039235 3300047319 Bacteria 4246
492 Ga0495676_0122104 3300047321 Unclassified 1893
493 Ga0495676_0159434 3300047321 Bacteria 1597
494 Ga0495680_0005567 3300047322 Bacteria 11823
495 Ga0495680_0029672 3300047322 Bacteria 4476
496 Ga0495680_0047393 3300047322 Bacteria 3381
497 Ga0495680_0118574 3300047322 Bacteria 1955
498 Ga0495675_0013037 3300047444 Bacteria 5241
499 Ga0495675_0030741 3300047444 Bacteria 3427
500 Ga0495684_0006324 3300047471 Bacteria 9204
501 Ga0495684_0139589 3300047471 Unclassified 1817
502 Ga0495593_0122577 3300047673 Unclassified 1322
503 Ga0495602_0006950 3300048088 Bacteria 11884
504 Ga0495602_0253115 3300048088 Bacteria 1311
505 Ga0496100_0000057 3300048903 Bacteria 67216
506 Ga0496101_0001297 3300048904 Bacteria 14944
507 Ga0496101_0097328 3300048904 Bacteria 2197
508 Ga0496102_0001628 3300048905 Bacteria 19791
509 Ga0496102_0018224 3300048905 Bacteria 6164
510 Ga0496103_0003173 3300048906 Bacteria 10102
511 Ga0496103_0011059 3300048906 Bacteria 5344
512 Ga0496104_0000932 3300048907 Bacteria 25092
513 Ga0496104_0041108 3300048907 Bacteria 4334
514 Ga0496104_0388188 3300048907 Bacteria 1308
515 Ga0496105_0019215 3300048908 Bacteria 5510
516 Ga0496105_0021279 3300048908 Bacteria 5248
517 Ga0496106_0000518 3300048909 Bacteria 27401
518 Ga0496107_0001129 3300048910 Bacteria 16115
519 Ga0496107_0005941 3300048910 Bacteria 8366
520 Ga0496107_0116749 3300048910 Bacteria 1965
521 Ga0496107_0255663 3300048910 Bacteria 1303
522 Ga0496108_0004254 3300048911 Bacteria 11528
523 Ga0496108_0021395 3300048911 Bacteria 5316
524 Ga0496108_0051769 3300048911 Bacteria 3440
525 Ga0496109_0002432 3300048912 Bacteria 15587
526 Ga0496109_0003961 3300048912 Bacteria 12362
527 Ga0496110_0001450 3300048913 Bacteria 17181
528 Ga0496110_0022934 3300048913 Bacteria 5305
529 Ga0496111_0018065 3300048914 Bacteria 4879
530 Ga0496112_0105119 3300048915 Bacteria 2793
531 Ga0496112_0254183 3300048915 Bacteria 1708
532 Ga0496112_0555072 3300048915 Bacteria 1082
533 Ga0496113_0016626 3300048916 Bacteria 5086
534 Ga0496113_0030441 3300048916 Bacteria 3907
535 Ga0496113_0388473 3300048916 Bacteria 1120
536 Ga0496114_0002944 3300048917 Bacteria 13059
537 Ga0496114_0355728 3300048917 Bacteria 1295
538 Ga0496115_0002786 3300048918 Bacteria 12565
539 Ga0496115_0014635 3300048918 Bacteria 5941
540 Ga0496115_0032489 3300048918 Bacteria 4116
541 Ga0496115_0203225 3300048918 Bacteria 1636
542 Ga0501032_0048692 3300049569 Bacteria 2861
543 Ga0501032_0494396 3300049569 Bacteria 782
544 Ga0501033_0055047 3300049570 Bacteria 2941
545 Ga0501033_0496149 3300049570 Unclassified 845
546 Ga0501034_0000032 3300049571 Bacteria 243763
547 Ga0501034_0010486 3300049571 Bacteria 9648
548 Ga0501034_0329514 3300049571 Bacteria 1458
549 Ga0501036_0018617 3300049572 Bacteria 5822
550 Ga0501036_0252883 3300049572 Bacteria 1476
551 Ga0501036_0361312 3300049572 Bacteria 1212
552 Ga0501037_0044551 3300049573 Bacteria 3258
553 Ga0501037_0072595 3300049573 Bacteria 2502
554 Ga0501038_0049211 3300049574 Bacteria 3645
555 Ga0501038_0072882 3300049574 Bacteria 2909
556 Ga0501038_0090742 3300049574 Bacteria 2560
557 Ga0501038_0149411 3300049574 Bacteria 1905
558 Ga0501039_0248605 3300049575 Unclassified 1398
559 Ga0501040_0127488 3300049576 Unclassified 1788
560 Ga0501043_0008265 3300049579 Bacteria 8200
561 Ga0501043_0184985 3300049579 Bacteria 1622
562 Ga0501046_0023608 3300049580 Bacteria 5055
563 Ga0501046_0093007 3300049580 Unclassified 2318
564 Ga0501047_0018542 3300049581 Bacteria 6674
565 Ga0501047_0213511 3300049581 Bacteria 1787
566 Ga0501047_0295188 3300049581 Bacteria 1464
567 Ga0501047_0484377 3300049581 Unclassified 1064
568 Ga0501048_0034404 3300049582 Bacteria 3655
569 Ga0501048_0127043 3300049582 Bacteria 1803
570 Ga0501048_0163293 3300049582 Unclassified 1577
571 Ga0501048_0420371 3300049582 Bacteria 956
572 Ga0501067_0077169 3300049583 Bacteria 1846
573 Ga0501068_0078727 3300049584 Bacteria 2020
574 Ga0501069_0029376 3300049585 Bacteria 3016
575 Ga0501069_0224883 3300049585 Bacteria 1091
576 Ga0501070_0002759 3300049586 Bacteria 15326
577 Ga0501070_0008780 3300049586 Bacteria 8545
578 Ga0501070_0087816 3300049586 Bacteria 2573
579 Ga0501070_0119058 3300049586 Bacteria 2182
580 Ga0501070_0171930 3300049586 Bacteria 1784
581 Ga0501070_0198571 3300049586 Bacteria 1647
582 Ga0501071_0023874 3300049587 Bacteria 4273
583 Ga0501073_0178582 3300049589 Bacteria 1469
584 Ga0501073_0182827 3300049589 Bacteria 1451
585 Ga0501074_0068958 3300049590 Bacteria 2542
586 Ga0501074_0071152 3300049590 Bacteria 2500
587 Ga0501075_0123637 3300049591 Bacteria 1970
588 Ga0501075_0128050 3300049591 Bacteria 1933
589 Ga0501076_0114009 3300049592 Bacteria 2187
590 Ga0501076_0344339 3300049592 Bacteria 1224
591 Ga0501077_0006238 3300049593 Bacteria 7290
592 Ga0501077_0037633 3300049593 Bacteria 3081
593 Ga0501077_0415267 3300049593 Bacteria 861
594 Ga0501079_0056842 3300049741 Bacteria 3019
595 Ga0501079_0162003 3300049741 Bacteria 1744
596 Ga0501079_0213286 3300049741 Bacteria 1508
597 Ga0501079_0290421 3300049741 Bacteria 1279
598 Ga0501079_0340247 3300049741 Bacteria 1175
599 Ga0501080_0010850 3300049742 Bacteria 8338
600 Ga0501080_0011076 3300049742 Bacteria 8251
601 Ga0501080_0033206 3300049742 Bacteria 4817
602 Ga0501080_0112526 3300049742 Bacteria 2523
603 Ga0501080_0221649 3300049742 Bacteria 1730
604 Ga0501080_0390695 3300049742 Bacteria 1252
605 Ga0501080_0465967 3300049742 Bacteria 1131
606 Ga0501081_0111528 3300049743 Unclassified 1941
607 Ga0501081_0135744 3300049743 Bacteria 1761
608 Ga0501081_0153227 3300049743 Bacteria 1657
609 Ga0501083_0031088 3300049744 Bacteria 3664
610 Ga0501035_0006636 3300049822 Bacteria 10831
611 Ga0501035_0014779 3300049822 Bacteria 7209
612 Ga0501035_0054697 3300049822 Bacteria 3565
613 Ga0501044_0145021 3300049823 Bacteria 2360
614 Ga0501044_0212639 3300049823 Bacteria 1887
615 Ga0501044_0593938 3300049823 Unclassified 1001
616 nmdc:mga03n38_151576_c1 3300050490 Bacteria 1167
617 nmdc:mga03n38_343496_c1 3300050490 Bacteria 811
618 nmdc:mga00v17_22620_c1 3300050491 Bacteria 3629
619 nmdc:mga0yw44_30618_c1 3300050492 Bacteria 3121
620 nmdc:mga06z11_258810_c1 3300050494 Bacteria 1026
621 nmdc:mga06z11_4530_c1 3300050494 Bacteria 5475
622 nmdc:mga06z11_4532_c1 3300050494 Bacteria 5473
623 nmdc:mga04h51_1364_c1 3300050495 Bacteria 5619
624 nmdc:mga04h51_5630_c1 3300050495 Bacteria 3203
625 nmdc:mga04h51_5885_c1 3300050495 Bacteria 3146
626 nmdc:mga05p37_215357_c1 3300050507 Bacteria 2320
627 nmdc:mga05p37_237562_c1 3300050507 Bacteria 2193
628 nmdc:mga05p37_262753_c1 3300050507 Bacteria 2065
629 nmdc:mga05p37_30390_c1 3300050507 Bacteria 6592
630 nmdc:mga05p37_45_c2 3300050507 Bacteria 24882
631 nmdc:mga05p37_754683_c1 3300050507 Bacteria 1072
632 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
633 nmdc:mga09592_155375_c1 3300050508 Bacteria 1975
634 nmdc:mga09592_167284_c1 3300050508 Bacteria 1901
635 nmdc:mga09592_255888_c1 3300050508 Bacteria 1518
636 nmdc:mga09592_62062_c1 3300050508 Bacteria 3161
637 nmdc:mga0qj67_11495_c1 3300050509 Bacteria 6634
638 nmdc:mga0qj67_195263_c1 3300050509 Bacteria 1645
639 nmdc:mga0qj67_263608_c1 3300050509 Bacteria 1398
640 nmdc:mga0qj67_336435_c1 3300050509 Bacteria 1221
641 nmdc:mga0qj67_53714_c1 3300050509 Bacteria 3190
642 nmdc:mga0qj67_701_c1 3300050509 Bacteria 22836
643 nmdc:mga06r32_101841_c1 3300050510 Bacteria 2819
644 nmdc:mga06r32_12918_c1 3300050510 Bacteria 7549
645 nmdc:mga06r32_170835_c1 3300050510 Bacteria 2158
646 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
647 nmdc:mga06r32_295679_c1 3300050510 Bacteria 1606
648 nmdc:mga06r32_368433_c1 3300050510 Bacteria 1420
649 nmdc:mga06r32_443833_c1 3300050510 Bacteria 1278
650 nmdc:mga08y16_1134_c1 3300050511 Bacteria 26246
651 nmdc:mga08y16_12172_c1 3300050511 Bacteria 9043
652 nmdc:mga08y16_190186_c1 3300050511 Bacteria 2129
653 nmdc:mga08y16_1989_c1 3300050511 Bacteria 20867
654 nmdc:mga08y16_278261_c1 3300050511 Bacteria 1727
655 nmdc:mga0n895_20617_c1 3300050512 Bacteria 6151
656 nmdc:mga0n895_3165_c1 3300050512 Bacteria 13152
657 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
658 nmdc:mga0rr50_12507_c1 3300050513 Bacteria 5490
659 nmdc:mga0rr50_2855_c1 3300050513 Bacteria 9829
660 nmdc:mga0rr50_68891_c1 3300050513 Bacteria 2691
661 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
662 nmdc:mga0a205_5479_c1 3300050515 Bacteria 11429
663 nmdc:mga0a205_77964_c1 3300050515 Bacteria 3201
664 Ga0495601_0004041 3300053077 Bacteria 8454
665 Ga0495601_0005795 3300053077 Bacteria 7201
666 Ga0495601_0032428 3300053077 Bacteria 3252
667 Ga0495601_0066837 3300053077 Unclassified 2288
668 Ga0495612_0006019 3300053078 Bacteria 4997
669 Ga0495612_0007152 3300053078 Bacteria 4566
670 Ga0495612_0023069 3300053078 Bacteria 2495
671 Ga0495595_0000577 3300053084 Bacteria 14028
672 Ga0495595_0002620 3300053084 Bacteria 7052
673 Ga0495595_0005520 3300053084 Bacteria 5121
674 Ga0495619_0000260 3300053085 Bacteria 38574
675 Ga0495619_0000655 3300053085 Bacteria 22730
676 Ga0495619_0014245 3300053085 Bacteria 5023
677 Ga0495619_0021990 3300053085 Bacteria 4076
678 Ga0495619_0064595 3300053085 Bacteria 2440
679 Ga0500643_006415 3300053087 Bacteria 4918
680 Ga0500644_0000301 3300053088 Bacteria 26471
681 Ga0500646_0084823 3300053090 Bacteria 972
682 Ga0500651_0032130 3300053093 Bacteria 3308
683 Ga0500566_0008779 3300053094 Bacteria 5977
684 Ga0500555_019795 3300053103 Bacteria 1938
685 Ga0500595_000144 3300053119 Bacteria 46478
686 Ga0500616_0000006 3300053153 Bacteria 944738
687 Ga0500645_000946 3300053730 Bacteria 16529
688 Ga0501084_0003952 3300054114 Bacteria 12073
689 Ga0501084_0084712 3300054114 Bacteria 2661
690 Ga0501084_0336514 3300054114 Unclassified 1275
691 Ga0501082_0075827 3300060353 Bacteria 2897
692 Ga0501082_0168739 3300060353 Bacteria 1902
693 Ga0501082_0672856 3300060353 Bacteria 906
694 Ga0501082_0955700 3300060353 Bacteria 749
695 Ga0530510_0021687 3300061734 Bacteria 4570
696 2643755554 2643221547 Bacteria 4740017
697 Ga0265330_10048431
698 ARcpr5oldR_c000444
699 ARSoilYngRDRAFT_c00409
700 ARcpr5yngRDRAFT_c000424
701 ARSoilOldRDRAFT_c000395
702 ARCol0oldRDRAFT_c01154
703 ARCol0yngRDRAFT_1000418
704 JGI24752J21851_1003948
705 JGI24746J21847_1000185
706 JGI24747J21853_1002365
707 JGI24739J22299_10000164
708 JGI24745J21846_1000369
709 JGI24749J21850_1005843
710 JGI24744J21845_10011578
711 JGI24033J26618_1002322
712 JGI24751J29686_10011012
713 JGI25405J52794_10058386
714 Ga0065704_10139579
715 Ga0065712_10105365
716 Ga0065715_10001682
717 Ga0065715_10121240
718 Ga0070676_10136131
719 Ga0070683_100000376
720 Ga0070683_100022026
721 Ga0070666_10184690
722 Ga0070680_100172825
723 Ga0070680_100500512
724 Ga0070682_100000141
725 Ga0068868_100379489
726 Ga0070660_100100076
727 Ga0070689_100003974
728 Ga0070691_10014449
729 Ga0070661_100000242
730 Ga0070668_100192735
731 Ga0070675_100000165
732 Ga0070675_100280831
733 Ga0070671_100001907
734 Ga0070674_100142637
735 Ga0070673_100001190
736 Ga0070673_100027376
737 Ga0070688_100002746
738 Ga0070703_10010312
739 Ga0070709_10633969
740 Ga0070713_100010515
741 Ga0070713_100538902
742 Ga0070710_10013868
743 Ga0070710_10036184
744 Ga0070711_100090906
745 Ga0070711_100282896
746 Ga0070711_100367936
747 Ga0070705_100102590
748 Ga0070705_100166578
749 Ga0070708_100038832
750 Ga0070663_100012645
751 Ga0070663_100130562
752 Ga0070678_100001012
753 Ga0070662_100235133
754 Ga0068867_100050314
755 Ga0068867_100290654
756 Ga0068867_100701373
757 Ga0070685_10000547
758 Ga0070707_101018000
759 Ga0070679_100024204
760 Ga0070679_100641681
761 Ga0070679_100697948
762 Ga0070684_100382482
763 Ga0070697_100201328
764 Ga0070672_100000527
765 Ga0070672_100406113
766 Ga0070695_100001734
767 Ga0070695_100007154
768 Ga0070695_100012588
769 Ga0070696_100040533
770 Ga0070693_100000199
771 Ga0070693_100013889
772 Ga0070665_100374166
773 Ga0068855_100004444
774 Ga0070664_100000895
775 Ga0070664_100006659
776 Ga0070664_100031100
777 Ga0068857_100001816
778 Ga0068854_100001666
779 Ga0068856_100001538
780 Ga0068856_100478856
781 Ga0068856_100622010
782 Ga0070702_100001415
783 Ga0070702_100700950
784 Ga0068852_100002972
785 Ga0068864_100000227
786 Ga0068870_10000155
787 Ga0068863_100000495
788 Ga0068858_100000783
789 Ga0068858_100286720
790 Ga0068860_100022860
791 Ga0068860_100126276
792 Ga0068860_100312604
793 Ga0068862_100313808
794 Ga0081455_10006948
795 Ga0081455_10169393
796 Ga0081538_10006317
797 Ga0081540_1029769
798 Ga0081540_1067389
799 Ga0070717_10421408
800 Ga0070717_10440499
801 Ga0075365_10077232
802 Ga0075368_10000202
803 Ga0075368_10009591
804 Ga0075363_100015552
805 Ga0075363_100064868
806 Ga0075363_100082581
807 Ga0075432_10000464
808 Ga0075432_10058773
809 Ga0070715_10063192
810 Ga0070712_100365350
811 Ga0070712_100849664
812 Ga0075367_10000448
813 Ga0075367_10126994
814 Ga0075367_10309065
815 Ga0097621_100000010
816 Ga0097621_100038380
817 Ga0075370_10099418
818 Ga0068871_100000034
819 Ga0075428_100016761
820 Ga0075428_100156309
821 Ga0075428_100410294
822 Ga0075428_100507572
823 Ga0075428_100610672
824 Ga0075430_100005590
825 Ga0075430_100006793
826 Ga0075430_100074585
827 Ga0075430_100092819
828 Ga0075430_100178157
829 Ga0075430_100281040
830 Ga0075431_100002999
831 Ga0075431_100004052
832 Ga0075431_100010695
833 Ga0075431_100171407
834 Ga0075431_100252069
835 Ga0075431_100260622
836 Ga0075431_100395587
837 Ga0075431_100619943
838 Ga0075433_10000774
839 Ga0075433_10009145
840 Ga0075434_100001700
841 Ga0075434_100005910
842 Ga0075434_100017596
843 Ga0075429_100007130
844 Ga0075429_100208466
845 Ga0075429_100249590
846 Ga0075429_100291621
847 Ga0068865_100000230
848 Ga0068865_100460130
849 Ga0075435_100018036
850 Ga0075435_100262238
851 Ga0099795_10020516
852 Ga0105240_10412735
853 Ga0111539_10000932
854 Ga0111539_10010377
855 Ga0111539_10134890
856 Ga0111539_10361669
857 Ga0114129_10026350
858 Ga0114129_10072966
859 Ga0114129_10097472
860 Ga0114129_10124834
861 Ga0114129_10151517
862 Ga0114129_10646036
863 Ga0114129_10743347
864 Ga0114129_10970007
865 Ga0105241_10052670
866 Ga0105241_10300667
867 Ga0105238_10287562
868 Ga0105249_10018811
869 Ga0105249_10080288
870 Ga0105249_11226388
871 Ga0099796_10075690
872 Ga0105239_10074122
873 Ga0105239_10528203
874 Ga0157324_1000372
875 Ga0157326_1001336
876 Ga0157338_1004402
877 Ga0157373_10122264
878 Ga0157370_10038246
879 Ga0157370_10501211
880 Ga0163162_10238564
881 Ga0157372_10085368
882 Ga0157380_10031602
883 Ga0157380_10156672
884 Ga0157379_10228435
885 Ga0163161_10000523
886 Ga0213875_10000567
887 Ga0207666_1000010
888 Ga0207673_1000265
889 Ga0207697_10000186
890 Ga0207697_10003939
891 Ga0207653_10006329
892 Ga0207682_10000123
893 Ga0207692_10196855
894 Ga0207642_10043751
895 Ga0207710_10002765
896 Ga0207688_10000889
897 Ga0207685_10026415
898 Ga0207699_10003769
899 Ga0207699_10043874
900 Ga0207645_10000023
901 Ga0207645_10141903
902 Ga0207643_10000007
903 Ga0207654_10006607
904 Ga0207654_10059928
905 Ga0207707_10002015
906 Ga0207707_10454637
907 Ga0207671_10053873
908 Ga0207671_10317139
909 Ga0207693_10009823
910 Ga0207693_10062939
911 Ga0207663_10059523
912 Ga0207663_10193802
913 Ga0207663_10243886
914 Ga0207660_10000393
915 Ga0207660_10050417
916 Ga0207660_10109916
917 Ga0207660_10136260
918 Ga0207662_10000136
919 Ga0207657_10035478
920 Ga0207649_10000434
921 Ga0207652_10001720
922 Ga0207652_10065502
923 Ga0207652_10066943
924 Ga0207681_10000273
925 Ga0207659_10000097
926 Ga0207687_10001031
927 Ga0207700_10019506
928 Ga0207664_10470213
929 Ga0207644_10005450
930 Ga0207690_10000962
931 Ga0207690_10176703
932 Ga0207706_10000867
933 Ga0207706_10023602
934 Ga0207706_10271666
935 Ga0207686_10002591
936 Ga0207686_10020419
937 Ga0207709_10007329
938 Ga0207709_10047675
939 Ga0207670_10000536
940 Ga0207669_10001135
941 Ga0207669_10082800
942 Ga0207669_10094150
943 Ga0207704_10000119
944 Ga0207665_10103561
945 Ga0207691_10000544
946 Ga0207711_10002468
947 Ga0207711_10235409
948 Ga0207689_10001743
949 Ga0207661_10000785
950 Ga0207661_10080161
951 Ga0207679_10000029
952 Ga0207667_10016422
953 Ga0207651_10000083
954 Ga0207712_10000471
955 Ga0207712_10313237
956 Ga0207668_10000862
957 Ga0207658_10002203
958 Ga0207677_10000992
959 Ga0207703_10088692
960 Ga0207639_10004451
961 Ga0207678_10001568
962 Ga0207708_10002060
963 Ga0207708_10163360
964 Ga0207702_10003639
965 Ga0207702_10421742
966 Ga0207702_11047310
967 Ga0207641_10000510
968 Ga0207648_10002351
969 Ga0207648_10739767
970 Ga0207676_10003788
971 Ga0207674_10000608
972 Ga0207675_100000805
973 Ga0207675_100049572
974 Ga0207675_100172777
975 Ga0207683_10000082
976 Ga0207698_10000377
977 Ga0207698_10257026
978 Ga0209999_1021261
979 Ga0209971_1007895
980 Ga0209966_1000761
981 Ga0209998_10001920
982 Ga0209998_10005097
983 Ga0209813_10004851
984 Ga0209974_10004757
985 Ga0207428_10000124
986 Ga0207428_10000420
987 Ga0207428_10000703
988 Ga0207428_10040025
989 Ga0268265_10001170
990 Ga0268265_10322200
991 Ga0268265_10335815
992 Ga0268264_10001878
993 Ga0268264_10080791
994 Ga0268264_10196448
995 Ga0268264_10646488
996 Ga0265332_10001311
997 Ga0265325_10000105
998 Ga0265325_10007640
999 Ga0265325_10026904
1000 Ga0265340_10069909
1001 Ga0265339_10002938
1002 Ga0265339_10004703
1003 Ga0265316_10133683
1004 Ga0265313_10000041
1005 Ga0265313_10005622
1006 Ga0265313_10014009
1007 Ga0265314_10000279
1008 Ga0265314_10010302
1009 Ga0265342_10000287
1010 Ga0307416_100252012
1011 Ga0373930_0000557
1012 Ga0373930_0003558
1013 Ga0373950_0042416
1014 Ga0373958_0001091
1015 Ga0373959_0001344
1016 Ga0373959_0005481
1017 Ga0373938_0000092
1018 Ga0373938_0004552
1019 Ga0373926_0002897
1020 Ga0373928_0000404
1021 Ga0373929_0000856
1022 Ga0373929_0019904
1023 Ga0373934_0014603
1024 Ga0373940_0000069
1025 Ga0373944_0000522
1026 Ga0373949_0002201
1027 Ga0373949_0003185
1028 Ga0373951_0005474
1029 Ga0373952_0001123
1030 Ga0373952_0002122
1031 Ga0373923_0000908
1032 Ga0373923_0012499
1033 Ga0373932_0000510
1034 Ga0373932_0076146
1035 Ga0373936_0013341
1036 Ga0373936_0017209
1037 Ga0373939_0002803
1038 Ga0373939_0044377
1039 Ga0373941_0000855
1040 Ga0373941_0002011
1041 Ga0373941_0003910
1042 Ga0373945_0000687
1043 Ga0373956_0003018
1044 Ga0373956_0017796
1045 Ga0373957_0118942
1046 Ga0373960_0002095
1047 Ga0373960_0051174
1048 Ga0373943_0078240
1049 Ga0373943_0094844
1050 Ga0373946_0070176
1051 Ga0373955_0006189
1052 Ga0373942_0001103
1053 Ga0373961_0000636
1054 Ga0373961_0005849
1055 Ga0373961_0079517
1056 Ga0373962_0054149
1057 Ga0373962_0060521
1058 Ga0373924_0027294
1059 Ga0373924_0089884
1060 Ga0373931_0000186
1061 Ga0373931_0001154
1062 Ga0373931_0003707
1063 Ga0373931_0032737
1064 Ga0373935_0032811
1065 Ga0373935_0124844
1066 Ga0373927_0006188
1067 Ga0373927_0123446
1068 Ga0373933_0004423
1069 Ga0373933_0012736
1070 Ga0373947_0039335
1071 Ga0373937_0011291
1072 Ga0373937_0019099
1073 Ga0373937_0019441
1074 Ga0373937_0020009
1075 Ga0373937_0062979
1076 Ga0373925_0033046
1077 Ga0373925_0040062
1078 Ga0373925_0115602
1079 Ga0373925_0334949
1080 Ga0373925_0402059
1081 Ga0436364_0045028
1082 Ga0242420_004233
1083 Ga0436361_0405803
1084 Ga0436363_0770944
1085 Ga0436362_0112778
1086 Ga0439441_015523
1087 Ga0439455_0010858
1088 Ga0451577_0048381
1089 Ga0451576_0052484
1090 Ga0495592_0001116
1091 Ga0495592_0008124
1092 Ga0495592_0028640
1093 Ga0495592_0169115
1094 Ga0495603_0008589
1095 Ga0495603_0040127
1096 Ga0495629_0061155
1097 Ga0495629_0162800
1098 Ga0495638_0041088
1099 Ga0495641_0021653
1100 Ga0495641_0110662
1101 Ga0495651_0000493
1102 Ga0495651_0003892
1103 Ga0495651_0006050
1104 Ga0495653_0004657
1105 Ga0495653_0174008
1106 Ga0495580_0021831
1107 Ga0495582_0001705
1108 Ga0495582_0024557
1109 Ga0495639_0047948
1110 Ga0495662_0009334
1111 Ga0495664_0001609
1112 Ga0495585_0003281
1113 Ga0495594_0022175
1114 Ga0495607_0004288
1115 Ga0495608_0088519
1116 Ga0495618_0015490
1117 Ga0495628_0002046
1118 Ga0495628_0014402
1119 Ga0495630_0036431
1120 Ga0495630_0065419
1121 Ga0495630_0143743
1122 Ga0495644_0000514
1123 Ga0495666_0001847
1124 Ga0495666_0016564
1125 Ga0495652_0011016
1126 Ga0495652_0143441
1127 Ga0495652_0325251
1128 Ga0495665_0026043
1129 Ga0495640_0019454
1130 Ga0495640_0036686
1131 Ga0495640_0038267
1132 Ga0495640_0153691
1133 Ga0495587_0016309
1134 Ga0495587_0016489
1135 Ga0495587_0020228
1136 Ga0495645_0001781
1137 Ga0495645_0009419
1138 Ga0495645_0312691
1139 Ga0495622_0012353
1140 Ga0495622_0148178
1141 Ga0495667_0002342
1142 Ga0495667_0011331
1143 Ga0495667_0037159
1144 Ga0495667_0052769
1145 Ga0495656_0001283
1146 Ga0495634_0063424
1147 Ga0495634_0088224
1148 Ga0495634_0096170
1149 Ga0495625_0193799
1150 Ga0495635_0000736
1151 Ga0495635_0004379
1152 Ga0495659_0056880
1153 Ga0495661_0056198
1154 Ga0495588_0018157
1155 Ga0495588_0080669
1156 Ga0495657_0007642
1157 Ga0495657_0172100
1158 Ga0495599_0002064
1159 Ga0495599_0002943
1160 Ga0495599_0003364
1161 Ga0495623_0002286
1162 Ga0495623_0159369
1163 Ga0495646_0000229
1164 Ga0495646_0006372
1165 Ga0495647_0004269
1166 Ga0495647_0185620
1167 Ga0495658_0002748
1168 Ga0495613_0143415
1169 Ga0495613_0182060
1170 Ga0495624_0117309
1171 Ga0495624_0234738
1172 Ga0495624_0561834
1173 Ga0495670_0009490
1174 Ga0495671_0220449
1175 Ga0495600_0003589
1176 Ga0495600_0032196
1177 Ga0495600_0073671
1178 Ga0495600_0121281
1179 Ga0495581_0005348
1180 Ga0495581_0260995
1181 Ga0495581_0301288
1182 Ga0495604_0009381
1183 Ga0495604_0119859
1184 Ga0495604_0243196
1185 Ga0495674_0013071
1186 Ga0495674_0030389
1187 Ga0495674_0039235
1188 Ga0495676_0122104
1189 Ga0495676_0159434
1190 Ga0495680_0005567
1191 Ga0495680_0029672
1192 Ga0495680_0047393
1193 Ga0495680_0118574
1194 Ga0495675_0013037
1195 Ga0495675_0030741
1196 Ga0495684_0006324
1197 Ga0495684_0139589
1198 Ga0495593_0122577
1199 Ga0495602_0006950
1200 Ga0495602_0253115
1201 Ga0496100_0000057
1202 Ga0496101_0001297
1203 Ga0496101_0097328
1204 Ga0496102_0001628
1205 Ga0496102_0018224
1206 Ga0496103_0003173
1207 Ga0496103_0011059
1208 Ga0496104_0000932
1209 Ga0496104_0041108
1210 Ga0496104_0388188
1211 Ga0496105_0019215
1212 Ga0496105_0021279
1213 Ga0496106_0000518
1214 Ga0496107_0001129
1215 Ga0496107_0005941
1216 Ga0496107_0116749
1217 Ga0496107_0255663
1218 Ga0496108_0004254
1219 Ga0496108_0021395
1220 Ga0496108_0051769
1221 Ga0496109_0002432
1222 Ga0496109_0003961
1223 Ga0496110_0001450
1224 Ga0496110_0022934
1225 Ga0496111_0018065
1226 Ga0496112_0105119
1227 Ga0496112_0254183
1228 Ga0496112_0555072
1229 Ga0496113_0016626
1230 Ga0496113_0030441
1231 Ga0496113_0388473
1232 Ga0496114_0002944
1233 Ga0496114_0355728
1234 Ga0496115_0002786
1235 Ga0496115_0014635
1236 Ga0496115_0032489
1237 Ga0496115_0203225
1238 Ga0501032_0048692
1239 Ga0501032_0494396
1240 Ga0501033_0055047
1241 Ga0501033_0496149
1242 Ga0501034_0000032
1243 Ga0501034_0010486
1244 Ga0501034_0329514
1245 Ga0501036_0018617
1246 Ga0501036_0252883
1247 Ga0501036_0361312
1248 Ga0501037_0044551
1249 Ga0501037_0072595
1250 Ga0501038_0049211
1251 Ga0501038_0072882
1252 Ga0501038_0090742
1253 Ga0501038_0149411
1254 Ga0501039_0248605
1255 Ga0501040_0127488
1256 Ga0501043_0008265
1257 Ga0501043_0184985
1258 Ga0501046_0023608
1259 Ga0501046_0093007
1260 Ga0501047_0018542
1261 Ga0501047_0213511
1262 Ga0501047_0295188
1263 Ga0501047_0484377
1264 Ga0501048_0034404
1265 Ga0501048_0127043
1266 Ga0501048_0163293
1267 Ga0501048_0420371
1268 Ga0501067_0077169
1269 Ga0501068_0078727
1270 Ga0501069_0029376
1271 Ga0501069_0224883
1272 Ga0501070_0002759
1273 Ga0501070_0008780
1274 Ga0501070_0087816
1275 Ga0501070_0119058
1276 Ga0501070_0171930
1277 Ga0501070_0198571
1278 Ga0501071_0023874
1279 Ga0501073_0178582
1280 Ga0501073_0182827
1281 Ga0501074_0068958
1282 Ga0501074_0071152
1283 Ga0501075_0123637
1284 Ga0501075_0128050
1285 Ga0501076_0114009
1286 Ga0501076_0344339
1287 Ga0501077_0006238
1288 Ga0501077_0037633
1289 Ga0501077_0415267
1290 Ga0501079_0056842
1291 Ga0501079_0162003
1292 Ga0501079_0213286
1293 Ga0501079_0290421
1294 Ga0501079_0340247
1295 Ga0501080_0010850
1296 Ga0501080_0011076
1297 Ga0501080_0033206
1298 Ga0501080_0112526
1299 Ga0501080_0221649
1300 Ga0501080_0390695
1301 Ga0501080_0465967
1302 Ga0501081_0111528
1303 Ga0501081_0135744
1304 Ga0501081_0153227
1305 Ga0501083_0031088
1306 Ga0501035_0006636
1307 Ga0501035_0014779
1308 Ga0501035_0054697
1309 Ga0501044_0145021
1310 Ga0501044_0212639
1311 Ga0501044_0593938
1312 nmdc:mga03n38_151576_c1
1313 nmdc:mga03n38_343496_c1
1314 nmdc:mga00v17_22620_c1
1315 nmdc:mga0yw44_30618_c1
1316 nmdc:mga06z11_258810_c1
1317 nmdc:mga06z11_4530_c1
1318 nmdc:mga06z11_4532_c1
1319 nmdc:mga04h51_1364_c1
1320 nmdc:mga04h51_5630_c1
1321 nmdc:mga04h51_5885_c1
1322 nmdc:mga05p37_215357_c1
1323 nmdc:mga05p37_237562_c1
1324 nmdc:mga05p37_262753_c1
1325 nmdc:mga05p37_30390_c1
1326 nmdc:mga05p37_45_c2
1327 nmdc:mga05p37_754683_c1
1328 nmdc:mga09592_1055_c1
1329 nmdc:mga09592_155375_c1
1330 nmdc:mga09592_167284_c1
1331 nmdc:mga09592_255888_c1
1332 nmdc:mga09592_62062_c1
1333 nmdc:mga0qj67_11495_c1
1334 nmdc:mga0qj67_195263_c1
1335 nmdc:mga0qj67_263608_c1
1336 nmdc:mga0qj67_336435_c1
1337 nmdc:mga0qj67_53714_c1
1338 nmdc:mga0qj67_701_c1
1339 nmdc:mga06r32_101841_c1
1340 nmdc:mga06r32_12918_c1
1341 nmdc:mga06r32_170835_c1
1342 nmdc:mga06r32_227_c1
1343 nmdc:mga06r32_295679_c1
1344 nmdc:mga06r32_368433_c1
1345 nmdc:mga06r32_443833_c1
1346 nmdc:mga08y16_1134_c1
1347 nmdc:mga08y16_12172_c1
1348 nmdc:mga08y16_190186_c1
1349 nmdc:mga08y16_1989_c1
1350 nmdc:mga08y16_278261_c1
1351 nmdc:mga0n895_20617_c1
1352 nmdc:mga0n895_3165_c1
1353 nmdc:mga0n895_50_c1
1354 nmdc:mga0rr50_12507_c1
1355 nmdc:mga0rr50_2855_c1
1356 nmdc:mga0rr50_68891_c1
1357 nmdc:mga0a205_2228_c1
1358 nmdc:mga0a205_5479_c1
1359 nmdc:mga0a205_77964_c1
1360 Ga0495601_0004041
1361 Ga0495601_0005795
1362 Ga0495601_0032428
1363 Ga0495601_0066837
1364 Ga0495612_0006019
1365 Ga0495612_0007152
1366 Ga0495612_0023069
1367 Ga0495595_0000577
1368 Ga0495595_0002620
1369 Ga0495595_0005520
1370 Ga0495619_0000260
1371 Ga0495619_0000655
1372 Ga0495619_0014245
1373 Ga0495619_0021990
1374 Ga0495619_0064595
1375 Ga0500643_006415
1376 Ga0500644_0000301
1377 Ga0500646_0084823
1378 Ga0500651_0032130
1379 Ga0500566_0008779
1380 Ga0500555_019795
1381 Ga0500595_000144
1382 Ga0500616_0000006
1383 Ga0500645_000946
1384 Ga0501084_0003952
1385 Ga0501084_0084712
1386 Ga0501084_0336514
1387 Ga0501082_0075827
1388 Ga0501082_0168739
1389 Ga0501082_0672856
1390 Ga0501082_0955700
1391 Ga0530510_0021687
1392 2643755554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

61

107

0.98

PF14246

TetR_C_7

AefR-like transcriptional repressor, C-terminal domain

130

198

0.86

PF16859

TetR_C_11

Tetracyclin repressor-like, C-terminal domain

129

231

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6azh-assembly1.cif.gz_B clostridium perfringens putative fatty acid metabolism regulator 0.8216 24 203
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.8148 22 205
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8104 22 208
5gpa-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8053 25 210
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.8024 24 210
ID Description Score Start End Superfamily
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9264 25 63 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9239 25 63 1.10.10.60
6azhB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.917 24 66 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9165 25 63 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9118 27 63 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A0Q7TPG1-F1-model_v4 HTH tetR-type domain-containing protein 0.9532 14 210 GO:0000976
GO:0003700
AF-A0A327L488-F1-model_v4 HTH tetR-type domain-containing protein 0.9466 14 210 GO:0000976
GO:0003700
AF-A0A6L5FGY3-F1-model_v4 TetR family transcriptional regulator 0.9459 22 210 GO:0000976
GO:0003700
AF-A0A127EWI0-F1-model_v4 Transcriptional regulator, TetR family 0.9379 11 210 GO:0000976
GO:0003700
AF-A0A371BD66-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9367 15 208 GO:0000976
GO:0003700

Map