F475771

General Info

Members Datasets Scaffolds Average Seq Length
695 277 1390 376

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10014126|Ga0065707_100141261
Length 434
Sequence VFRNSVNERITRLSQVTIFGLFVPGVPRRAKRKGQSAKLLALGPLLLALSSWPFALIMAKHKSKFLQGRRIDPAPITKKQNVADLIDESFLAYNAARLREACQLFTQKMLEPEVTVGMSLTGALTPAGLGISSLIPLIKAGFVDWIISTGANLYHDTHFGIGLAMHQGNAQISDIVLRQEEVVRIYDIFFDYSVLLDTDAFFRKIIEGXEFQRSMSTAEFXYLCGRYVHERERKLXIKDKSXLAVAXEYAVPIYTSSPGDSSIGMNVAAKALQGNRLAFDPSLDVNETASIVLAAKRNAVGTNGTRKKAKGKSAVFILGGGSPKNFLLQTEPQIQEVLGIDERGHDFFLQITDARPDTGGLSGATPGEAVSWGKVDPDRLPDAVVCYVDSTVALPLITAYALTRHDPRTPKRLYDRRAEFMDLLSKEYAKSKRR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
237 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
238 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
247 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
250 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
254 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
255 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
256 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
259 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
277 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 14.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10014126 3300005295 Bacteria 2273
2 SwRhRL2b_contig_1222003 2162886007 Bacteria 2162
3 JGI24034J14986_100637 3300001432 Bacteria 2070
4 JGI24748J21848_1000038 3300002074 Bacteria 69882
5 JGI24033J26618_1000166 3300002155 Bacteria 8115
6 JGI24034J26672_10000041 3300002239 Bacteria 69886
7 JGI24751J29686_10000040 3300002459 Bacteria 79191
8 JGI25406J46586_10003181 3300003203 Bacteria 7725
9 JGI25406J46586_10010884 3300003203 Bacteria 4010
10 Ga0065714_10064546 3300005288 Bacteria 38244
11 Ga0065704_10003849 3300005289 Bacteria 6007
12 Ga0065704_10102277 3300005289 Bacteria 2211
13 Ga0065712_10000133 3300005290 Bacteria 66806
14 Ga0065712_10008311 3300005290 Bacteria 2791
15 Ga0065712_10082206 3300005290 Bacteria 2937
16 Ga0065715_10002297 3300005293 Bacteria 5711
17 Ga0065715_10004230 3300005293 Bacteria 4026
18 Ga0065715_10019412 3300005293 Bacteria 1882
19 Ga0065715_10089428 3300005293 Bacteria 10257
20 Ga0065715_10108964 3300005293 Bacteria 2677
21 Ga0065715_10121504 3300005293 Unclassified 2228
22 Ga0065707_10001920 3300005295 Bacteria 13690
23 Ga0065707_10094009 3300005295 Bacteria 3550
24 Ga0065707_10094635 3300005295 Bacteria 3465
25 Ga0065707_10140031 3300005295 Bacteria 1785
26 Ga0070658_10012673 3300005327 Bacteria 6763
27 Ga0070676_10015707 3300005328 Bacteria 4178
28 Ga0070676_10040671 3300005328 Bacteria 2693
29 Ga0070683_100058887 3300005329 Bacteria 3568
30 Ga0070690_100003648 3300005330 Bacteria 8474
31 Ga0070690_100031603 3300005330 Bacteria 3299
32 Ga0070690_100036823 3300005330 Bacteria 3078
33 Ga0070690_100042115 3300005330 Bacteria 2892
34 Ga0070670_100000225 3300005331 Bacteria 52142
35 Ga0070670_100007289 3300005331 Bacteria 9380
36 Ga0070670_100078558 3300005331 Bacteria 2835
37 Ga0070670_100162928 3300005331 Unclassified 1933
38 Ga0068869_100003372 3300005334 Bacteria 9754
39 Ga0068869_100003484 3300005334 Bacteria 9628
40 Ga0068869_100015512 3300005334 Bacteria 5113
41 Ga0068869_100035085 3300005334 Bacteria 3553
42 Ga0070680_100002583 3300005336 Bacteria 13399
43 Ga0070680_100038250 3300005336 Bacteria 3880
44 Ga0070682_100000687 3300005337 Bacteria 20450
45 Ga0070682_100007382 3300005337 Bacteria 6202
46 Ga0070682_100012799 3300005337 Bacteria 4816
47 Ga0068868_100067335 3300005338 Bacteria 2850
48 Ga0068868_100103606 3300005338 Bacteria 2305
49 Ga0068868_100162610 3300005338 Bacteria 1844
50 Ga0068868_100246912 3300005338 Unclassified 1501
51 Ga0068868_100262482 3300005338 Bacteria 1457
52 Ga0070660_100040295 3300005339 Bacteria 3554
53 Ga0070689_100112133 3300005340 Bacteria 2170
54 Ga0070689_100156846 3300005340 Bacteria 1838
55 Ga0070691_10058141 3300005341 Unclassified 1856
56 Ga0070687_100000989 3300005343 Bacteria 9692
57 Ga0070687_100004694 3300005343 Bacteria 5466
58 Ga0070687_100015556 3300005343 Bacteria 3444
59 Ga0070668_100004628 3300005347 Bacteria 10188
60 Ga0070669_100007320 3300005353 Bacteria 7917
61 Ga0070675_100071996 3300005354 Bacteria 2869
62 Ga0070675_100104039 3300005354 Bacteria 2394
63 Ga0070674_100089695 3300005356 Bacteria 2216
64 Ga0070673_100000896 3300005364 Bacteria 16813
65 Ga0070673_100049946 3300005364 Bacteria 3268
66 Ga0070673_100105617 3300005364 Bacteria 2327
67 Ga0070673_100140296 3300005364 Bacteria 2038
68 Ga0070673_100151605 3300005364 Unclassified 1964
69 Ga0070688_100061690 3300005365 Bacteria 2371
70 Ga0070688_100070322 3300005365 Unclassified 2237
71 Ga0070659_100258454 3300005366 Bacteria 1445
72 Ga0070667_100038003 3300005367 Unclassified 4037
73 Ga0070667_100103843 3300005367 Bacteria 2457
74 Ga0070703_10000193 3300005406 Bacteria 29596
75 Ga0070709_10000074 3300005434 Bacteria 75742
76 Ga0070701_10080653 3300005438 Bacteria 1760
77 Ga0070705_100010194 3300005440 Bacteria 4695
78 Ga0070705_100037035 3300005440 Bacteria 2748
79 Ga0070700_100000090 3300005441 Bacteria 61626
80 Ga0070700_100077065 3300005441 Bacteria 2143
81 Ga0070700_100122049 3300005441 Bacteria 1747
82 Ga0070694_100013279 3300005444 Bacteria 5143
83 Ga0070694_100018716 3300005444 Bacteria 4399
84 Ga0070694_100020401 3300005444 Unclassified 4224
85 Ga0070694_100162943 3300005444 Unclassified 1638
86 Ga0070694_100162950 3300005444 Bacteria 1638
87 Ga0070708_100000189 3300005445 Bacteria 44518
88 Ga0070708_100085218 3300005445 Bacteria 2867
89 Ga0070678_100019413 3300005456 Bacteria 4430
90 Ga0070662_100004159 3300005457 Bacteria 9109
91 Ga0070662_100036792 3300005457 Bacteria 3466
92 Ga0070681_10000011 3300005458 Bacteria 139059
93 Ga0070681_10001243 3300005458 Bacteria 22166
94 Ga0068867_100069406 3300005459 Bacteria 2632
95 Ga0068867_100071357 3300005459 Bacteria 2598
96 Ga0068867_100132171 3300005459 Bacteria 1941
97 Ga0070685_10010181 3300005466 Bacteria 4881
98 Ga0070685_10054975 3300005466 Bacteria 2312
99 Ga0070706_100000312 3300005467 Bacteria 59056
100 Ga0070706_100017265 3300005467 Bacteria 6662
101 Ga0070706_100020535 3300005467 Bacteria 6086
102 Ga0070706_100037219 3300005467 Bacteria 4494
103 Ga0070706_100048757 3300005467 Bacteria 3908
104 Ga0070706_100075078 3300005467 Bacteria 3129
105 Ga0070706_100245202 3300005467 Bacteria 1673
106 Ga0070707_100000694 3300005468 Bacteria 33438
107 Ga0070707_100045113 3300005468 Bacteria 4219
108 Ga0070707_100045358 3300005468 Unclassified 4208
109 Ga0070707_100081676 3300005468 Bacteria 3121
110 Ga0070707_100129450 3300005468 Bacteria 2454
111 Ga0070707_100143826 3300005468 Unclassified 2321
112 Ga0070707_100211697 3300005468 Bacteria 1889
113 Ga0070698_100000374 3300005471 Bacteria 46633
114 Ga0070698_100006397 3300005471 Bacteria 12786
115 Ga0070698_100007201 3300005471 Bacteria 12051
116 Ga0070698_100009908 3300005471 Bacteria 10189
117 Ga0070698_100016433 3300005471 Bacteria 7809
118 Ga0070698_100018768 3300005471 Bacteria 7280
119 Ga0070698_100120403 3300005471 Bacteria 2585
120 Ga0070699_100059210 3300005518 Bacteria 3318
121 Ga0070699_100095926 3300005518 Unclassified 2597
122 Ga0070699_100168280 3300005518 Bacteria 1941
123 Ga0070699_100387118 3300005518 Unclassified 1263
124 Ga0070679_100000013 3300005530 Bacteria 151602
125 Ga0070679_100062295 3300005530 Bacteria 3718
126 Ga0070697_100001655 3300005536 Bacteria 16982
127 Ga0070697_100002135 3300005536 Bacteria 15156
128 Ga0070697_100005839 3300005536 Bacteria 9497
129 Ga0070697_100006124 3300005536 Bacteria 9306
130 Ga0070697_100017774 3300005536 Bacteria 5600
131 Ga0070697_100058023 3300005536 Unclassified 3149
132 Ga0070697_100144904 3300005536 Bacteria 1999
133 Ga0070697_100274967 3300005536 Bacteria 1444
134 Ga0068853_100008756 3300005539 Bacteria 8139
135 Ga0068853_100180631 3300005539 Bacteria 1913
136 Ga0068853_100195178 3300005539 Bacteria 1841
137 Ga0070672_100008730 3300005543 Bacteria 6957
138 Ga0070672_100038051 3300005543 Bacteria 3674
139 Ga0070686_100000015 3300005544 Bacteria 158823
140 Ga0070686_100012457 3300005544 Bacteria 4846
141 Ga0070686_100033600 3300005544 Bacteria 3153
142 Ga0070686_100065314 3300005544 Bacteria 2363
143 Ga0070695_100005519 3300005545 Bacteria 7450
144 Ga0070695_100025351 3300005545 Unclassified 3661
145 Ga0070695_100195034 3300005545 Bacteria 1444
146 Ga0070695_100199004 3300005545 Bacteria 1430
147 Ga0070696_100013630 3300005546 Bacteria 5456
148 Ga0070696_100020115 3300005546 Bacteria 4526
149 Ga0070696_100031992 3300005546 Bacteria 3608
150 Ga0070696_100034700 3300005546 Bacteria 3471
151 Ga0070696_100046945 3300005546 Bacteria 2996
152 Ga0070696_100054319 3300005546 Bacteria 2791
153 Ga0070696_100204767 3300005546 Unclassified 1474
154 Ga0070693_100006611 3300005547 Bacteria 5628
155 Ga0070693_100030470 3300005547 Bacteria 2949
156 Ga0070693_100050285 3300005547 Bacteria 2382
157 Ga0070693_100096936 3300005547 Bacteria 1789
158 Ga0070693_100151859 3300005547 Unclassified 1468
159 Ga0070704_100115883 3300005549 Bacteria 2048
160 Ga0070704_100219542 3300005549 Bacteria 1545
161 Ga0070704_100227720 3300005549 Unclassified 1519
162 Ga0068855_100141711 3300005563 Bacteria 2739
163 Ga0068855_100167704 3300005563 Bacteria 2488
164 Ga0068855_100198280 3300005563 Bacteria 2261
165 Ga0070664_100004096 3300005564 Bacteria 11708
166 Ga0068857_100217182 3300005577 Bacteria 1746
167 Ga0068854_100028198 3300005578 Bacteria 3878
168 Ga0068854_100032045 3300005578 Bacteria 3655
169 Ga0068854_100114080 3300005578 Unclassified 2042
170 Ga0068854_100116755 3300005578 Bacteria 2020
171 Ga0068854_100141965 3300005578 Bacteria 1844
172 Ga0068856_100287285 3300005614 Unclassified 1662
173 Ga0070702_100007300 3300005615 Bacteria 5285
174 Ga0070702_100037728 3300005615 Unclassified 2685
175 Ga0068852_100126769 3300005616 Bacteria 2345
176 Ga0068852_100422186 3300005616 Bacteria 1316
177 Ga0068859_100003763 3300005617 Bacteria 15470
178 Ga0068859_100005353 3300005617 Bacteria 13058
179 Ga0068859_100007721 3300005617 Bacteria 10924
180 Ga0068859_100021526 3300005617 Bacteria 6471
181 Ga0068859_100052343 3300005617 Bacteria 4105
182 Ga0068859_100057721 3300005617 Bacteria 3909
183 Ga0068859_100083303 3300005617 Bacteria 3241
184 Ga0068859_100133615 3300005617 Unclassified 2553
185 Ga0068859_100160967 3300005617 Bacteria 2324
186 Ga0068859_100277247 3300005617 Bacteria 1769
187 Ga0068864_100007568 3300005618 Bacteria 8949
188 Ga0068864_100039674 3300005618 Bacteria 4024
189 Ga0068864_100042480 3300005618 Bacteria 3890
190 Ga0068864_100047075 3300005618 Bacteria 3702
191 Ga0068864_100096058 3300005618 Bacteria 2622
192 Ga0068864_100117253 3300005618 Bacteria 2376
193 Ga0068864_100152500 3300005618 Bacteria 2094
194 Ga0068864_100229141 3300005618 Unclassified 1717
195 Ga0068866_10032998 3300005718 Bacteria 2507
196 Ga0068866_10041344 3300005718 Unclassified 2287
197 Ga0068861_100014064 3300005719 Bacteria 5612
198 Ga0068861_100018171 3300005719 Bacteria 5004
199 Ga0068861_100021110 3300005719 Bacteria 4679
200 Ga0068861_100032199 3300005719 Bacteria 3858
201 Ga0068861_100037526 3300005719 Unclassified 3602
202 Ga0068861_100150404 3300005719 Unclassified 1910
203 Ga0068861_100261846 3300005719 Bacteria 1481
204 Ga0068851_10001229 3300005834 Bacteria 11132
205 Ga0068870_10030708 3300005840 Bacteria 2718
206 Ga0068870_10170700 3300005840 Bacteria 1298
207 Ga0068863_100021036 3300005841 Bacteria 6232
208 Ga0068858_100009457 3300005842 Bacteria 9297
209 Ga0068858_100037873 3300005842 Bacteria 4472
210 Ga0068858_100047011 3300005842 Bacteria 4002
211 Ga0068858_100063999 3300005842 Bacteria 3403
212 Ga0068858_100154855 3300005842 Bacteria 2156
213 Ga0068860_100003472 3300005843 Bacteria 16221
214 Ga0068860_100008664 3300005843 Bacteria 10132
215 Ga0068860_100022684 3300005843 Bacteria 6068
216 Ga0068860_100027983 3300005843 Bacteria 5427
217 Ga0068860_100034874 3300005843 Bacteria 4827
218 Ga0068860_100127528 3300005843 Bacteria 2439
219 Ga0068860_100353377 3300005843 Unclassified 1447
220 Ga0068860_100430311 3300005843 Bacteria 1309
221 Ga0068862_100037797 3300005844 Bacteria 4092
222 Ga0068862_100044707 3300005844 Bacteria 3778
223 Ga0068862_100055428 3300005844 Bacteria 3396
224 Ga0068862_100123753 3300005844 Bacteria 2282
225 Ga0068862_100149993 3300005844 Unclassified 2075
226 Ga0068862_100416968 3300005844 Unclassified 1259
227 Ga0081455_10034980 3300005937 Bacteria 4496
228 Ga0081455_10103867 3300005937 Bacteria 2274
229 Ga0081538_10009201 3300005981 Bacteria 8277
230 Ga0081540_1019086 3300005983 Unclassified 4183
231 Ga0081539_10000297 3300005985 Bacteria 111986
232 Ga0081539_10000502 3300005985 Bacteria 82098
233 Ga0081539_10000796 3300005985 Bacteria 61233
234 Ga0081539_10002465 3300005985 Bacteria 26058
235 Ga0081539_10003882 3300005985 Bacteria 17449
236 Ga0081539_10028237 3300005985 Bacteria 3532
237 Ga0070715_10000002 3300006163 Bacteria 389554
238 Ga0070716_100000006 3300006173 Bacteria 268067
239 Ga0097621_100006186 3300006237 Bacteria 8483
240 Ga0097621_100143465 3300006237 Bacteria 2042
241 Ga0068871_100030874 3300006358 Bacteria 4223
242 Ga0068871_100038139 3300006358 Bacteria 3835
243 Ga0068871_100074664 3300006358 Unclassified 2797
244 Ga0068871_100081304 3300006358 Bacteria 2684
245 Ga0068871_100171164 3300006358 Unclassified 1862
246 Ga0075428_100000013 3300006844 Bacteria 167653
247 Ga0075428_100235445 3300006844 Unclassified 1976
248 Ga0075428_100275506 3300006844 Bacteria 1810
249 Ga0075428_100306837 3300006844 Unclassified 1706
250 Ga0075428_100425362 3300006844 Bacteria 1423
251 Ga0075431_100094775 3300006847 Bacteria 3081
252 Ga0075433_10001066 3300006852 Bacteria 19691
253 Ga0075433_10005746 3300006852 Bacteria 9756
254 Ga0075433_10069012 3300006852 Bacteria 3104
255 Ga0075433_10083167 3300006852 Unclassified 2824
256 Ga0075433_10187654 3300006852 Bacteria 1839
257 Ga0075434_100006909 3300006871 Bacteria 10457
258 Ga0075434_100007920 3300006871 Bacteria 9849
259 Ga0075434_100037159 3300006871 Bacteria 4820
260 Ga0075434_100039093 3300006871 Bacteria 4701
261 Ga0075434_100057787 3300006871 Bacteria 3855
262 Ga0075434_100072212 3300006871 Unclassified 3443
263 Ga0075434_100079111 3300006871 Bacteria 3284
264 Ga0075434_100101697 3300006871 Bacteria 2881
265 Ga0075434_100120976 3300006871 Bacteria 2634
266 Ga0075429_100140287 3300006880 Bacteria 2115
267 Ga0068865_100073730 3300006881 Bacteria 2428
268 Ga0075436_100000469 3300006914 Bacteria 26224
269 Ga0075436_100001434 3300006914 Bacteria 16214
270 Ga0075436_100006536 3300006914 Bacteria 7984
271 Ga0075436_100038496 3300006914 Bacteria 3301
272 Ga0097620_100003763 3300006931 Bacteria 15470
273 Ga0097620_100005353 3300006931 Bacteria 13058
274 Ga0097620_100007721 3300006931 Bacteria 10924
275 Ga0097620_100021524 3300006931 Bacteria 6471
276 Ga0097620_100052344 3300006931 Bacteria 4105
277 Ga0097620_100057724 3300006931 Bacteria 3909
278 Ga0097620_100083308 3300006931 Bacteria 3241
279 Ga0097620_100133623 3300006931 Unclassified 2553
280 Ga0097620_100160980 3300006931 Bacteria 2324
281 Ga0097620_100277232 3300006931 Bacteria 1769
282 Ga0075435_100001008 3300007076 Bacteria 17848
283 Ga0075435_100039407 3300007076 Bacteria 3770
284 Ga0075435_100051044 3300007076 Bacteria 3330
285 Ga0075435_100102275 3300007076 Unclassified 2375
286 Ga0075435_100126873 3300007076 Bacteria 2133
287 Ga0099794_10003728 3300007265 Bacteria 5865
288 Ga0105240_10122524 3300009093 Bacteria 3129
289 Ga0105240_10168305 3300009093 Bacteria 2598
290 Ga0111539_10009788 3300009094 Bacteria 12100
291 Ga0111539_10011762 3300009094 Bacteria 10974
292 Ga0111539_10019650 3300009094 Bacteria 8335
293 Ga0111539_10061745 3300009094 Bacteria 4439
294 Ga0111539_10075952 3300009094 Bacteria 3957
295 Ga0111539_10104643 3300009094 Bacteria 3321
296 Ga0111539_10181499 3300009094 Bacteria 2458
297 Ga0111539_10427022 3300009094 Bacteria 1543
298 Ga0105245_10063956 3300009098 Bacteria 3324
299 Ga0105247_10000142 3300009101 Bacteria 69945
300 Ga0105247_10013688 3300009101 Bacteria 4864
301 Ga0114129_10016316 3300009147 Bacteria 10572
302 Ga0114129_10017644 3300009147 Bacteria 10162
303 Ga0114129_10023666 3300009147 Bacteria 8706
304 Ga0114129_10033829 3300009147 Bacteria 7220
305 Ga0114129_10045516 3300009147 Bacteria 6169
306 Ga0114129_10058226 3300009147 Bacteria 5405
307 Ga0114129_10065400 3300009147 Bacteria 5075
308 Ga0114129_10072036 3300009147 Bacteria 4818
309 Ga0114129_10116633 3300009147 Bacteria 3679
310 Ga0114129_10271624 3300009147 Bacteria 2268
311 Ga0105243_10000460 3300009148 Bacteria 42351
312 Ga0105243_10001520 3300009148 Bacteria 20276
313 Ga0105243_10024254 3300009148 Bacteria 4626
314 Ga0105243_10077260 3300009148 Bacteria 2707
315 Ga0105243_10091277 3300009148 Bacteria 2508
316 Ga0105243_10143214 3300009148 Unclassified 2042
317 Ga0105241_10012097 3300009174 Bacteria 6338
318 Ga0105241_10031389 3300009174 Bacteria 3978
319 Ga0105241_10081589 3300009174 Bacteria 2533
320 Ga0105241_10105554 3300009174 Unclassified 2247
321 Ga0105241_10110709 3300009174 Unclassified 2197
322 Ga0105241_10153647 3300009174 Bacteria 1885
323 Ga0105242_10000606 3300009176 Bacteria 28064
324 Ga0105242_10001223 3300009176 Bacteria 20281
325 Ga0105242_10001732 3300009176 Bacteria 17229
326 Ga0105242_10005533 3300009176 Bacteria 9751
327 Ga0105242_10017594 3300009176 Bacteria 5574
328 Ga0105242_10101613 3300009176 Bacteria 2437
329 Ga0105248_10008670 3300009177 Bacteria 11172
330 Ga0105248_10009966 3300009177 Bacteria 10463
331 Ga0105248_10011136 3300009177 Bacteria 9924
332 Ga0105248_10019330 3300009177 Bacteria 7537
333 Ga0105248_10121129 3300009177 Bacteria 2951
334 Ga0105248_10163345 3300009177 Bacteria 2511
335 Ga0105237_10006126 3300009545 Bacteria 13445
336 Ga0105237_10016051 3300009545 Bacteria 7788
337 Ga0105237_10095656 3300009545 Bacteria 2960
338 Ga0105237_10116323 3300009545 Bacteria 2667
339 Ga0105238_10001168 3300009551 Bacteria 26434
340 Ga0105249_10000025 3300009553 Bacteria 232713
341 Ga0105249_10022642 3300009553 Bacteria 5630
342 Ga0105249_10053615 3300009553 Bacteria 3686
343 Ga0105249_10055312 3300009553 Bacteria 3630
344 Ga0105249_10234273 3300009553 Bacteria 1812
345 Ga0105249_10293585 3300009553 Unclassified 1628
346 Ga0105239_10009239 3300010375 Bacteria 11147
347 Ga0105239_10079400 3300010375 Bacteria 3611
348 Ga0105239_10354118 3300010375 Bacteria 1657
349 Ga0105239_10384242 3300010375 Bacteria 1587
350 Ga0105246_10020466 3300011119 Unclassified 4244
351 Ga0105246_10149997 3300011119 Unclassified 1764
352 Ga0157373_10073483 3300013100 Unclassified 2413
353 Ga0157373_10125509 3300013100 Bacteria 1805
354 Ga0157370_10054977 3300013104 Bacteria 3794
355 Ga0157374_10043209 3300013296 Bacteria 4162
356 Ga0157378_10000002 3300013297 Bacteria 222652
357 Ga0157378_10002351 3300013297 Bacteria 16810
358 Ga0157378_10005723 3300013297 Bacteria 10879
359 Ga0157378_10020796 3300013297 Bacteria 5770
360 Ga0157378_10036584 3300013297 Bacteria 4344
361 Ga0157378_10058105 3300013297 Bacteria 3450
362 Ga0157378_10078721 3300013297 Unclassified 2974
363 Ga0157378_10133701 3300013297 Unclassified 2298
364 Ga0157378_10188788 3300013297 Bacteria 1942
365 Ga0157378_10328241 3300013297 Bacteria 1488
366 Ga0163162_10000002 3300013306 Bacteria 717331
367 Ga0163162_10006565 3300013306 Bacteria 11271
368 Ga0163162_10009177 3300013306 Bacteria 9626
369 Ga0163162_10014781 3300013306 Bacteria 7625
370 Ga0163162_10036493 3300013306 Bacteria 4900
371 Ga0163162_10037457 3300013306 Bacteria 4840
372 Ga0163162_10106971 3300013306 Unclassified 2892
373 Ga0163162_10294132 3300013306 Bacteria 1755
374 Ga0157372_10193697 3300013307 Unclassified 2354
375 Ga0157372_10266981 3300013307 Unclassified 1988
376 Ga0157375_10003637 3300013308 Bacteria 13372
377 Ga0157375_10070716 3300013308 Bacteria 3500
378 Ga0157375_10149135 3300013308 Unclassified 2472
379 Ga0157375_10157217 3300013308 Bacteria 2413
380 Ga0157375_10372976 3300013308 Bacteria 1593
381 Ga0163163_10000083 3300014325 Bacteria 104503
382 Ga0163163_10002212 3300014325 Bacteria 16356
383 Ga0163163_10017600 3300014325 Bacteria 6669
384 Ga0163163_10019605 3300014325 Bacteria 6352
385 Ga0163163_10059997 3300014325 Bacteria 3765
386 Ga0163163_10062654 3300014325 Bacteria 3686
387 Ga0163163_10108537 3300014325 Bacteria 2803
388 Ga0157380_10002001 3300014326 Bacteria 13583
389 Ga0157380_10012722 3300014326 Bacteria 6111
390 Ga0157380_10071301 3300014326 Bacteria 2811
391 Ga0157377_10010891 3300014745 Bacteria 4518
392 Ga0157377_10019496 3300014745 Bacteria 3544
393 Ga0157379_10049837 3300014968 Bacteria 3739
394 Ga0157379_10123318 3300014968 Bacteria 2332
395 Ga0157379_10147257 3300014968 Bacteria 2123
396 Ga0157379_10247247 3300014968 Bacteria 1618
397 Ga0157376_10139923 3300014969 Bacteria 2170
398 Ga0163161_10061258 3300017792 Bacteria 2739
399 Ga0163161_10080629 3300017792 Unclassified 2395
400 Ga0163161_10175387 3300017792 Bacteria 1641
401 Ga0213876_10000035 3300021384 Bacteria 186618
402 Ga0213876_10000762 3300021384 Bacteria 22235
403 Ga0207656_10000196 3300025321 Bacteria 21638
404 Ga0207653_10000289 3300025885 Bacteria 29336
405 Ga0207642_10051546 3300025899 Bacteria 1862
406 Ga0207710_10000001 3300025900 Bacteria 1797433
407 Ga0207710_10002132 3300025900 Bacteria 9346
408 Ga0207685_10000002 3300025905 Bacteria 438088
409 Ga0207699_10000041 3300025906 Bacteria 120229
410 Ga0207645_10047567 3300025907 Bacteria 2739
411 Ga0207643_10065818 3300025908 Bacteria 2077
412 Ga0207643_10081233 3300025908 Bacteria 1879
413 Ga0207684_10000448 3300025910 Bacteria 54372
414 Ga0207684_10005228 3300025910 Bacteria 12054
415 Ga0207684_10007380 3300025910 Bacteria 9912
416 Ga0207684_10058484 3300025910 Bacteria 3271
417 Ga0207684_10079174 3300025910 Bacteria 2796
418 Ga0207684_10119137 3300025910 Bacteria 2262
419 Ga0207654_10092193 3300025911 Bacteria 1849
420 Ga0207707_10000004 3300025912 Bacteria 391281
421 Ga0207707_10002069 3300025912 Bacteria 18184
422 Ga0207707_10016248 3300025912 Bacteria 6492
423 Ga0207707_10017642 3300025912 Bacteria 6226
424 Ga0207671_10004405 3300025914 Bacteria 13490
425 Ga0207671_10097359 3300025914 Bacteria 2224
426 Ga0207660_10000453 3300025917 Bacteria 26995
427 Ga0207662_10000911 3300025918 Bacteria 13686
428 Ga0207662_10002083 3300025918 Bacteria 9930
429 Ga0207662_10013746 3300025918 Bacteria 4530
430 Ga0207662_10066324 3300025918 Unclassified 2175
431 Ga0207657_10171705 3300025919 Bacteria 1756
432 Ga0207649_10172826 3300025920 Bacteria 1506
433 Ga0207652_10001059 3300025921 Bacteria 25028
434 Ga0207646_10002426 3300025922 Bacteria 22003
435 Ga0207646_10056678 3300025922 Bacteria 3502
436 Ga0207646_10135336 3300025922 Bacteria 2218
437 Ga0207646_10148363 3300025922 Bacteria 2114
438 Ga0207646_10169578 3300025922 Bacteria 1971
439 Ga0207681_10040535 3300025923 Bacteria 3099
440 Ga0207694_10000993 3300025924 Bacteria 24824
441 Ga0207650_10000001 3300025925 Bacteria 1545726
442 Ga0207650_10004340 3300025925 Bacteria 9686
443 Ga0207650_10062990 3300025925 Bacteria 2772
444 Ga0207650_10132974 3300025925 Bacteria 1949
445 Ga0207659_10068504 3300025926 Bacteria 2581
446 Ga0207659_10153954 3300025926 Unclassified 1798
447 Ga0207687_10164473 3300025927 Unclassified 1706
448 Ga0207700_10055439 3300025928 Bacteria 2979
449 Ga0207644_10000765 3300025931 Bacteria 20349
450 Ga0207690_10075415 3300025932 Bacteria 2339
451 Ga0207690_10082798 3300025932 Bacteria 2245
452 Ga0207706_10016349 3300025933 Bacteria 6698
453 Ga0207706_10096739 3300025933 Unclassified 2596
454 Ga0207706_10228182 3300025933 Bacteria 1630
455 Ga0207686_10000392 3300025934 Bacteria 30379
456 Ga0207686_10000659 3300025934 Bacteria 21331
457 Ga0207686_10000800 3300025934 Bacteria 19297
458 Ga0207686_10101198 3300025934 Bacteria 1924
459 Ga0207686_10157839 3300025934 Unclassified 1587
460 Ga0207709_10000037 3300025935 Bacteria 279771
461 Ga0207709_10001110 3300025935 Bacteria 19716
462 Ga0207709_10026191 3300025935 Unclassified 3347
463 Ga0207670_10039775 3300025936 Bacteria 3082
464 Ga0207670_10040260 3300025936 Bacteria 3067
465 Ga0207670_10099034 3300025936 Bacteria 2079
466 Ga0207669_10228068 3300025937 Bacteria 1372
467 Ga0207704_10179943 3300025938 Bacteria 1527
468 Ga0207665_10000056 3300025939 Bacteria 73322
469 Ga0207665_10059095 3300025939 Unclassified 2594
470 Ga0207691_10001245 3300025940 Bacteria 25434
471 Ga0207691_10010463 3300025940 Bacteria 8898
472 Ga0207711_10004416 3300025941 Bacteria 11989
473 Ga0207711_10095436 3300025941 Unclassified 2623
474 Ga0207711_10101169 3300025941 Bacteria 2550
475 Ga0207711_10132063 3300025941 Bacteria 2240
476 Ga0207711_10188968 3300025941 Bacteria 1876
477 Ga0207711_10270487 3300025941 Bacteria 1563
478 Ga0207689_10005406 3300025942 Bacteria 11431
479 Ga0207689_10007654 3300025942 Bacteria 9461
480 Ga0207689_10033562 3300025942 Bacteria 4265
481 Ga0207689_10039115 3300025942 Bacteria 3927
482 Ga0207679_10033761 3300025945 Bacteria 3604
483 Ga0207651_10000598 3300025960 Bacteria 15206
484 Ga0207651_10076486 3300025960 Bacteria 2393
485 Ga0207651_10235726 3300025960 Bacteria 1489
486 Ga0207651_10252184 3300025960 Bacteria 1444
487 Ga0207712_10000483 3300025961 Bacteria 33226
488 Ga0207712_10005221 3300025961 Bacteria 8213
489 Ga0207712_10005390 3300025961 Bacteria 8075
490 Ga0207712_10065356 3300025961 Bacteria 2596
491 Ga0207712_10132567 3300025961 Unclassified 1901
492 Ga0207668_10038622 3300025972 Bacteria 3206
493 Ga0207640_10081120 3300025981 Bacteria 2217
494 Ga0207640_10104738 3300025981 Bacteria 1992
495 Ga0207640_10119485 3300025981 Unclassified 1885
496 Ga0207640_10156036 3300025981 Bacteria 1683
497 Ga0207640_10274890 3300025981 Unclassified 1320
498 Ga0207640_10294699 3300025981 Bacteria 1280
499 Ga0207658_10075090 3300025986 Bacteria 2571
500 Ga0207677_10018989 3300026023 Unclassified 4140
501 Ga0207703_10000286 3300026035 Bacteria 55964
502 Ga0207703_10003889 3300026035 Bacteria 12402
503 Ga0207703_10117801 3300026035 Unclassified 2276
504 Ga0207703_10176856 3300026035 Bacteria 1881
505 Ga0207639_10025037 3300026041 Unclassified 4325
506 Ga0207639_10327353 3300026041 Bacteria 1362
507 Ga0207708_10000095 3300026075 Bacteria 67730
508 Ga0207708_10017019 3300026075 Bacteria 5472
509 Ga0207708_10025165 3300026075 Bacteria 4501
510 Ga0207708_10084063 3300026075 Bacteria 2447
511 Ga0207708_10120837 3300026075 Bacteria 2041
512 Ga0207641_10028158 3300026088 Bacteria 4641
513 Ga0207648_10006724 3300026089 Bacteria 11406
514 Ga0207648_10080790 3300026089 Bacteria 2836
515 Ga0207676_10010488 3300026095 Bacteria 6600
516 Ga0207676_10044728 3300026095 Unclassified 3417
517 Ga0207676_10147777 3300026095 Bacteria 2020
518 Ga0207676_10206539 3300026095 Bacteria 1739
519 Ga0207676_10289198 3300026095 Bacteria 1491
520 Ga0207674_10021048 3300026116 Bacteria 7034
521 Ga0207674_10087938 3300026116 Unclassified 3100
522 Ga0207675_100009031 3300026118 Bacteria 9351
523 Ga0207675_100023589 3300026118 Bacteria 5724
524 Ga0207675_100035077 3300026118 Bacteria 4679
525 Ga0207675_100036039 3300026118 Bacteria 4614
526 Ga0207675_100315039 3300026118 Bacteria 1526
527 Ga0207683_10013365 3300026121 Bacteria 7001
528 Ga0209970_1003290 3300027614 Bacteria 2722
529 Ga0209974_10001187 3300027876 Bacteria 9311
530 Ga0207428_10001203 3300027907 Bacteria 27741
531 Ga0207428_10013776 3300027907 Bacteria 7048
532 Ga0207428_10028773 3300027907 Unclassified 4613
533 Ga0268265_10000806 3300028380 Bacteria 29787
534 Ga0268265_10032353 3300028380 Bacteria 3789
535 Ga0268265_10072703 3300028380 Bacteria 2683
536 Ga0268265_10133475 3300028380 Bacteria 2067
537 Ga0268264_10001303 3300028381 Bacteria 23523
538 Ga0268264_10021213 3300028381 Bacteria 5307
539 Ga0268264_10032982 3300028381 Bacteria 4250
540 Ga0268264_10043518 3300028381 Unclassified 3721
541 Ga0268264_10073971 3300028381 Bacteria 2893
542 Ga0268264_10081646 3300028381 Bacteria 2764
543 Ga0307513_10012428 3300031456 Bacteria 10509
544 Ga0307408_100012226 3300031548 Bacteria 5681
545 Ga0307405_10192633 3300031731 Unclassified 1474
546 Ga0307410_10124044 3300031852 Bacteria 1888
547 Ga0307410_10146259 3300031852 Unclassified 1754
548 Ga0307407_10106495 3300031903 Unclassified 1752
549 Ga0307412_10009011 3300031911 Bacteria 5718
550 Ga0307416_100067270 3300032002 Bacteria 2954
551 Ga0307416_100146525 3300032002 Unclassified 2157
552 Ga0307416_100311685 3300032002 Bacteria 1571
553 Ga0307414_10008840 3300032004 Bacteria 5746
554 Ga0307414_10229402 3300032004 Bacteria 1530
555 Ga0307411_10187809 3300032005 Unclassified 1575
556 Ga0373929_0000008 3300035085 Bacteria 298561
557 Ga0373932_0035802 3300035112 Bacteria 1406
558 Ga0373961_0037741 3300035241 Bacteria 1382
559 Ga0373931_0005346 3300035691 Bacteria 5928
560 Ga0373927_0020175 3300035695 Bacteria 4369
561 Ga0373925_0003863 3300037068 Bacteria 11465
562 Ga0373925_0250390 3300037068 Bacteria 1421
563 Ga0395900_0060378 3300037418 Bacteria 3902
564 Ga0395900_0239970 3300037418 Unclassified 1819
565 Ga0395900_0246529 3300037418 Bacteria 1790
566 Ga0395898_0237596 3300037466 Bacteria 1738
567 Ga0395905_0012157 3300037471 Bacteria 8291
568 Ga0395905_0327928 3300037471 Bacteria 1421
569 Ga0395901_0216021 3300038443 Bacteria 2006
570 Ga0395901_0309621 3300038443 Unclassified 1636
571 Ga0242420_004528 3300038996 Unclassified 2107
572 Ga0436365_0054394 3300039437 Bacteria 83335
573 Ga0436365_0574100 3300039437 Bacteria 186636
574 Ga0451837_1550867 3300041494 Bacteria 1229
575 Ga0439434_0043234 3300042435 Bacteria 1386
576 Ga0451577_0043897 3300042876 Bacteria 4002
577 Ga0451577_0054859 3300042876 Bacteria 3557
578 Ga0451577_0083033 3300042876 Bacteria 2858
579 Ga0453683_0039294 3300044673 Bacteria 2974
580 Ga0453684_0112328 3300044712 Bacteria 3308
581 Ga0451576_0020290 3300045051 Bacteria 7239
582 Ga0451576_0026646 3300045051 Bacteria 6215
583 Ga0451576_0280356 3300045051 Bacteria 1742
584 Ga0451576_0295324 3300045051 Bacteria 1694
585 Ga0495629_0000223 3300046459 Bacteria 50594
586 Ga0495629_0117104 3300046459 Unclassified 1856
587 Ga0495582_0012682 3300046473 Bacteria 4645
588 Ga0495582_0259386 3300046473 Bacteria 997
589 Ga0495594_0050443 3300046499 Bacteria 2288
590 Ga0495632_0008496 3300046519 Bacteria 6293
591 Ga0495643_0000064 3300046522 Bacteria 179331
592 Ga0495586_0059272 3300046535 Bacteria 2080
593 Ga0495587_0125667 3300046536 Bacteria 1468
594 Ga0495621_0002583 3300046539 Bacteria 4883
595 Ga0495621_0007088 3300046539 Bacteria 3305
596 Ga0495645_0046136 3300046543 Unclassified 3177
597 Ga0495656_0042830 3300046615 Unclassified 1898
598 Ga0495668_0001365 3300046616 Bacteria 23932
599 Ga0495634_0005558 3300046642 Bacteria 9675
600 Ga0495635_0030511 3300046663 Bacteria 3746
601 Ga0495599_0098298 3300046678 Bacteria 1824
602 Ga0495647_0005584 3300046681 Bacteria 4129
603 Ga0495658_0000050 3300046683 Bacteria 59328
604 Ga0495658_0110971 3300046683 Bacteria 1649
605 Ga0495613_0004840 3300046689 Bacteria 10101
606 Ga0495600_0170060 3300046809 Unclassified 1407
607 Ga0495581_0000533 3300047315 Bacteria 19573
608 Ga0495581_0186821 3300047315 Bacteria 1212
609 Ga0495674_0184761 3300047319 Unclassified 1735
610 Ga0495676_0275131 3300047321 Bacteria 1141
611 Ga0495680_0000855 3300047322 Bacteria 33862
612 Ga0495680_0143573 3300047322 Bacteria 1745
613 Ga0495684_0194247 3300047471 Unclassified 1499
614 Ga0495614_0013783 3300048089 Bacteria 3543
615 Ga0496102_0073179 3300048905 Bacteria 3150
616 Ga0496104_0030518 3300048907 Bacteria 5010
617 Ga0496104_0119885 3300048907 Bacteria 2526
618 Ga0496106_0001962 3300048909 Bacteria 15461
619 Ga0496107_0202502 3300048910 Unclassified 1475
620 Ga0496112_0290524 3300048915 Bacteria 1581
621 Ga0496114_0125330 3300048917 Bacteria 2213
622 Ga0501297_000713 3300049520 Bacteria 2981
623 Ga0501298_000163 3300049521 Bacteria 8191
624 Ga0501299_003298 3300049522 Bacteria 2325
625 Ga0501299_012140 3300049522 Bacteria 1466
626 Ga0501031_0081657 3300049568 Bacteria 2107
627 Ga0501036_0044433 3300049572 Bacteria 3763
628 Ga0501038_0001767 3300049574 Bacteria 20103
629 Ga0501038_0252612 3300049574 Bacteria 1396
630 Ga0501040_0038353 3300049576 Bacteria 3257
631 Ga0501041_0106250 3300049577 Bacteria 1740
632 Ga0501071_0050537 3300049587 Bacteria 2995
633 Ga0501075_0304237 3300049591 Unclassified 1215
634 Ga0501198_002169 3300049649 Bacteria 2622
635 Ga0501216_002954 3300049660 Bacteria 2451
636 Ga0501223_008579 3300049663 Unclassified 2081
637 Ga0501223_012550 3300049663 Bacteria 1693
638 Ga0501224_006267 3300049664 Unclassified 1723
639 Ga0501227_001450 3300049665 Bacteria 5296
640 Ga0501233_002031 3300049668 Bacteria 3529
641 Ga0501233_007199 3300049668 Unclassified 2113
642 Ga0501233_009316 3300049668 Unclassified 1913
643 Ga0501235_005472 3300049669 Unclassified 2764
644 Ga0501247_005289 3300049677 Bacteria 1434
645 Ga0501249_010600 3300049679 Unclassified 1930
646 Ga0501221_019002 3300049704 Unclassified 1329
647 Ga0501234_005216 3300049707 Unclassified 2034
648 Ga0501079_0031133 3300049741 Bacteria 4100
649 Ga0501271_000922 3300049768 Bacteria 2479
650 Ga0501283_000161 3300049779 Bacteria 8519
651 Ga0501283_001941 3300049779 Bacteria 2669
652 Ga0501045_0019903 3300049824 Bacteria 4791
653 nmdc:mga05p37_104002_c1 3300050507 Bacteria 3494
654 nmdc:mga05p37_11175_c1 3300050507 Bacteria 10670
655 nmdc:mga05p37_40667_c1 3300050507 Bacteria 5709
656 nmdc:mga05p37_80156_c1 3300050507 Bacteria 4021
657 nmdc:mga09592_24647_c1 3300050508 Bacteria 4977
658 nmdc:mga0qj67_486949_c1 3300050509 Unclassified 992
659 nmdc:mga06r32_181022_c1 3300050510 Bacteria 2093
660 nmdc:mga08y16_189469_c1 3300050511 Unclassified 2134
661 nmdc:mga08y16_21226_c1 3300050511 Bacteria 6858
662 nmdc:mga08y16_2321_c1 3300050511 Bacteria 19497
663 nmdc:mga08y16_293442_c1 3300050511 Bacteria 1676
664 nmdc:mga08y16_46273_c1 3300050511 Bacteria 4555
665 nmdc:mga08y16_519414_c1 3300050511 Bacteria 1208
666 nmdc:mga08y16_8230_c1 3300050511 Bacteria 10908
667 nmdc:mga0n895_102942_c1 3300050512 Bacteria 2866
668 nmdc:mga0n895_151253_c1 3300050512 Bacteria 2351
669 nmdc:mga0n895_32280_c1 3300050512 Bacteria 5025
670 nmdc:mga0n895_49128_c1 3300050512 Bacteria 4131
671 nmdc:mga0n895_533520_c1 3300050512 Bacteria 1180
672 nmdc:mga0n895_55731_c1 3300050512 Bacteria 3891
673 nmdc:mga0n895_64729_c1 3300050512 Bacteria 3617
674 nmdc:mga0rr50_197068_c1 3300050513 Unclassified 1654
675 nmdc:mga0rr50_432_c1 3300050513 Bacteria 22538
676 nmdc:mga0rr50_87866_c1 3300050513 Unclassified 2413
677 nmdc:mga0rr50_90135_c1 3300050513 Unclassified 2385
678 nmdc:mga0rr50_93147_c1 3300050513 Bacteria 2350
679 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
680 nmdc:mga08x19_45093_c1 3300050514 Bacteria 2817
681 nmdc:mga08x19_72_c1 3300050514 Bacteria 96429
682 nmdc:mga0a205_151014_c1 3300050515 Bacteria 2222
683 nmdc:mga0a205_17790_c1 3300050515 Bacteria 6669
684 nmdc:mga0a205_233770_c1 3300050515 Unclassified 1721
685 nmdc:mga0a205_82144_c1 3300050515 Bacteria 3112
686 nmdc:mga0a205_9318_c1 3300050515 Bacteria 8965
687 Ga0495655_0002565 3300053083 Unclassified 2903
688 Ga0495619_0000904 3300053085 Bacteria 19429
689 Ga0500628_000102 3300053129 Bacteria 18162
690 Ga0500616_0006479 3300053153 Bacteria 7661
691 Ga0500616_0013582 3300053153 Bacteria 4720
692 Ga0501084_0029693 3300054114 Bacteria 4574
693 Ga0501082_0044057 3300060353 Bacteria 3849
694 Ga0530510_0034385 3300061734 Bacteria 3651
695 2920113114 2920107658 Bacteria 10042636
696 Ga0065707_10014126
697 SwRhRL2b_contig_1222003
698 JGI24034J14986_100637
699 JGI24748J21848_1000038
700 JGI24033J26618_1000166
701 JGI24034J26672_10000041
702 JGI24751J29686_10000040
703 JGI25406J46586_10003181
704 JGI25406J46586_10010884
705 Ga0065714_10064546
706 Ga0065704_10003849
707 Ga0065704_10102277
708 Ga0065712_10000133
709 Ga0065712_10008311
710 Ga0065712_10082206
711 Ga0065715_10002297
712 Ga0065715_10004230
713 Ga0065715_10019412
714 Ga0065715_10089428
715 Ga0065715_10108964
716 Ga0065715_10121504
717 Ga0065707_10001920
718 Ga0065707_10094009
719 Ga0065707_10094635
720 Ga0065707_10140031
721 Ga0070658_10012673
722 Ga0070676_10015707
723 Ga0070676_10040671
724 Ga0070683_100058887
725 Ga0070690_100003648
726 Ga0070690_100031603
727 Ga0070690_100036823
728 Ga0070690_100042115
729 Ga0070670_100000225
730 Ga0070670_100007289
731 Ga0070670_100078558
732 Ga0070670_100162928
733 Ga0068869_100003372
734 Ga0068869_100003484
735 Ga0068869_100015512
736 Ga0068869_100035085
737 Ga0070680_100002583
738 Ga0070680_100038250
739 Ga0070682_100000687
740 Ga0070682_100007382
741 Ga0070682_100012799
742 Ga0068868_100067335
743 Ga0068868_100103606
744 Ga0068868_100162610
745 Ga0068868_100246912
746 Ga0068868_100262482
747 Ga0070660_100040295
748 Ga0070689_100112133
749 Ga0070689_100156846
750 Ga0070691_10058141
751 Ga0070687_100000989
752 Ga0070687_100004694
753 Ga0070687_100015556
754 Ga0070668_100004628
755 Ga0070669_100007320
756 Ga0070675_100071996
757 Ga0070675_100104039
758 Ga0070674_100089695
759 Ga0070673_100000896
760 Ga0070673_100049946
761 Ga0070673_100105617
762 Ga0070673_100140296
763 Ga0070673_100151605
764 Ga0070688_100061690
765 Ga0070688_100070322
766 Ga0070659_100258454
767 Ga0070667_100038003
768 Ga0070667_100103843
769 Ga0070703_10000193
770 Ga0070709_10000074
771 Ga0070701_10080653
772 Ga0070705_100010194
773 Ga0070705_100037035
774 Ga0070700_100000090
775 Ga0070700_100077065
776 Ga0070700_100122049
777 Ga0070694_100013279
778 Ga0070694_100018716
779 Ga0070694_100020401
780 Ga0070694_100162943
781 Ga0070694_100162950
782 Ga0070708_100000189
783 Ga0070708_100085218
784 Ga0070678_100019413
785 Ga0070662_100004159
786 Ga0070662_100036792
787 Ga0070681_10000011
788 Ga0070681_10001243
789 Ga0068867_100069406
790 Ga0068867_100071357
791 Ga0068867_100132171
792 Ga0070685_10010181
793 Ga0070685_10054975
794 Ga0070706_100000312
795 Ga0070706_100017265
796 Ga0070706_100020535
797 Ga0070706_100037219
798 Ga0070706_100048757
799 Ga0070706_100075078
800 Ga0070706_100245202
801 Ga0070707_100000694
802 Ga0070707_100045113
803 Ga0070707_100045358
804 Ga0070707_100081676
805 Ga0070707_100129450
806 Ga0070707_100143826
807 Ga0070707_100211697
808 Ga0070698_100000374
809 Ga0070698_100006397
810 Ga0070698_100007201
811 Ga0070698_100009908
812 Ga0070698_100016433
813 Ga0070698_100018768
814 Ga0070698_100120403
815 Ga0070699_100059210
816 Ga0070699_100095926
817 Ga0070699_100168280
818 Ga0070699_100387118
819 Ga0070679_100000013
820 Ga0070679_100062295
821 Ga0070697_100001655
822 Ga0070697_100002135
823 Ga0070697_100005839
824 Ga0070697_100006124
825 Ga0070697_100017774
826 Ga0070697_100058023
827 Ga0070697_100144904
828 Ga0070697_100274967
829 Ga0068853_100008756
830 Ga0068853_100180631
831 Ga0068853_100195178
832 Ga0070672_100008730
833 Ga0070672_100038051
834 Ga0070686_100000015
835 Ga0070686_100012457
836 Ga0070686_100033600
837 Ga0070686_100065314
838 Ga0070695_100005519
839 Ga0070695_100025351
840 Ga0070695_100195034
841 Ga0070695_100199004
842 Ga0070696_100013630
843 Ga0070696_100020115
844 Ga0070696_100031992
845 Ga0070696_100034700
846 Ga0070696_100046945
847 Ga0070696_100054319
848 Ga0070696_100204767
849 Ga0070693_100006611
850 Ga0070693_100030470
851 Ga0070693_100050285
852 Ga0070693_100096936
853 Ga0070693_100151859
854 Ga0070704_100115883
855 Ga0070704_100219542
856 Ga0070704_100227720
857 Ga0068855_100141711
858 Ga0068855_100167704
859 Ga0068855_100198280
860 Ga0070664_100004096
861 Ga0068857_100217182
862 Ga0068854_100028198
863 Ga0068854_100032045
864 Ga0068854_100114080
865 Ga0068854_100116755
866 Ga0068854_100141965
867 Ga0068856_100287285
868 Ga0070702_100007300
869 Ga0070702_100037728
870 Ga0068852_100126769
871 Ga0068852_100422186
872 Ga0068859_100003763
873 Ga0068859_100005353
874 Ga0068859_100007721
875 Ga0068859_100021526
876 Ga0068859_100052343
877 Ga0068859_100057721
878 Ga0068859_100083303
879 Ga0068859_100133615
880 Ga0068859_100160967
881 Ga0068859_100277247
882 Ga0068864_100007568
883 Ga0068864_100039674
884 Ga0068864_100042480
885 Ga0068864_100047075
886 Ga0068864_100096058
887 Ga0068864_100117253
888 Ga0068864_100152500
889 Ga0068864_100229141
890 Ga0068866_10032998
891 Ga0068866_10041344
892 Ga0068861_100014064
893 Ga0068861_100018171
894 Ga0068861_100021110
895 Ga0068861_100032199
896 Ga0068861_100037526
897 Ga0068861_100150404
898 Ga0068861_100261846
899 Ga0068851_10001229
900 Ga0068870_10030708
901 Ga0068870_10170700
902 Ga0068863_100021036
903 Ga0068858_100009457
904 Ga0068858_100037873
905 Ga0068858_100047011
906 Ga0068858_100063999
907 Ga0068858_100154855
908 Ga0068860_100003472
909 Ga0068860_100008664
910 Ga0068860_100022684
911 Ga0068860_100027983
912 Ga0068860_100034874
913 Ga0068860_100127528
914 Ga0068860_100353377
915 Ga0068860_100430311
916 Ga0068862_100037797
917 Ga0068862_100044707
918 Ga0068862_100055428
919 Ga0068862_100123753
920 Ga0068862_100149993
921 Ga0068862_100416968
922 Ga0081455_10034980
923 Ga0081455_10103867
924 Ga0081538_10009201
925 Ga0081540_1019086
926 Ga0081539_10000297
927 Ga0081539_10000502
928 Ga0081539_10000796
929 Ga0081539_10002465
930 Ga0081539_10003882
931 Ga0081539_10028237
932 Ga0070715_10000002
933 Ga0070716_100000006
934 Ga0097621_100006186
935 Ga0097621_100143465
936 Ga0068871_100030874
937 Ga0068871_100038139
938 Ga0068871_100074664
939 Ga0068871_100081304
940 Ga0068871_100171164
941 Ga0075428_100000013
942 Ga0075428_100235445
943 Ga0075428_100275506
944 Ga0075428_100306837
945 Ga0075428_100425362
946 Ga0075431_100094775
947 Ga0075433_10001066
948 Ga0075433_10005746
949 Ga0075433_10069012
950 Ga0075433_10083167
951 Ga0075433_10187654
952 Ga0075434_100006909
953 Ga0075434_100007920
954 Ga0075434_100037159
955 Ga0075434_100039093
956 Ga0075434_100057787
957 Ga0075434_100072212
958 Ga0075434_100079111
959 Ga0075434_100101697
960 Ga0075434_100120976
961 Ga0075429_100140287
962 Ga0068865_100073730
963 Ga0075436_100000469
964 Ga0075436_100001434
965 Ga0075436_100006536
966 Ga0075436_100038496
967 Ga0097620_100003763
968 Ga0097620_100005353
969 Ga0097620_100007721
970 Ga0097620_100021524
971 Ga0097620_100052344
972 Ga0097620_100057724
973 Ga0097620_100083308
974 Ga0097620_100133623
975 Ga0097620_100160980
976 Ga0097620_100277232
977 Ga0075435_100001008
978 Ga0075435_100039407
979 Ga0075435_100051044
980 Ga0075435_100102275
981 Ga0075435_100126873
982 Ga0099794_10003728
983 Ga0105240_10122524
984 Ga0105240_10168305
985 Ga0111539_10009788
986 Ga0111539_10011762
987 Ga0111539_10019650
988 Ga0111539_10061745
989 Ga0111539_10075952
990 Ga0111539_10104643
991 Ga0111539_10181499
992 Ga0111539_10427022
993 Ga0105245_10063956
994 Ga0105247_10000142
995 Ga0105247_10013688
996 Ga0114129_10016316
997 Ga0114129_10017644
998 Ga0114129_10023666
999 Ga0114129_10033829
1000 Ga0114129_10045516
1001 Ga0114129_10058226
1002 Ga0114129_10065400
1003 Ga0114129_10072036
1004 Ga0114129_10116633
1005 Ga0114129_10271624
1006 Ga0105243_10000460
1007 Ga0105243_10001520
1008 Ga0105243_10024254
1009 Ga0105243_10077260
1010 Ga0105243_10091277
1011 Ga0105243_10143214
1012 Ga0105241_10012097
1013 Ga0105241_10031389
1014 Ga0105241_10081589
1015 Ga0105241_10105554
1016 Ga0105241_10110709
1017 Ga0105241_10153647
1018 Ga0105242_10000606
1019 Ga0105242_10001223
1020 Ga0105242_10001732
1021 Ga0105242_10005533
1022 Ga0105242_10017594
1023 Ga0105242_10101613
1024 Ga0105248_10008670
1025 Ga0105248_10009966
1026 Ga0105248_10011136
1027 Ga0105248_10019330
1028 Ga0105248_10121129
1029 Ga0105248_10163345
1030 Ga0105237_10006126
1031 Ga0105237_10016051
1032 Ga0105237_10095656
1033 Ga0105237_10116323
1034 Ga0105238_10001168
1035 Ga0105249_10000025
1036 Ga0105249_10022642
1037 Ga0105249_10053615
1038 Ga0105249_10055312
1039 Ga0105249_10234273
1040 Ga0105249_10293585
1041 Ga0105239_10009239
1042 Ga0105239_10079400
1043 Ga0105239_10354118
1044 Ga0105239_10384242
1045 Ga0105246_10020466
1046 Ga0105246_10149997
1047 Ga0157373_10073483
1048 Ga0157373_10125509
1049 Ga0157370_10054977
1050 Ga0157374_10043209
1051 Ga0157378_10000002
1052 Ga0157378_10002351
1053 Ga0157378_10005723
1054 Ga0157378_10020796
1055 Ga0157378_10036584
1056 Ga0157378_10058105
1057 Ga0157378_10078721
1058 Ga0157378_10133701
1059 Ga0157378_10188788
1060 Ga0157378_10328241
1061 Ga0163162_10000002
1062 Ga0163162_10006565
1063 Ga0163162_10009177
1064 Ga0163162_10014781
1065 Ga0163162_10036493
1066 Ga0163162_10037457
1067 Ga0163162_10106971
1068 Ga0163162_10294132
1069 Ga0157372_10193697
1070 Ga0157372_10266981
1071 Ga0157375_10003637
1072 Ga0157375_10070716
1073 Ga0157375_10149135
1074 Ga0157375_10157217
1075 Ga0157375_10372976
1076 Ga0163163_10000083
1077 Ga0163163_10002212
1078 Ga0163163_10017600
1079 Ga0163163_10019605
1080 Ga0163163_10059997
1081 Ga0163163_10062654
1082 Ga0163163_10108537
1083 Ga0157380_10002001
1084 Ga0157380_10012722
1085 Ga0157380_10071301
1086 Ga0157377_10010891
1087 Ga0157377_10019496
1088 Ga0157379_10049837
1089 Ga0157379_10123318
1090 Ga0157379_10147257
1091 Ga0157379_10247247
1092 Ga0157376_10139923
1093 Ga0163161_10061258
1094 Ga0163161_10080629
1095 Ga0163161_10175387
1096 Ga0213876_10000035
1097 Ga0213876_10000762
1098 Ga0207656_10000196
1099 Ga0207653_10000289
1100 Ga0207642_10051546
1101 Ga0207710_10000001
1102 Ga0207710_10002132
1103 Ga0207685_10000002
1104 Ga0207699_10000041
1105 Ga0207645_10047567
1106 Ga0207643_10065818
1107 Ga0207643_10081233
1108 Ga0207684_10000448
1109 Ga0207684_10005228
1110 Ga0207684_10007380
1111 Ga0207684_10058484
1112 Ga0207684_10079174
1113 Ga0207684_10119137
1114 Ga0207654_10092193
1115 Ga0207707_10000004
1116 Ga0207707_10002069
1117 Ga0207707_10016248
1118 Ga0207707_10017642
1119 Ga0207671_10004405
1120 Ga0207671_10097359
1121 Ga0207660_10000453
1122 Ga0207662_10000911
1123 Ga0207662_10002083
1124 Ga0207662_10013746
1125 Ga0207662_10066324
1126 Ga0207657_10171705
1127 Ga0207649_10172826
1128 Ga0207652_10001059
1129 Ga0207646_10002426
1130 Ga0207646_10056678
1131 Ga0207646_10135336
1132 Ga0207646_10148363
1133 Ga0207646_10169578
1134 Ga0207681_10040535
1135 Ga0207694_10000993
1136 Ga0207650_10000001
1137 Ga0207650_10004340
1138 Ga0207650_10062990
1139 Ga0207650_10132974
1140 Ga0207659_10068504
1141 Ga0207659_10153954
1142 Ga0207687_10164473
1143 Ga0207700_10055439
1144 Ga0207644_10000765
1145 Ga0207690_10075415
1146 Ga0207690_10082798
1147 Ga0207706_10016349
1148 Ga0207706_10096739
1149 Ga0207706_10228182
1150 Ga0207686_10000392
1151 Ga0207686_10000659
1152 Ga0207686_10000800
1153 Ga0207686_10101198
1154 Ga0207686_10157839
1155 Ga0207709_10000037
1156 Ga0207709_10001110
1157 Ga0207709_10026191
1158 Ga0207670_10039775
1159 Ga0207670_10040260
1160 Ga0207670_10099034
1161 Ga0207669_10228068
1162 Ga0207704_10179943
1163 Ga0207665_10000056
1164 Ga0207665_10059095
1165 Ga0207691_10001245
1166 Ga0207691_10010463
1167 Ga0207711_10004416
1168 Ga0207711_10095436
1169 Ga0207711_10101169
1170 Ga0207711_10132063
1171 Ga0207711_10188968
1172 Ga0207711_10270487
1173 Ga0207689_10005406
1174 Ga0207689_10007654
1175 Ga0207689_10033562
1176 Ga0207689_10039115
1177 Ga0207679_10033761
1178 Ga0207651_10000598
1179 Ga0207651_10076486
1180 Ga0207651_10235726
1181 Ga0207651_10252184
1182 Ga0207712_10000483
1183 Ga0207712_10005221
1184 Ga0207712_10005390
1185 Ga0207712_10065356
1186 Ga0207712_10132567
1187 Ga0207668_10038622
1188 Ga0207640_10081120
1189 Ga0207640_10104738
1190 Ga0207640_10119485
1191 Ga0207640_10156036
1192 Ga0207640_10274890
1193 Ga0207640_10294699
1194 Ga0207658_10075090
1195 Ga0207677_10018989
1196 Ga0207703_10000286
1197 Ga0207703_10003889
1198 Ga0207703_10117801
1199 Ga0207703_10176856
1200 Ga0207639_10025037
1201 Ga0207639_10327353
1202 Ga0207708_10000095
1203 Ga0207708_10017019
1204 Ga0207708_10025165
1205 Ga0207708_10084063
1206 Ga0207708_10120837
1207 Ga0207641_10028158
1208 Ga0207648_10006724
1209 Ga0207648_10080790
1210 Ga0207676_10010488
1211 Ga0207676_10044728
1212 Ga0207676_10147777
1213 Ga0207676_10206539
1214 Ga0207676_10289198
1215 Ga0207674_10021048
1216 Ga0207674_10087938
1217 Ga0207675_100009031
1218 Ga0207675_100023589
1219 Ga0207675_100035077
1220 Ga0207675_100036039
1221 Ga0207675_100315039
1222 Ga0207683_10013365
1223 Ga0209970_1003290
1224 Ga0209974_10001187
1225 Ga0207428_10001203
1226 Ga0207428_10013776
1227 Ga0207428_10028773
1228 Ga0268265_10000806
1229 Ga0268265_10032353
1230 Ga0268265_10072703
1231 Ga0268265_10133475
1232 Ga0268264_10001303
1233 Ga0268264_10021213
1234 Ga0268264_10032982
1235 Ga0268264_10043518
1236 Ga0268264_10073971
1237 Ga0268264_10081646
1238 Ga0307513_10012428
1239 Ga0307408_100012226
1240 Ga0307405_10192633
1241 Ga0307410_10124044
1242 Ga0307410_10146259
1243 Ga0307407_10106495
1244 Ga0307412_10009011
1245 Ga0307416_100067270
1246 Ga0307416_100146525
1247 Ga0307416_100311685
1248 Ga0307414_10008840
1249 Ga0307414_10229402
1250 Ga0307411_10187809
1251 Ga0373929_0000008
1252 Ga0373932_0035802
1253 Ga0373961_0037741
1254 Ga0373931_0005346
1255 Ga0373927_0020175
1256 Ga0373925_0003863
1257 Ga0373925_0250390
1258 Ga0395900_0060378
1259 Ga0395900_0239970
1260 Ga0395900_0246529
1261 Ga0395898_0237596
1262 Ga0395905_0012157
1263 Ga0395905_0327928
1264 Ga0395901_0216021
1265 Ga0395901_0309621
1266 Ga0242420_004528
1267 Ga0436365_0054394
1268 Ga0436365_0574100
1269 Ga0451837_1550867
1270 Ga0439434_0043234
1271 Ga0451577_0043897
1272 Ga0451577_0054859
1273 Ga0451577_0083033
1274 Ga0453683_0039294
1275 Ga0453684_0112328
1276 Ga0451576_0020290
1277 Ga0451576_0026646
1278 Ga0451576_0280356
1279 Ga0451576_0295324
1280 Ga0495629_0000223
1281 Ga0495629_0117104
1282 Ga0495582_0012682
1283 Ga0495582_0259386
1284 Ga0495594_0050443
1285 Ga0495632_0008496
1286 Ga0495643_0000064
1287 Ga0495586_0059272
1288 Ga0495587_0125667
1289 Ga0495621_0002583
1290 Ga0495621_0007088
1291 Ga0495645_0046136
1292 Ga0495656_0042830
1293 Ga0495668_0001365
1294 Ga0495634_0005558
1295 Ga0495635_0030511
1296 Ga0495599_0098298
1297 Ga0495647_0005584
1298 Ga0495658_0000050
1299 Ga0495658_0110971
1300 Ga0495613_0004840
1301 Ga0495600_0170060
1302 Ga0495581_0000533
1303 Ga0495581_0186821
1304 Ga0495674_0184761
1305 Ga0495676_0275131
1306 Ga0495680_0000855
1307 Ga0495680_0143573
1308 Ga0495684_0194247
1309 Ga0495614_0013783
1310 Ga0496102_0073179
1311 Ga0496104_0030518
1312 Ga0496104_0119885
1313 Ga0496106_0001962
1314 Ga0496107_0202502
1315 Ga0496112_0290524
1316 Ga0496114_0125330
1317 Ga0501297_000713
1318 Ga0501298_000163
1319 Ga0501299_003298
1320 Ga0501299_012140
1321 Ga0501031_0081657
1322 Ga0501036_0044433
1323 Ga0501038_0001767
1324 Ga0501038_0252612
1325 Ga0501040_0038353
1326 Ga0501041_0106250
1327 Ga0501071_0050537
1328 Ga0501075_0304237
1329 Ga0501198_002169
1330 Ga0501216_002954
1331 Ga0501223_008579
1332 Ga0501223_012550
1333 Ga0501224_006267
1334 Ga0501227_001450
1335 Ga0501233_002031
1336 Ga0501233_007199
1337 Ga0501233_009316
1338 Ga0501235_005472
1339 Ga0501247_005289
1340 Ga0501249_010600
1341 Ga0501221_019002
1342 Ga0501234_005216
1343 Ga0501079_0031133
1344 Ga0501271_000922
1345 Ga0501283_000161
1346 Ga0501283_001941
1347 Ga0501045_0019903
1348 nmdc:mga05p37_104002_c1
1349 nmdc:mga05p37_11175_c1
1350 nmdc:mga05p37_40667_c1
1351 nmdc:mga05p37_80156_c1
1352 nmdc:mga09592_24647_c1
1353 nmdc:mga0qj67_486949_c1
1354 nmdc:mga06r32_181022_c1
1355 nmdc:mga08y16_189469_c1
1356 nmdc:mga08y16_21226_c1
1357 nmdc:mga08y16_2321_c1
1358 nmdc:mga08y16_293442_c1
1359 nmdc:mga08y16_46273_c1
1360 nmdc:mga08y16_519414_c1
1361 nmdc:mga08y16_8230_c1
1362 nmdc:mga0n895_102942_c1
1363 nmdc:mga0n895_151253_c1
1364 nmdc:mga0n895_32280_c1
1365 nmdc:mga0n895_49128_c1
1366 nmdc:mga0n895_533520_c1
1367 nmdc:mga0n895_55731_c1
1368 nmdc:mga0n895_64729_c1
1369 nmdc:mga0rr50_197068_c1
1370 nmdc:mga0rr50_432_c1
1371 nmdc:mga0rr50_87866_c1
1372 nmdc:mga0rr50_90135_c1
1373 nmdc:mga0rr50_93147_c1
1374 nmdc:mga08x19_27_c1
1375 nmdc:mga08x19_45093_c1
1376 nmdc:mga08x19_72_c1
1377 nmdc:mga0a205_151014_c1
1378 nmdc:mga0a205_17790_c1
1379 nmdc:mga0a205_233770_c1
1380 nmdc:mga0a205_82144_c1
1381 nmdc:mga0a205_9318_c1
1382 Ga0495655_0002565
1383 Ga0495619_0000904
1384 Ga0500628_000102
1385 Ga0500616_0006479
1386 Ga0500616_0013582
1387 Ga0501084_0029693
1388 Ga0501082_0044057
1389 Ga0530510_0034385
1390 2920113114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01916

DS

Deoxyhypusine synthase

85

401

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dft-assembly2.cif.gz_F trypanosoma brucei deoxyhypusine synthase 0.8361 25 339
6w3z-assembly1.cif.gz_D crystal structure of brugia malayi deoxyhypusine synthase (dhps) 0.8292 3 346
7cmc-assembly1.cif.gz_B crystal structure of deoxyhypusine synthase from pyrococcus horikoshii 0.8227 11 343
6dft-assembly1.cif.gz_B trypanosoma brucei deoxyhypusine synthase 0.8222 25 339
6w3z-assembly1.cif.gz_A crystal structure of brugia malayi deoxyhypusine synthase (dhps) 0.819 3 346
ID Description Score Start End Superfamily
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.8187 11 343 3.40.910.10
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.8061 11 343 3.40.910.10
6dftL00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.8001 16 339 3.40.910.10
6dftL00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.7836 16 339 3.40.910.10
af_Q6NYK1_8_355_3.40.910.10 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.7666 14 344 3.40.910.10
ID Description Score Start End GO Terms
AF-A0A2V7MBB5-F1-model_v4 Deoxyhypusine synthase 0.9827 8 221
AF-A0A832LU54-F1-model_v4 Deoxyhypusine synthase 0.9796 58 166
AF-A0A7C3JTL5-F1-model_v4 Deoxyhypusine synthase 0.9784 8 262 GO:0005737
GO:0034038
AF-A0A7W0NH85-F1-model_v4 deleted 0.9759 1 270
AF-A0A6P0IZ47-F1-model_v4 Deoxyhypusine synthase 0.9724 1 291 GO:0005737
GO:0034038

Map