F475762

General Info

Members Datasets Scaffolds Average Seq Length
694 354 1388 133

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0061790|Ga0500566_0061790_835_1287
Length 150
Sequence VISPVVVPSRPAPQIVGVPLHLTKVAYGCDSIEFLQERLALKAAHLPAFLTTRYLPKRHEEIAGGSLFWIIKHQLIGRSPILGFGEAEGGRVAIYLEPKLVLVQARPKRAHQGWRYLEGKDAPVDLGEAGAGVSEMPAGLVGELAAMGLI

Samples

Sample ID Description Type Environment
1 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
89 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
90 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
195 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
198 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
214 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
298 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
299 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
300 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
323 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
328 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
329 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
330 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
331 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
332 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
333 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
336 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
337 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
338 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
339 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
340 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
341 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
342 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
343 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
344 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
345 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
346 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
347 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
348 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
349 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
350 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
351 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
352 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
353 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
354 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 0.29
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 18.59
Nodule 0.14
Rhizoplane 4.32
Rhizosphere 66.71
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500566_0061790 3300053094 Bacteria 2119
2 SwRhRL2b_contig_1622313 2162886007 Bacteria 3722
3 JGI24736J21556_1003820 3300001904 Bacteria 2598
4 JGI24741J21665_1000040 3300001915 Bacteria 30851
5 JGI24741J21665_1001934 3300001915 Bacteria 5589
6 JGI24741J21665_1003189 3300001915 Bacteria 3999
7 JGI24747J21853_1028669 3300001978 Bacteria 630
8 JGI24740J21852_10000683 3300001979 Bacteria 14697
9 JGI24740J21852_10005582 3300001979 Bacteria 5300
10 JGI24739J22299_10017450 3300001989 Bacteria 2590
11 JGI24739J22299_10127675 3300001989 Bacteria 757
12 JGI24737J22298_10001811 3300001990 Bacteria 7657
13 JGI24737J22298_10004112 3300001990 Bacteria 5083
14 JGI24735J21928_10015828 3300002067 Bacteria 2347
15 JGI24735J21928_10030560 3300002067 Bacteria 1600
16 JGI24738J21930_10012519 3300002075 Bacteria 1853
17 JGI24738J21930_10028041 3300002075 Bacteria 1152
18 JGI24738J21930_10065350 3300002075 Bacteria 749
19 JGI25150J39212_1000336 3300002774 Bacteria 23118
20 JGI25151J46595_10009573 3300003187 Bacteria 4573
21 JGI25165J46597_1000010 3300003214 Bacteria 442113
22 JGI25153J46596_10000045 3300003215 Bacteria 149347
23 JGI25153J46596_10000055 3300003215 Bacteria 135518
24 rootL2_10087041 3300003322 Bacteria 1864
25 Ga0055525_1000139 3300003759 Bacteria 102623
26 Ga0055542_1000012 3300003762 Bacteria 391808
27 Ga0055529_1000002 3300003763 Bacteria 537914
28 Ga0055529_1000004 3300003763 Bacteria 433331
29 Ga0055526_1003322 3300003771 Bacteria 10285
30 Ga0055537_1003069 3300003773 Bacteria 5260
31 Ga0055524_1000405 3300003775 Bacteria 36783
32 Ga0055530_10000429 3300003791 Bacteria 37251
33 Ga0055530_10011966 3300003791 Bacteria 3062
34 Ga0055530_10019378 3300003791 Bacteria 2062
35 Ga0055540_1003589 3300003792 Bacteria 7411
36 Ga0055540_1008407 3300003792 Bacteria 3722
37 Ga0055531_10000472 3300003794 Bacteria 37251
38 Ga0055531_10062885 3300003794 Bacteria 896
39 Ga0065165_1005026 3300005262 Bacteria 7732
40 Ga0065165_1005638 3300005262 Bacteria 6923
41 Ga0065165_1028550 3300005262 Bacteria 1800
42 Ga0065165_1028877 3300005262 Bacteria 1784
43 Ga0065165_1061201 3300005262 Bacteria 1031
44 Ga0065704_10006330 3300005289 Bacteria 6170
45 Ga0065704_10023989 3300005289 Bacteria 1784
46 Ga0065707_10031451 3300005295 Bacteria 1171
47 Ga0070658_10013837 3300005327 Bacteria 6474
48 Ga0070658_10035931 3300005327 Bacteria 3992
49 Ga0070658_10290327 3300005327 Bacteria 1393
50 Ga0070683_100047555 3300005329 Bacteria 3964
51 Ga0070690_101619715 3300005330 Bacteria 525
52 Ga0070670_101293105 3300005331 Bacteria 668
53 Ga0070680_100004141 3300005336 Bacteria 10865
54 Ga0070680_100225412 3300005336 Bacteria 1582
55 Ga0068868_100185283 3300005338 Bacteria 1729
56 Ga0070660_100001140 3300005339 Bacteria 17931
57 Ga0070660_100032203 3300005339 Bacteria 3944
58 Ga0070660_100741612 3300005339 Bacteria 824
59 Ga0070660_100772007 3300005339 Bacteria 808
60 Ga0070661_100002597 3300005344 Bacteria 12386
61 Ga0070661_100004660 3300005344 Bacteria 9447
62 Ga0070661_100230706 3300005344 Bacteria 1422
63 Ga0070661_100238001 3300005344 Bacteria 1401
64 Ga0070668_100038482 3300005347 Bacteria 3656
65 Ga0070668_100155968 3300005347 Bacteria 1849
66 Ga0070669_100143950 3300005353 Bacteria 1840
67 Ga0070669_100325011 3300005353 Bacteria 1243
68 Ga0070669_100805310 3300005353 Bacteria 799
69 Ga0070675_100287378 3300005354 Bacteria 1447
70 Ga0070671_100024178 3300005355 Bacteria 4973
71 Ga0070674_100003448 3300005356 Bacteria 8884
72 Ga0070674_100044285 3300005356 Bacteria 3033
73 Ga0070659_100013536 3300005366 Bacteria 6074
74 Ga0070659_100059768 3300005366 Bacteria 3009
75 Ga0070659_100751692 3300005366 Bacteria 846
76 Ga0070659_101590225 3300005366 Bacteria 583
77 Ga0070659_101998896 3300005366 Bacteria 520
78 Ga0070663_100003780 3300005455 Bacteria 8796
79 Ga0070678_100000716 3300005456 Bacteria 16449
80 Ga0070678_100106440 3300005456 Bacteria 2185
81 Ga0070662_100003088 3300005457 Bacteria 10337
82 Ga0070662_100052119 3300005457 Bacteria 2957
83 Ga0070662_100187498 3300005457 Bacteria 1633
84 Ga0070662_100289142 3300005457 Bacteria 1328
85 Ga0070681_10030642 3300005458 Bacteria 5398
86 Ga0070679_100016361 3300005530 Bacteria 7152
87 Ga0070679_100055674 3300005530 Bacteria 3939
88 Ga0070679_100481548 3300005530 Bacteria 1185
89 Ga0070679_101008469 3300005530 Bacteria 777
90 Ga0068853_100000508 3300005539 Bacteria 26343
91 Ga0068853_100125567 3300005539 Bacteria 2292
92 Ga0068853_100157191 3300005539 Bacteria 2049
93 Ga0068853_100256685 3300005539 Bacteria 1606
94 Ga0068853_100324206 3300005539 Bacteria 1428
95 Ga0070672_100021173 3300005543 Bacteria 4753
96 Ga0070665_100000088 3300005548 Bacteria 177729
97 Ga0070665_100007364 3300005548 Bacteria 11193
98 Ga0070665_100495857 3300005548 Bacteria 1232
99 Ga0070665_100618934 3300005548 Bacteria 1096
100 Ga0068855_100002675 3300005563 Bacteria 21961
101 Ga0068855_100010367 3300005563 Bacteria 11243
102 Ga0068855_100165371 3300005563 Bacteria 2508
103 Ga0068855_100403104 3300005563 Bacteria 1498
104 Ga0070664_100023720 3300005564 Bacteria 5067
105 Ga0070664_100042413 3300005564 Bacteria 3841
106 Ga0068857_100025986 3300005577 Bacteria 5157
107 Ga0068857_100029633 3300005577 Bacteria 4830
108 Ga0068857_100111621 3300005577 Bacteria 2458
109 Ga0068857_100852251 3300005577 Bacteria 872
110 Ga0068854_100040676 3300005578 Bacteria 3281
111 Ga0068854_100163947 3300005578 Bacteria 1724
112 Ga0068854_100292280 3300005578 Bacteria 1315
113 Ga0068854_101466641 3300005578 Bacteria 618
114 Ga0068856_100009552 3300005614 Bacteria 9420
115 Ga0068856_100036170 3300005614 Bacteria 4841
116 Ga0068859_100000448 3300005617 Bacteria 41237
117 Ga0068864_100440207 3300005618 Bacteria 1245
118 Ga0068861_100000037 3300005719 Bacteria 60283
119 Ga0068861_100496738 3300005719 Bacteria 1102
120 Ga0068851_10021057 3300005834 Bacteria 3163
121 Ga0068858_100000275 3300005842 Bacteria 55318
122 Ga0068858_100000487 3300005842 Bacteria 41394
123 Ga0068858_100033032 3300005842 Bacteria 4806
124 Ga0081539_10033187 3300005985 Bacteria 3149
125 Ga0075368_10002233 3300006042 Bacteria 6294
126 Ga0075363_100019579 3300006048 Bacteria 3385
127 Ga0075363_100049797 3300006048 Bacteria 2231
128 Ga0075364_10091081 3300006051 Bacteria 2023
129 Ga0075362_10000119 3300006177 Bacteria 22052
130 Ga0075367_10050353 3300006178 Bacteria 2459
131 Ga0075369_10000252 3300006186 Bacteria 15880
132 Ga0075366_10000014 3300006195 Bacteria 66940
133 Ga0075366_10326751 3300006195 Bacteria 940
134 Ga0097621_100015978 3300006237 Bacteria 5660
135 Ga0075370_10000141 3300006353 Bacteria 24359
136 Ga0075370_10286313 3300006353 Bacteria 979
137 Ga0068871_101326830 3300006358 Bacteria 677
138 Ga0068865_100293249 3300006881 Bacteria 1299
139 Ga0097620_100000448 3300006931 Bacteria 41237
140 Ga0079104_1019865 3300006946 Bacteria 1865
141 Ga0105251_10001301 3300009011 Bacteria 21561
142 Ga0105240_10066571 3300009093 Bacteria 4468
143 Ga0105240_10256228 3300009093 Bacteria 2021
144 Ga0105240_11510703 3300009093 Bacteria 704
145 Ga0105245_10002918 3300009098 Bacteria 15347
146 Ga0114129_11141922 3300009147 Bacteria 973
147 Ga0105243_10000208 3300009148 Bacteria 68900
148 Ga0105243_10042992 3300009148 Bacteria 3540
149 Ga0105243_10224350 3300009148 Unclassified 1663
150 Ga0105241_10000685 3300009174 Bacteria 25528
151 Ga0105241_10072048 3300009174 Bacteria 2684
152 Ga0105241_11269037 3300009174 Bacteria 700
153 Ga0105242_10438261 3300009176 Bacteria 1229
154 Ga0105248_10012274 3300009177 Bacteria 9449
155 Ga0105248_10014451 3300009177 Bacteria 8691
156 Ga0105237_10019381 3300009545 Bacteria 7027
157 Ga0105237_10021147 3300009545 Bacteria 6693
158 Ga0105237_10171738 3300009545 Bacteria 2168
159 Ga0105238_10034028 3300009551 Bacteria 5186
160 Ga0105238_10301392 3300009551 Bacteria 1586
161 Ga0105238_11244916 3300009551 Bacteria 769
162 Ga0105238_12137252 3300009551 Bacteria 594
163 Ga0105249_10031157 3300009553 Bacteria 4821
164 Ga0105148_100193 3300009978 Bacteria 8842
165 Ga0105239_11268213 3300010375 Bacteria 850
166 Ga0105239_12212531 3300010375 Bacteria 639
167 Ga0105246_10000589 3300011119 Bacteria 20145
168 Ga0105246_10021501 3300011119 Bacteria 4152
169 Ga0157317_1001966 3300012475 Bacteria 1172
170 Ga0157324_1018166 3300012506 Bacteria 688
171 Ga0157326_1001890 3300012513 Bacteria 2271
172 Ga0157373_10017159 3300013100 Bacteria 5271
173 Ga0157373_10023178 3300013100 Bacteria 4502
174 Ga0157373_10149039 3300013100 Bacteria 1646
175 Ga0157373_10450964 3300013100 Bacteria 926
176 Ga0157373_10554512 3300013100 Bacteria 834
177 Ga0157373_10810250 3300013100 Bacteria 691
178 Ga0157371_10000290 3300013102 Bacteria 67914
179 Ga0157371_10017135 3300013102 Bacteria 5389
180 Ga0157371_10138650 3300013102 Bacteria 1732
181 Ga0157371_11210662 3300013102 Bacteria 582
182 Ga0157370_10003089 3300013104 Bacteria 19709
183 Ga0157370_10056667 3300013104 Bacteria 3730
184 Ga0157370_10069774 3300013104 Bacteria 3319
185 Ga0157370_10234101 3300013104 Bacteria 1700
186 Ga0157370_11409469 3300013104 Bacteria 627
187 Ga0157369_10003745 3300013105 Bacteria 18064
188 Ga0157369_10081911 3300013105 Bacteria 3453
189 Ga0157369_10415836 3300013105 Bacteria 1394
190 Ga0157369_10939503 3300013105 Bacteria 886
191 Ga0157369_11389098 3300013105 Bacteria 715
192 Ga0157374_10269663 3300013296 Bacteria 1678
193 Ga0163162_10271955 3300013306 Bacteria 1826
194 Ga0163162_10978415 3300013306 Bacteria 956
195 Ga0163162_11715278 3300013306 Bacteria 717
196 Ga0157372_10001844 3300013307 Bacteria 22969
197 Ga0157372_10031040 3300013307 Bacteria 5848
198 Ga0157372_10259456 3300013307 Bacteria 2018
199 Ga0157372_10350919 3300013307 Bacteria 1719
200 Ga0157372_10929787 3300013307 Bacteria 1008
201 Ga0157375_10048508 3300013308 Bacteria 4154
202 Ga0157375_10723756 3300013308 Bacteria 1148
203 Ga0157375_12603108 3300013308 Bacteria 604
204 Ga0157380_10029053 3300014326 Bacteria 4224
205 Ga0157380_10052396 3300014326 Bacteria 3231
206 Ga0157380_13421021 3300014326 Bacteria 508
207 Ga0157379_10112046 3300014968 Bacteria 2451
208 Ga0157379_12000994 3300014968 Bacteria 572
209 Ga0157376_11617030 3300014969 Bacteria 682
210 Ga0183363_1003 3300015690 Bacteria 421263
211 Ga0163161_10273004 3300017792 Bacteria 1324
212 Ga0163161_11337015 3300017792 Bacteria 624
213 Ga0206354_10419039 3300020081 Bacteria 591
214 Ga0206353_11171589 3300020082 Bacteria 899
215 Ga0213874_10020655 3300021377 Bacteria 1808
216 Ga0209674_111773 3300025226 Bacteria 879
217 Ga0209147_100963 3300025229 Bacteria 12611
218 Ga0209563_100070 3300025230 Bacteria 249779
219 Ga0209563_126701 3300025230 Bacteria 584
220 Ga0209437_117894 3300025233 Bacteria 921
221 Ga0209437_121717 3300025233 Bacteria 766
222 Ga0207425_1000005 3300025245 Bacteria 900502
223 Ga0207425_1022674 3300025245 Bacteria 1320
224 Ga0209646_1022189 3300025246 Bacteria 906
225 Ga0209677_108591 3300025253 Bacteria 1954
226 Ga0209148_1000008 3300025254 Bacteria 1504371
227 Ga0209148_1042294 3300025254 Bacteria 625
228 Ga0209129_1001045 3300025258 Bacteria 16360
229 Ga0209233_1000044 3300025261 Bacteria 489783
230 Ga0209233_1032953 3300025261 Bacteria 1193
231 Ga0209565_1000029 3300025263 Bacteria 340335
232 Ga0209565_1000272 3300025263 Bacteria 52468
233 Ga0209455_1000002 3300025272 Bacteria 1505459
234 Ga0209455_1023729 3300025272 Bacteria 1144
235 Ga0209455_1034626 3300025272 Bacteria 820
236 Ga0209673_1001949 3300025273 Bacteria 16202
237 Ga0209673_1004026 3300025273 Bacteria 8138
238 Ga0209676_1022547 3300025292 Bacteria 2083
239 Ga0209025_1001074 3300025294 Bacteria 39612
240 Ga0209564_1021504 3300025295 Bacteria 2316
241 Ga0209564_1023543 3300025295 Bacteria 2135
242 Ga0209758_1000002 3300025297 Bacteria 1400310
243 Ga0209758_1000007 3300025297 Bacteria 1270410
244 Ga0209758_1027966 3300025297 Bacteria 2398
245 Ga0209758_1084314 3300025297 Bacteria 950
246 Ga0209050_1000001 3300025298 Bacteria 3563507
247 Ga0209050_1000167 3300025298 Bacteria 151608
248 Ga0209050_1029676 3300025298 Bacteria 1743
249 Ga0209050_1037810 3300025298 Bacteria 1386
250 Ga0209050_1042212 3300025298 Bacteria 1247
251 Ga0209256_1000008 3300025299 Bacteria 975723
252 Ga0207426_1006222 3300025302 Bacteria 5240
253 Ga0209051_1001979 3300025303 Bacteria 15745
254 Ga0209051_1113062 3300025303 Bacteria 704
255 Ga0209257_1000028 3300025304 Bacteria 699493
256 Ga0209257_1001046 3300025304 Bacteria 36813
257 Ga0209257_1001287 3300025304 Bacteria 30619
258 Ga0209257_1015643 3300025304 Bacteria 3139
259 Ga0209257_1016575 3300025304 Bacteria 2970
260 Ga0207697_10136829 3300025315 Bacteria 1061
261 Ga0207656_10008030 3300025321 Bacteria 3871
262 Ga0207656_10601818 3300025321 Bacteria 561
263 Ga0207688_10136265 3300025901 Bacteria 1442
264 Ga0207647_10055777 3300025904 Bacteria 2427
265 Ga0207647_10123253 3300025904 Bacteria 1527
266 Ga0207705_10000103 3300025909 Bacteria 97511
267 Ga0207705_10067968 3300025909 Bacteria 2579
268 Ga0207654_10001185 3300025911 Bacteria 13982
269 Ga0207654_10013856 3300025911 Bacteria 4154
270 Ga0207707_10034425 3300025912 Bacteria 4432
271 Ga0207695_10043729 3300025913 Bacteria 4772
272 Ga0207695_10161149 3300025913 Bacteria 2175
273 Ga0207695_10269465 3300025913 Bacteria 1598
274 Ga0207671_10007591 3300025914 Bacteria 9385
275 Ga0207671_10016916 3300025914 Bacteria 5645
276 Ga0207671_10033676 3300025914 Bacteria 3810
277 Ga0207660_10007445 3300025917 Bacteria 7086
278 Ga0207657_10000124 3300025919 Bacteria 77147
279 Ga0207657_10012973 3300025919 Bacteria 8192
280 Ga0207649_10000275 3300025920 Bacteria 40550
281 Ga0207649_10070347 3300025920 Bacteria 2231
282 Ga0207649_10235247 3300025920 Bacteria 1312
283 Ga0207649_10264084 3300025920 Bacteria 1245
284 Ga0207652_10003184 3300025921 Bacteria 13638
285 Ga0207652_10098616 3300025921 Bacteria 2577
286 Ga0207652_10167092 3300025921 Bacteria 1973
287 Ga0207681_10113922 3300025923 Bacteria 1972
288 Ga0207681_10583298 3300025923 Bacteria 922
289 Ga0207681_10948530 3300025923 Bacteria 721
290 Ga0207694_10005081 3300025924 Bacteria 10170
291 Ga0207694_10022285 3300025924 Bacteria 4804
292 Ga0207694_10687137 3300025924 Bacteria 863
293 Ga0207694_11761039 3300025924 Bacteria 521
294 Ga0207650_10098672 3300025925 Bacteria 2245
295 Ga0207687_10002166 3300025927 Bacteria 13400
296 Ga0207644_10083838 3300025931 Bacteria 2362
297 Ga0207644_10246416 3300025931 Bacteria 1424
298 Ga0207690_10000198 3300025932 Bacteria 47046
299 Ga0207690_10005531 3300025932 Bacteria 7457
300 Ga0207690_10182189 3300025932 Bacteria 1582
301 Ga0207690_10224728 3300025932 Bacteria 1438
302 Ga0207690_10652304 3300025932 Bacteria 862
303 Ga0207706_10000160 3300025933 Bacteria 75222
304 Ga0207706_10008512 3300025933 Bacteria 9461
305 Ga0207706_10073923 3300025933 Bacteria 2997
306 Ga0207706_10114055 3300025933 Bacteria 2377
307 Ga0207686_10520205 3300025934 Bacteria 926
308 Ga0207709_10000005 3300025935 Bacteria 806813
309 Ga0207709_10087839 3300025935 Bacteria 2022
310 Ga0207709_10904608 3300025935 Bacteria 717
311 Ga0207709_10982282 3300025935 Bacteria 689
312 Ga0207669_10000703 3300025937 Bacteria 14419
313 Ga0207669_10028866 3300025937 Bacteria 3058
314 Ga0207704_10595593 3300025938 Bacteria 904
315 Ga0207704_10751682 3300025938 Bacteria 811
316 Ga0207691_10044887 3300025940 Bacteria 4066
317 Ga0207691_10896640 3300025940 Bacteria 742
318 Ga0207711_10006981 3300025941 Bacteria 9475
319 Ga0207711_10084541 3300025941 Bacteria 2778
320 Ga0207679_10180442 3300025945 Bacteria 1746
321 Ga0207679_10933671 3300025945 Bacteria 794
322 Ga0207667_10000001 3300025949 Bacteria 1178522
323 Ga0207667_10007047 3300025949 Bacteria 13582
324 Ga0207667_10012946 3300025949 Bacteria 9578
325 Ga0207667_10024369 3300025949 Bacteria 6643
326 Ga0207667_10143812 3300025949 Bacteria 2455
327 Ga0207667_10381123 3300025949 Bacteria 1437
328 Ga0207667_10485181 3300025949 Bacteria 1254
329 Ga0207712_10029353 3300025961 Bacteria 3688
330 Ga0207640_10007222 3300025981 Bacteria 6126
331 Ga0207640_10012181 3300025981 Bacteria 4892
332 Ga0207640_10015840 3300025981 Bacteria 4374
333 Ga0207640_10197932 3300025981 Bacteria 1520
334 Ga0207640_10306150 3300025981 Bacteria 1259
335 Ga0207640_10488438 3300025981 Bacteria 1023
336 Ga0207677_10671588 3300026023 Bacteria 916
337 Ga0207703_10000108 3300026035 Bacteria 97908
338 Ga0207703_10000334 3300026035 Bacteria 51370
339 Ga0207703_10023807 3300026035 Bacteria 4817
340 Ga0207639_10005941 3300026041 Bacteria 8279
341 Ga0207639_10012041 3300026041 Bacteria 6017
342 Ga0207639_10044914 3300026041 Bacteria 3325
343 Ga0207639_10102465 3300026041 Bacteria 2317
344 Ga0207678_10000159 3300026067 Bacteria 56028
345 Ga0207678_10265907 3300026067 Bacteria 1470
346 Ga0207702_10009492 3300026078 Bacteria 8174
347 Ga0207702_10176599 3300026078 Bacteria 1963
348 Ga0207702_10672387 3300026078 Bacteria 1019
349 Ga0207702_10996262 3300026078 Bacteria 831
350 Ga0207648_10500540 3300026089 Bacteria 1112
351 Ga0207676_12498365 3300026095 Bacteria 513
352 Ga0207674_10060921 3300026116 Bacteria 3815
353 Ga0207674_10064519 3300026116 Bacteria 3694
354 Ga0207674_10392676 3300026116 Bacteria 1341
355 Ga0207674_10402833 3300026116 Bacteria 1322
356 Ga0207674_10767683 3300026116 Bacteria 930
357 Ga0207674_11164554 3300026116 Bacteria 740
358 Ga0207675_100000152 3300026118 Bacteria 60845
359 Ga0207675_100993221 3300026118 Bacteria 857
360 Ga0207683_10043341 3300026121 Bacteria 3932
361 Ga0207683_10154829 3300026121 Bacteria 2070
362 Ga0207698_10000990 3300026142 Bacteria 16461
363 Ga0209998_10091539 3300027717 Bacteria 746
364 Ga0209813_10000080 3300027866 Bacteria 35297
365 Ga0207428_11002398 3300027907 Bacteria 587
366 Ga0268266_10000074 3300028379 Bacteria 230993
367 Ga0268266_10262328 3300028379 Bacteria 1601
368 Ga0268266_10429390 3300028379 Bacteria 1253
369 Ga0268266_10464893 3300028379 Bacteria 1204
370 Ga0268266_11223781 3300028379 Bacteria 726
371 Ga0307517_10020735 3300028786 Bacteria 8352
372 Ga0307517_10107765 3300028786 Bacteria 2144
373 Ga0314311_1049764 3300030733 Bacteria 1099
374 Ga0307513_10059023 3300031456 Bacteria 4074
375 Ga0307513_10120327 3300031456 Bacteria 2595
376 Ga0307513_10310045 3300031456 Bacteria 1341
377 Ga0307508_10001895 3300031616 Bacteria 22964
378 Ga0307508_10019452 3300031616 Bacteria 6173
379 Ga0307516_10522378 3300031730 Bacteria 841
380 Ga0307405_10205198 3300031731 Bacteria 1434
381 Ga0307405_10649167 3300031731 Bacteria 867
382 Ga0307405_11008801 3300031731 Bacteria 710
383 Ga0307413_10006253 3300031824 Bacteria 5409
384 Ga0307413_10019133 3300031824 Bacteria 3610
385 Ga0307410_10226351 3300031852 Bacteria 1441
386 Ga0307406_10583191 3300031901 Bacteria 919
387 Ga0307406_10772419 3300031901 Bacteria 808
388 Ga0307412_10006013 3300031911 Bacteria 6836
389 Ga0307412_10007277 3300031911 Bacteria 6276
390 Ga0307412_10227286 3300031911 Bacteria 1434
391 Ga0307412_11226633 3300031911 Bacteria 672
392 Ga0307412_11517805 3300031911 Bacteria 609
393 Ga0307409_100213474 3300031995 Bacteria 1736
394 Ga0307409_100644664 3300031995 Bacteria 1052
395 Ga0307416_100292906 3300032002 Bacteria 1612
396 Ga0307416_100313059 3300032002 Bacteria 1567
397 Ga0307414_10109033 3300032004 Bacteria 2102
398 Ga0307414_10181505 3300032004 Bacteria 1693
399 Ga0307411_10486829 3300032005 Bacteria 1040
400 Ga0307510_10001183 3300033180 Bacteria 28156
401 Ga0307510_10261001 3300033180 Bacteria 1214
402 Ga0373962_0052943 3300035242 Bacteria 1174
403 Ga0373935_0458180 3300035692 Bacteria 922
404 Ga0395899_0001588 3300037312 Bacteria 19105
405 Ga0395899_0108791 3300037312 Bacteria 1995
406 Ga0395905_0105936 3300037471 Bacteria 2640
407 Ga0395905_0788636 3300037471 Bacteria 853
408 Ga0395901_0170764 3300038443 Bacteria 2282
409 Ga0237819_01081 3300038705 Bacteria 8047
410 Ga0237816_03431 3300039145 Bacteria 1161
411 Ga0436363_0767477 3300039450 Bacteria 1062
412 Ga0436363_1436052 3300039450 Bacteria 3378
413 Ga0439439_0173177 3300041406 Bacteria 619
414 Ga0439461_0006293 3300041410 Bacteria 2062
415 Ga0439466_0040641 3300041411 Bacteria 1555
416 Ga0439466_0081626 3300041411 Bacteria 1019
417 Ga0439465_0001715 3300041413 Bacteria 7157
418 Ga0439465_0097356 3300041413 Bacteria 1012
419 Ga0451791_1619187 3300041451 Bacteria 692
420 Ga0451793_0812204 3300041452 Bacteria 567
421 Ga0451795_0649393 3300041456 Bacteria 846
422 Ga0451806_362630 3300041462 Bacteria 565
423 Ga0439431_0000273 3300041997 Bacteria 10607
424 Ga0439431_0005938 3300041997 Bacteria 2694
425 Ga0439442_008278 3300042002 Bacteria 2099
426 Ga0439445_0003617 3300042004 Bacteria 3467
427 Ga0439448_0044535 3300042005 Bacteria 1443
428 Ga0439432_000602 3300042006 Bacteria 13546
429 Ga0439432_010456 3300042006 Bacteria 3211
430 Ga0439452_019566 3300042010 Bacteria 1788
431 Ga0439452_034958 3300042010 Bacteria 1211
432 Ga0439457_184949 3300042014 Bacteria 509
433 Ga0439462_0010698 3300042015 Bacteria 2327
434 Ga0450912_001233 3300042116 Bacteria 1515
435 Ga0450898_047909 3300042134 Bacteria 821
436 Ga0439446_0017794 3300042156 Bacteria 1987
437 Ga0439446_0093073 3300042156 Bacteria 945
438 Ga0439434_0001243 3300042435 Bacteria 7326
439 Ga0439434_0007070 3300042435 Bacteria 3280
440 Ga0451577_0673083 3300042876 Bacteria 938
441 Ga0466961_0547444 3300044693 Bacteria 697
442 Ga0466963_0256355 3300044694 Bacteria 1228
443 Ga0453684_0567135 3300044712 Bacteria 1248
444 Ga0466971_0048636 3300044719 Bacteria 1907
445 Ga0466967_1206154 3300045976 Bacteria 754
446 Ga0495629_0620640 3300046459 Bacteria 722
447 Ga0495638_0000732 3300046460 Bacteria 35317
448 Ga0495638_0185589 3300046460 Bacteria 1183
449 Ga0495653_0502299 3300046463 Bacteria 756
450 Ga0495650_0000196 3300046471 Bacteria 131306
451 Ga0495650_0025448 3300046471 Bacteria 2774
452 Ga0495584_0152256 3300046491 Bacteria 1175
453 Ga0495585_0001312 3300046492 Bacteria 19806
454 Ga0495585_0042674 3300046492 Bacteria 2539
455 Ga0495585_0059598 3300046492 Bacteria 2103
456 Ga0495585_0138433 3300046492 Bacteria 1276
457 Ga0495596_0035016 3300046500 Bacteria 1992
458 Ga0495607_0415768 3300046501 Bacteria 609
459 Ga0495583_0000122 3300046506 Bacteria 132255
460 Ga0495583_0033001 3300046506 Bacteria 2493
461 Ga0495583_0041362 3300046506 Bacteria 2159
462 Ga0495583_0042880 3300046506 Bacteria 2110
463 Ga0495583_0058831 3300046506 Bacteria 1724
464 Ga0495583_0140962 3300046506 Bacteria 1003
465 Ga0495606_0001040 3300046507 Bacteria 40138
466 Ga0495606_0127749 3300046507 Bacteria 1514
467 Ga0495606_0167192 3300046507 Bacteria 1279
468 Ga0495610_0155863 3300046512 Bacteria 970
469 Ga0495616_0000014 3300046513 Bacteria 191010
470 Ga0495616_0220080 3300046513 Bacteria 827
471 Ga0495631_0044637 3300046518 Bacteria 1952
472 Ga0495631_0109912 3300046518 Bacteria 1185
473 Ga0495631_0166285 3300046518 Bacteria 946
474 Ga0495632_0000023 3300046519 Bacteria 180933
475 Ga0495637_0058299 3300046520 Bacteria 1592
476 Ga0495643_0009740 3300046522 Bacteria 5943
477 Ga0495643_0024451 3300046522 Bacteria 3426
478 Ga0495643_0059613 3300046522 Bacteria 2028
479 Ga0495643_0077047 3300046522 Bacteria 1743
480 Ga0495648_0000387 3300046524 Bacteria 48332
481 Ga0495648_0285912 3300046524 Bacteria 779
482 Ga0495663_0000019 3300046525 Bacteria 129361
483 Ga0495663_0002458 3300046525 Bacteria 5571
484 Ga0495642_0004460 3300046528 Bacteria 5432
485 Ga0495642_0209885 3300046528 Bacteria 849
486 Ga0495652_0148941 3300046529 Bacteria 1831
487 Ga0495654_0090582 3300046530 Bacteria 1420
488 Ga0495587_0068991 3300046536 Bacteria 2059
489 Ga0495597_0171973 3300046542 Bacteria 879
490 Ga0495622_0019053 3300046557 Bacteria 3197
491 Ga0495633_0000054 3300046558 Bacteria 151646
492 Ga0495633_0000855 3300046558 Bacteria 26647
493 Ga0495633_0009384 3300046558 Bacteria 5408
494 Ga0495633_0031325 3300046558 Bacteria 2579
495 Ga0495668_0000022 3300046616 Bacteria 363999
496 Ga0495668_0014880 3300046616 Bacteria 4553
497 Ga0495668_0035790 3300046616 Bacteria 2782
498 Ga0495668_0128035 3300046616 Bacteria 1390
499 Ga0495625_0000031 3300046660 Bacteria 238193
500 Ga0495625_0002639 3300046660 Bacteria 19152
501 Ga0495625_0005816 3300046660 Bacteria 11127
502 Ga0495625_0040267 3300046660 Bacteria 3409
503 Ga0495625_0041777 3300046660 Bacteria 3336
504 Ga0495625_0153293 3300046660 Bacteria 1548
505 Ga0495625_0184678 3300046660 Bacteria 1384
506 Ga0495625_0228289 3300046660 Bacteria 1217
507 Ga0495661_0061552 3300046665 Bacteria 2228
508 Ga0495623_0222065 3300046679 Bacteria 1076
509 Ga0495669_0000150 3300046684 Bacteria 44519
510 Ga0495670_0000016 3300046691 Bacteria 128045
511 Ga0495670_0128453 3300046691 Bacteria 1320
512 Ga0495670_0169227 3300046691 Bacteria 1150
513 Ga0495649_0065764 3300046694 Bacteria 1946
514 Ga0495649_0104448 3300046694 Bacteria 1504
515 Ga0495649_0211668 3300046694 Bacteria 1004
516 Ga0495649_0572197 3300046694 Bacteria 558
517 Ga0495660_0118968 3300046810 Bacteria 1339
518 Ga0495636_0471082 3300047318 Bacteria 605
519 Ga0495672_0315479 3300047320 Bacteria 736
520 Ga0495687_003221 3300047443 Bacteria 12077
521 Ga0495687_003498 3300047443 Bacteria 11334
522 Ga0495677_0000624 3300047445 Bacteria 14278
523 Ga0495677_0013565 3300047445 Bacteria 2966
524 Ga0495677_0355977 3300047445 Bacteria 578
525 Ga0495681_0009672 3300047470 Bacteria 5913
526 Ga0495681_0037527 3300047470 Bacteria 2385
527 Ga0495681_0258582 3300047470 Bacteria 685
528 Ga0495686_0031275 3300047472 Bacteria 3453
529 Ga0495686_0048867 3300047472 Bacteria 2665
530 Ga0495686_0084580 3300047472 Bacteria 1933
531 Ga0496101_0547716 3300048904 Bacteria 915
532 Ga0496102_0000022 3300048905 Bacteria 246314
533 Ga0496102_0023768 3300048905 Bacteria 5446
534 Ga0496103_0000075 3300048906 Bacteria 114569
535 Ga0496103_0161159 3300048906 Bacteria 1439
536 Ga0496103_0294326 3300048906 Bacteria 1044
537 Ga0496104_0152127 3300048907 Bacteria 2220
538 Ga0496105_0000560 3300048908 Bacteria 24564
539 Ga0496107_0043777 3300048910 Bacteria 3217
540 Ga0496108_0003451 3300048911 Bacteria 12680
541 Ga0496108_0036644 3300048911 Bacteria 4082
542 Ga0496109_0064817 3300048912 Bacteria 3344
543 Ga0496109_1458732 3300048912 Bacteria 619
544 Ga0496110_0026786 3300048913 Bacteria 4937
545 Ga0496110_0046556 3300048913 Bacteria 3795
546 Ga0496110_0175070 3300048913 Bacteria 1947
547 Ga0496111_0005794 3300048914 Bacteria 7968
548 Ga0496111_0132493 3300048914 Bacteria 1845
549 Ga0496112_0118065 3300048915 Bacteria 2623
550 Ga0496112_0918236 3300048915 Bacteria 797
551 Ga0496113_0022268 3300048916 Bacteria 4480
552 Ga0496114_0002996 3300048917 Bacteria 12950
553 Ga0496115_0000029 3300048918 Bacteria 141359
554 Ga0496115_0000304 3300048918 Bacteria 41844
555 Ga0496116_0001492 3300048919 Bacteria 26054
556 Ga0496116_0022564 3300048919 Bacteria 4714
557 Ga0496116_0084609 3300048919 Bacteria 1953
558 Ga0496117_0000439 3300048920 Bacteria 69213
559 Ga0496117_0061017 3300048920 Bacteria 2594
560 Ga0496118_0000039 3300048921 Bacteria 305458
561 Ga0496118_0031550 3300048921 Bacteria 4389
562 Ga0496118_0445344 3300048921 Bacteria 659
563 Ga0496119_0012306 3300048922 Bacteria 6966
564 Ga0496120_0010920 3300048923 Bacteria 6283
565 Ga0496120_0048868 3300048923 Bacteria 2432
566 Ga0496121_0000269 3300048924 Bacteria 108869
567 Ga0496121_0001561 3300048924 Bacteria 38247
568 Ga0496121_0085910 3300048924 Bacteria 2474
569 Ga0496121_0464062 3300048924 Bacteria 813
570 Ga0496122_0003788 3300048925 Bacteria 19492
571 Ga0496122_0009783 3300048925 Bacteria 10013
572 Ga0496122_0106266 3300048925 Bacteria 1858
573 Ga0496122_0184855 3300048925 Bacteria 1238
574 Ga0496122_0212331 3300048925 Bacteria 1119
575 Ga0496122_0288143 3300048925 Bacteria 893
576 Ga0496122_0316531 3300048925 Bacteria 832
577 Ga0496123_0010349 3300048926 Bacteria 8259
578 Ga0496123_0038434 3300048926 Bacteria 3364
579 Ga0496123_0039137 3300048926 Bacteria 3320
580 Ga0496123_0069837 3300048926 Bacteria 2203
581 Ga0496124_0000076 3300048927 Bacteria 215767
582 Ga0496124_0000354 3300048927 Bacteria 83817
583 Ga0496124_0007794 3300048927 Bacteria 11310
584 Ga0496124_0008572 3300048927 Bacteria 10668
585 Ga0496124_0109927 3300048927 Bacteria 2220
586 Ga0496124_0135047 3300048927 Bacteria 1954
587 Ga0496124_0292780 3300048927 Bacteria 1180
588 Ga0496124_0365420 3300048927 Bacteria 1015
589 Ga0496125_0010283 3300048928 Bacteria 9474
590 Ga0496125_0010592 3300048928 Bacteria 9316
591 Ga0496125_0013726 3300048928 Bacteria 7945
592 Ga0496125_0232964 3300048928 Bacteria 1176
593 Ga0496125_0364332 3300048928 Bacteria 858
594 Ga0496126_0001441 3300048929 Bacteria 37293
595 Ga0496126_0024310 3300048929 Bacteria 5851
596 Ga0496126_0082405 3300048929 Bacteria 2842
597 Ga0496126_0250147 3300048929 Bacteria 1477
598 Ga0496126_0483254 3300048929 Bacteria 992
599 Ga0501290_002748 3300049513 Bacteria 2255
600 Ga0501033_0823168 3300049570 Bacteria 627
601 Ga0501034_0590067 3300049571 Bacteria 1017
602 Ga0501036_0146186 3300049572 Bacteria 1994
603 Ga0501037_0742146 3300049573 Bacteria 651
604 Ga0501037_0846017 3300049573 Bacteria 602
605 Ga0501042_0798182 3300049578 Bacteria 687
606 Ga0501043_0869388 3300049579 Bacteria 648
607 Ga0501047_0300506 3300049581 Bacteria 1448
608 Ga0501047_0648338 3300049581 Bacteria 875
609 Ga0501070_1132338 3300049586 Bacteria 603
610 Ga0501073_0462474 3300049589 Bacteria 877
611 Ga0501211_000334 3300049658 Bacteria 4348
612 Ga0501223_000009 3300049663 Bacteria 109998
613 Ga0501235_002808 3300049669 Bacteria 3748
614 Ga0501235_210869 3300049669 Bacteria 529
615 Ga0501225_0000005 3300049705 Bacteria 133194
616 Ga0501225_0017787 3300049705 Bacteria 1972
617 Ga0501225_0019384 3300049705 Bacteria 1883
618 Ga0501080_0696715 3300049742 Bacteria 896
619 Ga0501241_028309 3300049758 Bacteria 1051
620 Ga0501241_036069 3300049758 Bacteria 947
621 Ga0501035_0711891 3300049822 Bacteria 809
622 Ga0501044_0170642 3300049823 Bacteria 2147
623 Ga0501044_0434593 3300049823 Bacteria 1221
624 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
625 nmdc:mga03683_63365_c1 3300050489 Bacteria 1567
626 nmdc:mga03n38_17847_c1 3300050490 Bacteria 2787
627 nmdc:mga03n38_28520_c1 3300050490 Bacteria 2328
628 nmdc:mga00v17_260461_c1 3300050491 Bacteria 1125
629 nmdc:mga0k408_106225_c1 3300050493 Bacteria 1658
630 nmdc:mga0k408_192045_c1 3300050493 Bacteria 1218
631 nmdc:mga0k408_391877_c1 3300050493 Bacteria 827
632 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
633 nmdc:mga0k408_930120_c1 3300050493 Bacteria 504
634 nmdc:mga06z11_110828_c1 3300050494 Bacteria 1519
635 nmdc:mga06z11_40_c1 3300050494 Bacteria 53122
636 nmdc:mga04h51_98_c1 3300050495 Bacteria 26290
637 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
638 nmdc:mga07m45_565866_c1 3300050496 Bacteria 657
639 nmdc:mga07m45_78712_c1 3300050496 Bacteria 1881
640 nmdc:mga0rr50_287476_c1 3300050513 Bacteria 1373
641 nmdc:mga08x19_407838_c1 3300050514 Bacteria 954
642 nmdc:mga0sz30_111_c1 3300050516 Bacteria 15885
643 Ga0495601_0446043 3300053077 Bacteria 837
644 Ga0500610_0002060 3300053079 Bacteria 7224
645 Ga0500643_000835 3300053087 Bacteria 19769
646 Ga0500643_002392 3300053087 Bacteria 9755
647 Ga0500643_007692 3300053087 Bacteria 4313
648 Ga0500643_042803 3300053087 Bacteria 1323
649 Ga0500566_0390665 3300053094 Bacteria 626
650 Ga0500641_0008336 3300053096 Bacteria 3695
651 Ga0500641_0190503 3300053096 Bacteria 878
652 Ga0500556_0030343 3300053104 Bacteria 1831
653 Ga0500562_017035 3300053108 Bacteria 1871
654 Ga0500562_036962 3300053108 Bacteria 1296
655 Ga0500595_001009 3300053119 Bacteria 15783
656 Ga0500595_005769 3300053119 Bacteria 5352
657 Ga0500642_0021239 3300053130 Bacteria 2567
658 Ga0500655_044261 3300053133 Bacteria 877
659 Ga0500658_0000579 3300053134 Bacteria 15417
660 Ga0500658_0007859 3300053134 Bacteria 3941
661 Ga0500559_0011280 3300053136 Bacteria 3819
662 Ga0500559_0067868 3300053136 Bacteria 1601
663 Ga0500559_0101948 3300053136 Bacteria 1323
664 Ga0500568_0129596 3300053139 Bacteria 938
665 Ga0500573_0000041 3300053140 Bacteria 103805
666 Ga0500573_0048640 3300053140 Bacteria 2441
667 Ga0500585_083992 3300053144 Bacteria 1151
668 Ga0500588_0007419 3300053146 Bacteria 2529
669 Ga0500604_0063665 3300053151 Bacteria 1163
670 Ga0500604_0306075 3300053151 Bacteria 551
671 Ga0500619_003433 3300053154 Bacteria 3245
672 Ga0500627_0000721 3300053158 Bacteria 8770
673 Ga0500636_0073030 3300053177 Bacteria 1987
674 Ga0500645_000231 3300053730 Bacteria 42528
675 Ga0500596_003767 3300053735 Bacteria 2846
676 2512643996 2512564014 Bacteria 4639632
677 2600201935 2599185354 Bacteria 4398675
678 2600227000 2599185359 Bacteria 4772316
679 2643948760 2643221588 Bacteria 3692460
680 2644127375 2643221622 Bacteria 4212502
681 2778126651 2775507255 Bacteria 3945731
682 2819715548 2818991466 Bacteria 4748179
683 2830076300 2830075706 Bacteria 3855215
684 2885432520 2885429604 Bacteria 3642894
685 2928029803 2928027323 Bacteria 4382488
686 2928529567 2928526807 Bacteria 4760224
687 2928970945 2928968154 Bacteria 4633371
688 2946790830 2946787523 Bacteria 4366789
689 2984556638 2984555340 Bacteria 4247089
690 2984565189 2984564862 Bacteria 4339992
691 2990265997 2990265787 Bacteria 3943888
692 2993356265 2993356040 Bacteria 4247105
693 2993696211 2993693658 Bacteria 4040749
694 8057105513 8057101203 Bacteria 5034064
695 Ga0500566_0061790
696 SwRhRL2b_contig_1622313
697 JGI24736J21556_1003820
698 JGI24741J21665_1000040
699 JGI24741J21665_1001934
700 JGI24741J21665_1003189
701 JGI24747J21853_1028669
702 JGI24740J21852_10000683
703 JGI24740J21852_10005582
704 JGI24739J22299_10017450
705 JGI24739J22299_10127675
706 JGI24737J22298_10001811
707 JGI24737J22298_10004112
708 JGI24735J21928_10015828
709 JGI24735J21928_10030560
710 JGI24738J21930_10012519
711 JGI24738J21930_10028041
712 JGI24738J21930_10065350
713 JGI25150J39212_1000336
714 JGI25151J46595_10009573
715 JGI25165J46597_1000010
716 JGI25153J46596_10000045
717 JGI25153J46596_10000055
718 rootL2_10087041
719 Ga0055525_1000139
720 Ga0055542_1000012
721 Ga0055529_1000002
722 Ga0055529_1000004
723 Ga0055526_1003322
724 Ga0055537_1003069
725 Ga0055524_1000405
726 Ga0055530_10000429
727 Ga0055530_10011966
728 Ga0055530_10019378
729 Ga0055540_1003589
730 Ga0055540_1008407
731 Ga0055531_10000472
732 Ga0055531_10062885
733 Ga0065165_1005026
734 Ga0065165_1005638
735 Ga0065165_1028550
736 Ga0065165_1028877
737 Ga0065165_1061201
738 Ga0065704_10006330
739 Ga0065704_10023989
740 Ga0065707_10031451
741 Ga0070658_10013837
742 Ga0070658_10035931
743 Ga0070658_10290327
744 Ga0070683_100047555
745 Ga0070690_101619715
746 Ga0070670_101293105
747 Ga0070680_100004141
748 Ga0070680_100225412
749 Ga0068868_100185283
750 Ga0070660_100001140
751 Ga0070660_100032203
752 Ga0070660_100741612
753 Ga0070660_100772007
754 Ga0070661_100002597
755 Ga0070661_100004660
756 Ga0070661_100230706
757 Ga0070661_100238001
758 Ga0070668_100038482
759 Ga0070668_100155968
760 Ga0070669_100143950
761 Ga0070669_100325011
762 Ga0070669_100805310
763 Ga0070675_100287378
764 Ga0070671_100024178
765 Ga0070674_100003448
766 Ga0070674_100044285
767 Ga0070659_100013536
768 Ga0070659_100059768
769 Ga0070659_100751692
770 Ga0070659_101590225
771 Ga0070659_101998896
772 Ga0070663_100003780
773 Ga0070678_100000716
774 Ga0070678_100106440
775 Ga0070662_100003088
776 Ga0070662_100052119
777 Ga0070662_100187498
778 Ga0070662_100289142
779 Ga0070681_10030642
780 Ga0070679_100016361
781 Ga0070679_100055674
782 Ga0070679_100481548
783 Ga0070679_101008469
784 Ga0068853_100000508
785 Ga0068853_100125567
786 Ga0068853_100157191
787 Ga0068853_100256685
788 Ga0068853_100324206
789 Ga0070672_100021173
790 Ga0070665_100000088
791 Ga0070665_100007364
792 Ga0070665_100495857
793 Ga0070665_100618934
794 Ga0068855_100002675
795 Ga0068855_100010367
796 Ga0068855_100165371
797 Ga0068855_100403104
798 Ga0070664_100023720
799 Ga0070664_100042413
800 Ga0068857_100025986
801 Ga0068857_100029633
802 Ga0068857_100111621
803 Ga0068857_100852251
804 Ga0068854_100040676
805 Ga0068854_100163947
806 Ga0068854_100292280
807 Ga0068854_101466641
808 Ga0068856_100009552
809 Ga0068856_100036170
810 Ga0068859_100000448
811 Ga0068864_100440207
812 Ga0068861_100000037
813 Ga0068861_100496738
814 Ga0068851_10021057
815 Ga0068858_100000275
816 Ga0068858_100000487
817 Ga0068858_100033032
818 Ga0081539_10033187
819 Ga0075368_10002233
820 Ga0075363_100019579
821 Ga0075363_100049797
822 Ga0075364_10091081
823 Ga0075362_10000119
824 Ga0075367_10050353
825 Ga0075369_10000252
826 Ga0075366_10000014
827 Ga0075366_10326751
828 Ga0097621_100015978
829 Ga0075370_10000141
830 Ga0075370_10286313
831 Ga0068871_101326830
832 Ga0068865_100293249
833 Ga0097620_100000448
834 Ga0079104_1019865
835 Ga0105251_10001301
836 Ga0105240_10066571
837 Ga0105240_10256228
838 Ga0105240_11510703
839 Ga0105245_10002918
840 Ga0114129_11141922
841 Ga0105243_10000208
842 Ga0105243_10042992
843 Ga0105243_10224350
844 Ga0105241_10000685
845 Ga0105241_10072048
846 Ga0105241_11269037
847 Ga0105242_10438261
848 Ga0105248_10012274
849 Ga0105248_10014451
850 Ga0105237_10019381
851 Ga0105237_10021147
852 Ga0105237_10171738
853 Ga0105238_10034028
854 Ga0105238_10301392
855 Ga0105238_11244916
856 Ga0105238_12137252
857 Ga0105249_10031157
858 Ga0105148_100193
859 Ga0105239_11268213
860 Ga0105239_12212531
861 Ga0105246_10000589
862 Ga0105246_10021501
863 Ga0157317_1001966
864 Ga0157324_1018166
865 Ga0157326_1001890
866 Ga0157373_10017159
867 Ga0157373_10023178
868 Ga0157373_10149039
869 Ga0157373_10450964
870 Ga0157373_10554512
871 Ga0157373_10810250
872 Ga0157371_10000290
873 Ga0157371_10017135
874 Ga0157371_10138650
875 Ga0157371_11210662
876 Ga0157370_10003089
877 Ga0157370_10056667
878 Ga0157370_10069774
879 Ga0157370_10234101
880 Ga0157370_11409469
881 Ga0157369_10003745
882 Ga0157369_10081911
883 Ga0157369_10415836
884 Ga0157369_10939503
885 Ga0157369_11389098
886 Ga0157374_10269663
887 Ga0163162_10271955
888 Ga0163162_10978415
889 Ga0163162_11715278
890 Ga0157372_10001844
891 Ga0157372_10031040
892 Ga0157372_10259456
893 Ga0157372_10350919
894 Ga0157372_10929787
895 Ga0157375_10048508
896 Ga0157375_10723756
897 Ga0157375_12603108
898 Ga0157380_10029053
899 Ga0157380_10052396
900 Ga0157380_13421021
901 Ga0157379_10112046
902 Ga0157379_12000994
903 Ga0157376_11617030
904 Ga0183363_1003
905 Ga0163161_10273004
906 Ga0163161_11337015
907 Ga0206354_10419039
908 Ga0206353_11171589
909 Ga0213874_10020655
910 Ga0209674_111773
911 Ga0209147_100963
912 Ga0209563_100070
913 Ga0209563_126701
914 Ga0209437_117894
915 Ga0209437_121717
916 Ga0207425_1000005
917 Ga0207425_1022674
918 Ga0209646_1022189
919 Ga0209677_108591
920 Ga0209148_1000008
921 Ga0209148_1042294
922 Ga0209129_1001045
923 Ga0209233_1000044
924 Ga0209233_1032953
925 Ga0209565_1000029
926 Ga0209565_1000272
927 Ga0209455_1000002
928 Ga0209455_1023729
929 Ga0209455_1034626
930 Ga0209673_1001949
931 Ga0209673_1004026
932 Ga0209676_1022547
933 Ga0209025_1001074
934 Ga0209564_1021504
935 Ga0209564_1023543
936 Ga0209758_1000002
937 Ga0209758_1000007
938 Ga0209758_1027966
939 Ga0209758_1084314
940 Ga0209050_1000001
941 Ga0209050_1000167
942 Ga0209050_1029676
943 Ga0209050_1037810
944 Ga0209050_1042212
945 Ga0209256_1000008
946 Ga0207426_1006222
947 Ga0209051_1001979
948 Ga0209051_1113062
949 Ga0209257_1000028
950 Ga0209257_1001046
951 Ga0209257_1001287
952 Ga0209257_1015643
953 Ga0209257_1016575
954 Ga0207697_10136829
955 Ga0207656_10008030
956 Ga0207656_10601818
957 Ga0207688_10136265
958 Ga0207647_10055777
959 Ga0207647_10123253
960 Ga0207705_10000103
961 Ga0207705_10067968
962 Ga0207654_10001185
963 Ga0207654_10013856
964 Ga0207707_10034425
965 Ga0207695_10043729
966 Ga0207695_10161149
967 Ga0207695_10269465
968 Ga0207671_10007591
969 Ga0207671_10016916
970 Ga0207671_10033676
971 Ga0207660_10007445
972 Ga0207657_10000124
973 Ga0207657_10012973
974 Ga0207649_10000275
975 Ga0207649_10070347
976 Ga0207649_10235247
977 Ga0207649_10264084
978 Ga0207652_10003184
979 Ga0207652_10098616
980 Ga0207652_10167092
981 Ga0207681_10113922
982 Ga0207681_10583298
983 Ga0207681_10948530
984 Ga0207694_10005081
985 Ga0207694_10022285
986 Ga0207694_10687137
987 Ga0207694_11761039
988 Ga0207650_10098672
989 Ga0207687_10002166
990 Ga0207644_10083838
991 Ga0207644_10246416
992 Ga0207690_10000198
993 Ga0207690_10005531
994 Ga0207690_10182189
995 Ga0207690_10224728
996 Ga0207690_10652304
997 Ga0207706_10000160
998 Ga0207706_10008512
999 Ga0207706_10073923
1000 Ga0207706_10114055
1001 Ga0207686_10520205
1002 Ga0207709_10000005
1003 Ga0207709_10087839
1004 Ga0207709_10904608
1005 Ga0207709_10982282
1006 Ga0207669_10000703
1007 Ga0207669_10028866
1008 Ga0207704_10595593
1009 Ga0207704_10751682
1010 Ga0207691_10044887
1011 Ga0207691_10896640
1012 Ga0207711_10006981
1013 Ga0207711_10084541
1014 Ga0207679_10180442
1015 Ga0207679_10933671
1016 Ga0207667_10000001
1017 Ga0207667_10007047
1018 Ga0207667_10012946
1019 Ga0207667_10024369
1020 Ga0207667_10143812
1021 Ga0207667_10381123
1022 Ga0207667_10485181
1023 Ga0207712_10029353
1024 Ga0207640_10007222
1025 Ga0207640_10012181
1026 Ga0207640_10015840
1027 Ga0207640_10197932
1028 Ga0207640_10306150
1029 Ga0207640_10488438
1030 Ga0207677_10671588
1031 Ga0207703_10000108
1032 Ga0207703_10000334
1033 Ga0207703_10023807
1034 Ga0207639_10005941
1035 Ga0207639_10012041
1036 Ga0207639_10044914
1037 Ga0207639_10102465
1038 Ga0207678_10000159
1039 Ga0207678_10265907
1040 Ga0207702_10009492
1041 Ga0207702_10176599
1042 Ga0207702_10672387
1043 Ga0207702_10996262
1044 Ga0207648_10500540
1045 Ga0207676_12498365
1046 Ga0207674_10060921
1047 Ga0207674_10064519
1048 Ga0207674_10392676
1049 Ga0207674_10402833
1050 Ga0207674_10767683
1051 Ga0207674_11164554
1052 Ga0207675_100000152
1053 Ga0207675_100993221
1054 Ga0207683_10043341
1055 Ga0207683_10154829
1056 Ga0207698_10000990
1057 Ga0209998_10091539
1058 Ga0209813_10000080
1059 Ga0207428_11002398
1060 Ga0268266_10000074
1061 Ga0268266_10262328
1062 Ga0268266_10429390
1063 Ga0268266_10464893
1064 Ga0268266_11223781
1065 Ga0307517_10020735
1066 Ga0307517_10107765
1067 Ga0314311_1049764
1068 Ga0307513_10059023
1069 Ga0307513_10120327
1070 Ga0307513_10310045
1071 Ga0307508_10001895
1072 Ga0307508_10019452
1073 Ga0307516_10522378
1074 Ga0307405_10205198
1075 Ga0307405_10649167
1076 Ga0307405_11008801
1077 Ga0307413_10006253
1078 Ga0307413_10019133
1079 Ga0307410_10226351
1080 Ga0307406_10583191
1081 Ga0307406_10772419
1082 Ga0307412_10006013
1083 Ga0307412_10007277
1084 Ga0307412_10227286
1085 Ga0307412_11226633
1086 Ga0307412_11517805
1087 Ga0307409_100213474
1088 Ga0307409_100644664
1089 Ga0307416_100292906
1090 Ga0307416_100313059
1091 Ga0307414_10109033
1092 Ga0307414_10181505
1093 Ga0307411_10486829
1094 Ga0307510_10001183
1095 Ga0307510_10261001
1096 Ga0373962_0052943
1097 Ga0373935_0458180
1098 Ga0395899_0001588
1099 Ga0395899_0108791
1100 Ga0395905_0105936
1101 Ga0395905_0788636
1102 Ga0395901_0170764
1103 Ga0237819_01081
1104 Ga0237816_03431
1105 Ga0436363_0767477
1106 Ga0436363_1436052
1107 Ga0439439_0173177
1108 Ga0439461_0006293
1109 Ga0439466_0040641
1110 Ga0439466_0081626
1111 Ga0439465_0001715
1112 Ga0439465_0097356
1113 Ga0451791_1619187
1114 Ga0451793_0812204
1115 Ga0451795_0649393
1116 Ga0451806_362630
1117 Ga0439431_0000273
1118 Ga0439431_0005938
1119 Ga0439442_008278
1120 Ga0439445_0003617
1121 Ga0439448_0044535
1122 Ga0439432_000602
1123 Ga0439432_010456
1124 Ga0439452_019566
1125 Ga0439452_034958
1126 Ga0439457_184949
1127 Ga0439462_0010698
1128 Ga0450912_001233
1129 Ga0450898_047909
1130 Ga0439446_0017794
1131 Ga0439446_0093073
1132 Ga0439434_0001243
1133 Ga0439434_0007070
1134 Ga0451577_0673083
1135 Ga0466961_0547444
1136 Ga0466963_0256355
1137 Ga0453684_0567135
1138 Ga0466971_0048636
1139 Ga0466967_1206154
1140 Ga0495629_0620640
1141 Ga0495638_0000732
1142 Ga0495638_0185589
1143 Ga0495653_0502299
1144 Ga0495650_0000196
1145 Ga0495650_0025448
1146 Ga0495584_0152256
1147 Ga0495585_0001312
1148 Ga0495585_0042674
1149 Ga0495585_0059598
1150 Ga0495585_0138433
1151 Ga0495596_0035016
1152 Ga0495607_0415768
1153 Ga0495583_0000122
1154 Ga0495583_0033001
1155 Ga0495583_0041362
1156 Ga0495583_0042880
1157 Ga0495583_0058831
1158 Ga0495583_0140962
1159 Ga0495606_0001040
1160 Ga0495606_0127749
1161 Ga0495606_0167192
1162 Ga0495610_0155863
1163 Ga0495616_0000014
1164 Ga0495616_0220080
1165 Ga0495631_0044637
1166 Ga0495631_0109912
1167 Ga0495631_0166285
1168 Ga0495632_0000023
1169 Ga0495637_0058299
1170 Ga0495643_0009740
1171 Ga0495643_0024451
1172 Ga0495643_0059613
1173 Ga0495643_0077047
1174 Ga0495648_0000387
1175 Ga0495648_0285912
1176 Ga0495663_0000019
1177 Ga0495663_0002458
1178 Ga0495642_0004460
1179 Ga0495642_0209885
1180 Ga0495652_0148941
1181 Ga0495654_0090582
1182 Ga0495587_0068991
1183 Ga0495597_0171973
1184 Ga0495622_0019053
1185 Ga0495633_0000054
1186 Ga0495633_0000855
1187 Ga0495633_0009384
1188 Ga0495633_0031325
1189 Ga0495668_0000022
1190 Ga0495668_0014880
1191 Ga0495668_0035790
1192 Ga0495668_0128035
1193 Ga0495625_0000031
1194 Ga0495625_0002639
1195 Ga0495625_0005816
1196 Ga0495625_0040267
1197 Ga0495625_0041777
1198 Ga0495625_0153293
1199 Ga0495625_0184678
1200 Ga0495625_0228289
1201 Ga0495661_0061552
1202 Ga0495623_0222065
1203 Ga0495669_0000150
1204 Ga0495670_0000016
1205 Ga0495670_0128453
1206 Ga0495670_0169227
1207 Ga0495649_0065764
1208 Ga0495649_0104448
1209 Ga0495649_0211668
1210 Ga0495649_0572197
1211 Ga0495660_0118968
1212 Ga0495636_0471082
1213 Ga0495672_0315479
1214 Ga0495687_003221
1215 Ga0495687_003498
1216 Ga0495677_0000624
1217 Ga0495677_0013565
1218 Ga0495677_0355977
1219 Ga0495681_0009672
1220 Ga0495681_0037527
1221 Ga0495681_0258582
1222 Ga0495686_0031275
1223 Ga0495686_0048867
1224 Ga0495686_0084580
1225 Ga0496101_0547716
1226 Ga0496102_0000022
1227 Ga0496102_0023768
1228 Ga0496103_0000075
1229 Ga0496103_0161159
1230 Ga0496103_0294326
1231 Ga0496104_0152127
1232 Ga0496105_0000560
1233 Ga0496107_0043777
1234 Ga0496108_0003451
1235 Ga0496108_0036644
1236 Ga0496109_0064817
1237 Ga0496109_1458732
1238 Ga0496110_0026786
1239 Ga0496110_0046556
1240 Ga0496110_0175070
1241 Ga0496111_0005794
1242 Ga0496111_0132493
1243 Ga0496112_0118065
1244 Ga0496112_0918236
1245 Ga0496113_0022268
1246 Ga0496114_0002996
1247 Ga0496115_0000029
1248 Ga0496115_0000304
1249 Ga0496116_0001492
1250 Ga0496116_0022564
1251 Ga0496116_0084609
1252 Ga0496117_0000439
1253 Ga0496117_0061017
1254 Ga0496118_0000039
1255 Ga0496118_0031550
1256 Ga0496118_0445344
1257 Ga0496119_0012306
1258 Ga0496120_0010920
1259 Ga0496120_0048868
1260 Ga0496121_0000269
1261 Ga0496121_0001561
1262 Ga0496121_0085910
1263 Ga0496121_0464062
1264 Ga0496122_0003788
1265 Ga0496122_0009783
1266 Ga0496122_0106266
1267 Ga0496122_0184855
1268 Ga0496122_0212331
1269 Ga0496122_0288143
1270 Ga0496122_0316531
1271 Ga0496123_0010349
1272 Ga0496123_0038434
1273 Ga0496123_0039137
1274 Ga0496123_0069837
1275 Ga0496124_0000076
1276 Ga0496124_0000354
1277 Ga0496124_0007794
1278 Ga0496124_0008572
1279 Ga0496124_0109927
1280 Ga0496124_0135047
1281 Ga0496124_0292780
1282 Ga0496124_0365420
1283 Ga0496125_0010283
1284 Ga0496125_0010592
1285 Ga0496125_0013726
1286 Ga0496125_0232964
1287 Ga0496125_0364332
1288 Ga0496126_0001441
1289 Ga0496126_0024310
1290 Ga0496126_0082405
1291 Ga0496126_0250147
1292 Ga0496126_0483254
1293 Ga0501290_002748
1294 Ga0501033_0823168
1295 Ga0501034_0590067
1296 Ga0501036_0146186
1297 Ga0501037_0742146
1298 Ga0501037_0846017
1299 Ga0501042_0798182
1300 Ga0501043_0869388
1301 Ga0501047_0300506
1302 Ga0501047_0648338
1303 Ga0501070_1132338
1304 Ga0501073_0462474
1305 Ga0501211_000334
1306 Ga0501223_000009
1307 Ga0501235_002808
1308 Ga0501235_210869
1309 Ga0501225_0000005
1310 Ga0501225_0017787
1311 Ga0501225_0019384
1312 Ga0501080_0696715
1313 Ga0501241_028309
1314 Ga0501241_036069
1315 Ga0501035_0711891
1316 Ga0501044_0170642
1317 Ga0501044_0434593
1318 nmdc:mga03683_32_c1
1319 nmdc:mga03683_63365_c1
1320 nmdc:mga03n38_17847_c1
1321 nmdc:mga03n38_28520_c1
1322 nmdc:mga00v17_260461_c1
1323 nmdc:mga0k408_106225_c1
1324 nmdc:mga0k408_192045_c1
1325 nmdc:mga0k408_391877_c1
1326 nmdc:mga0k408_7_c1
1327 nmdc:mga0k408_930120_c1
1328 nmdc:mga06z11_110828_c1
1329 nmdc:mga06z11_40_c1
1330 nmdc:mga04h51_98_c1
1331 nmdc:mga07m45_3_c1
1332 nmdc:mga07m45_565866_c1
1333 nmdc:mga07m45_78712_c1
1334 nmdc:mga0rr50_287476_c1
1335 nmdc:mga08x19_407838_c1
1336 nmdc:mga0sz30_111_c1
1337 Ga0495601_0446043
1338 Ga0500610_0002060
1339 Ga0500643_000835
1340 Ga0500643_002392
1341 Ga0500643_007692
1342 Ga0500643_042803
1343 Ga0500566_0390665
1344 Ga0500641_0008336
1345 Ga0500641_0190503
1346 Ga0500556_0030343
1347 Ga0500562_017035
1348 Ga0500562_036962
1349 Ga0500595_001009
1350 Ga0500595_005769
1351 Ga0500642_0021239
1352 Ga0500655_044261
1353 Ga0500658_0000579
1354 Ga0500658_0007859
1355 Ga0500559_0011280
1356 Ga0500559_0067868
1357 Ga0500559_0101948
1358 Ga0500568_0129596
1359 Ga0500573_0000041
1360 Ga0500573_0048640
1361 Ga0500585_083992
1362 Ga0500588_0007419
1363 Ga0500604_0063665
1364 Ga0500604_0306075
1365 Ga0500619_003433
1366 Ga0500627_0000721
1367 Ga0500636_0073030
1368 Ga0500645_000231
1369 Ga0500596_003767
1370 2512643996
1371 2600201935
1372 2600227000
1373 2643948760
1374 2644127375
1375 2778126651
1376 2819715548
1377 2830076300
1378 2885432520
1379 2928029803
1380 2928529567
1381 2928970945
1382 2946790830
1383 2984556638
1384 2984565189
1385 2990265997
1386 2993356265
1387 2993696211
1388 8057105513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

22

150

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ppd-assembly3.cif.gz_E-6 pdua k26a, crystal form 2 0.6609 62 77
7yyf-assembly4.cif.gz_D orthorombic crystal structure of ythdf1 yth domain (g459n mutant) form ii 0.56 46 88
5y6c-assembly2.cif.gz_B crystal structure of zmasch s128a mutant protein from zymomonas mobilis 0.5523 4 102
8g66-assembly1.cif.gz_B structure with sj3149 0.5519 58 88
2e5o-assembly1.cif.gz_A 'solution structure of the trip_4c domain of target of activating signal cointegrator 1 0.5417 2 101
ID Description Score Start End Superfamily
af_E9QD17_90_189_3.30.70.960 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain 0.6106 54 77 3.30.70.960
af_Q03957_171_264_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5879 60 78 3.30.200.20
af_Q8I4N4_415_691_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5682 60 78 1.10.510.10
af_K7LMR0_63_217_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.5651 1 101 3.10.590.10
2nwaA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.5501 25 81 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A2D8TE65-F1-model_v4 Uncharacterized protein 0.9917 1 67
AF-A0A2D8TE65-F1-model_v4 Uncharacterized protein 0.9773 1 67
AF-A0A2R7IW93-F1-model_v4 DUF1489 domain-containing protein 0.9581 1 107
AF-A0A520HM13-F1-model_v4 DUF1489 family protein 0.9289 3 112
AF-A0A2R7IW93-F1-model_v4 DUF1489 domain-containing protein 0.9244 1 107

Map